close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 flying,first=0,duration=500,cooldown=500
1 position_switch,first=0,duration=500,cooldown=500
2 stun,duration=1.0,first=45.0,period=45.0
3 stun,duration=1.0,first=57.0,period=57.0
4 damage,first=6.0,period=6.0,last=59.5,amount=44000,type=shadow
5 damage,first=60.0,period=5.0,last=119.5,amount=44855,type=shadow
6 damage,first=120.0,period=4.0,last=179.5,amount=44855,type=shadow
7 damage,first=180.0,period=3.0,last=239.5,amount=44855,type=shadow
8 damage,first=240.0,period=2.0,last=299.5,amount=44855,type=shadow
9 damage,first=300.0,period=1.0,amount=44855,type=shadow
HPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.93 - 3.10 - - - 2.41 - 1.28 1.11 1.38 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.92 - 3.12 - - - 2.41 - 1.19 1.01 1.36 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.92 - 3.06 - - - 2.40 - 1.30 1.11 1.43 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.93 - 3.10 - - - 2.39 - 1.25 1.13 1.35 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.99 - 3.14 - - - 2.20 - 1.26 1.19 1.41 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.98 - 3.17 - - - 2.34 - 1.32 1.19 1.37 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.97 - 3.05 - - - 2.33 - 1.04 0.82 1.21 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 4.07 - 3.21 - - - 2.38 - 1.02 0.76 1.23 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 4.06 - 3.21 - - - 2.37 - 1.13 0.84 1.24 - - - - - - wowhead lootrank

priest_90_di_fdcl : 102900 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
102899.9 102899.9 20.25 / 0.02% 3804 / 3.7% 25.0 5494.4 5494.4 41.80 / 0.76% 7472 / 136.0% 1.4 3953.3 3884.7 Mana 0.71% 37.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.93 0.00 3.10 2.41 1.28 1.11 1.38
Normalized 1.00 0.00 0.79 0.61 0.33 0.28 0.35
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.93, SpellDamage=3.10, HitRating=2.41, CritRating=1.28, HasteRating=1.11, MasteryRating=1.38 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.93, SpellDamage=3.10, HitRating=0.00, CritRating=1.28, HasteRating=1.11, MasteryRating=1.38 )

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:341638|218942|185034|121632|99921|97646|81827|50143&chds=0,683277&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++341638++devouring_plague,9482C9,0,0,15|t++218942++shadow_word_pain,9482C9,1,0,15|t++185034++vampiric_touch,9482C9,2,0,15|t++121632++halo,9482C9,3,0,15|t++99921++shadow_word_death,9482C9,4,0,15|t++97646++mind_blast,9482C9,5,0,15|t++81827++mind_spike,4A79D3,6,0,15|t++50143++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,14,10,9,9,8,7,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|devouring_plague_tick|vampiric_touch|mind_spike|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.93,3.10,2.41,1.38,1.28,1.11|3.90,3.07,2.38,1.35,1.25,1.08|3.96,3.12,2.44,1.41,1.31,1.14&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.93++Int,FFFFFF,0,0,15,0.1,e|t++++3.10++SP,FFFFFF,0,1,15,0.1,e|t++++2.41++Hit,FFFFFF,0,2,15,0.1,e|t++++1.38++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.28++Crit,FFFFFF,0,4,15,0.1,e|t++++1.11++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.726&chtt=Scale Factors|priest_90_di_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6864432211100yywwvutrqonnnmmlljiiiihhhhhhhhhhhgfeeeeeeddeddddddddccccddddccccdccbbaaaaaaaaabbbbbbbbabcccbbbcccccdddddeefffeeeeeeeedddcccccbbaaaaaabcccccccccdddddccccddcccbabccdddeeefggggfgggggihggffeeddccdddddeeeeeedddcbbcccbbbbbbbbbbbbbbbcdddddeeeeeeeeeeeeeeedddccccbbbaaaaaZYYYYYZZZaaaaabbbbbbbcddeefffgffffffgggggggghhhhhhhiiijjjijjkkllmmmnnoooopponnpqqqqqqqqqppo&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5343,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=102900|max=192597&chxp=1,1,53,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,24,0,16,48,40,64,192,272,344,416,552,624,864,1080,1592,1696,2040,2520,2560,2840,2720,2504,3032,3064,2904,2960,2496,2104,1856,1840,1480,1304,1024,680,624,440,248,320,224,128,88,24,48,32,48,0,8&chds=0,3064&chbh=5&chxt=x&chxl=0:|min=93972|avg=102900|max=111385&chxp=0,1,51,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.9,14.0,9.8,6.2,5.7,5.5,3.8,2.9,0.7,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 171.6s|mind_blast 51.1s|mind_spike 35.8s|vampiric_touch 22.6s|shadow_word_pain 20.9s|devouring_plague 20.1s|shadow_word_death 14.0s|halo 10.7s|shadowfiend 2.4s|waiting 2.6s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl 102900
devouring_plague 6672 (18765) 6.5% (18.2%) 17.0 22.59sec 404336 341638 118468 245561 143764 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.99 16.99 0.00 0.00 1.1835 0.0000 2441875.02 2441875.02 0.00 341638.33 341638.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.61 80.10% 118468.34 107519 143944 118460.73 110440 125589 1611827 1611827 0.00
crit 3.38 19.90% 245561.08 221488 296525 239451.36 0 296525 830048 830048 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2883 2.8% 44.1 8.26sec 23948 0 19772 40968 23978 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.06 44.00 0.00 0.00 0.0000 0.0000 1055038.54 1055038.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.27 80.16% 19771.85 17856 23904 19771.40 18685 21222 697341 697341 0.00
crit 8.73 19.84% 40967.68 36784 49242 40957.47 0 49242 357697 357697 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9210 9.0% 17.0 22.59sec 198463 0 0 0 0 0.0% 0.0% 0.0% 0.0% 141.1 19683 40770 23894 20.0% 0.0% 28.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.99 16.99 141.08 141.08 0.0000 0.7461 3371041.87 3371041.87 0.00 32023.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.9 80.03% 19683.02 17856 28143 19682.07 18672 20583 2222462 2222462 0.00
crit 28.2 19.97% 40769.85 36784 57975 40763.84 37920 43975 1148580 1148580 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3540) 0.0% (3.4%) 9.0 42.02sec 143971 121632 0 0 0 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1838 0.0000 0.00 0.00 0.00 121631.55 121631.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.18 79.73% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.82 20.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3540 3.4% 9.0 42.02sec 143971 0 118630 245490 143973 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1295740.89 1295740.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.20 80.02% 118629.86 109581 139821 118628.10 109581 129740 854387 854387 0.00
crit 1.80 19.98% 245489.74 225736 288030 213321.39 0 288030 441354 441354 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 5494 100.0% 9.0 42.02sec 223439 0 19567 25770 20995 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.79 0.00 0.00 0.0000 0.0000 2010950.98 18925846.10 89.37 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.73 76.97% 19566.65 0 184948 19568.35 0 107123 1442581 11687189 87.63
crit 22.06 23.03% 25769.58 0 380994 25742.36 0 196104 568370 7238657 92.13
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13644 13.3% 43.3 8.45sec 115266 97646 94902 196611 115266 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.32 43.32 0.00 0.00 1.1805 0.0000 4993630.52 4993630.52 0.00 97646.28 97646.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.65 79.98% 94902.15 86183 115909 94899.94 91590 98358 3288256 3288256 0.00
crit 8.67 20.02% 196611.39 177536 238773 196604.36 177536 232190 1705374 1705374 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17919 (23505) 17.4% (22.8%) 100.3 3.54sec 85755 50143 0 0 0 0.0% 0.0% 0.0% 0.0% 214.1 25228 52299 30634 20.0% 0.0% 43.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.32 100.32 214.08 214.08 1.7102 0.7363 6558184.93 6558184.93 0.00 50143.37 50143.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.3 80.03% 25228.46 22887 30640 25228.53 24508 25889 4322428 4322428 0.00
crit 42.7 19.97% 52299.22 47146 63119 52296.33 49609 55490 2235757 2235757 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5587 5.4% 66.8 5.25sec 30621 0 25234 52287 30622 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.78 66.77 0.00 0.00 0.0000 0.0000 2044813.32 2044813.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.48 80.08% 25234.45 22887 30640 25234.90 24124 26403 1349429 1349429 0.00
crit 13.30 19.92% 52287.50 47146 63119 52289.66 47146 57864 695384 695384 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8002 7.8% 30.4 11.36sec 96469 81827 79417 164587 96469 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.36 30.36 0.00 0.00 1.1789 0.0000 2928844.09 2928844.09 0.00 81827.29 81827.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.28 79.98% 79417.00 72412 97688 79424.34 74736 85940 1928385 1928385 0.00
crit 6.08 20.02% 164587.39 149169 201238 164306.53 0 201238 1000459 1000459 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3813 3.7% 11.9 4.86sec 117566 99921 96251 199795 117565 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.87 11.87 0.00 0.00 1.1766 0.0000 1395493.09 1395493.09 0.00 99920.74 99920.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.43 79.41% 96250.81 83662 112752 96236.20 86922 104958 907309 907309 0.00
crit 2.44 20.59% 199794.59 172343 232270 186375.45 0 232270 488184 488184 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9511 (12489) 9.2% (12.1%) 17.7 21.21sec 257778 218942 0 0 0 0.0% 0.0% 0.0% 0.0% 179.8 14690 30368 19364 29.8% 0.0% 98.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.73 17.73 179.76 179.76 1.1774 2.0056 3480846.64 3480846.64 0.00 11984.80 218942.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.2 70.19% 14690.38 13422 17966 14690.69 14155 15216 1853510 1853510 0.00
crit 53.6 29.81% 30368.11 27649 37009 30366.64 28815 31807 1627337 1627337 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2979 2.9% 56.2 6.41sec 19414 0 14724 30468 19440 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.16 56.08 0.00 0.00 0.0000 0.0000 1090227.70 1090227.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.28 70.05% 14724.20 13422 17966 14724.13 14007 15516 578402 578402 0.00
crit 16.80 29.95% 30468.23 27649 37009 30466.62 28147 33141 511825 511825 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2237 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3727 3.6% 63.4 5.69sec 21520 0 18331 36880 22027 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.39 61.93 0.00 0.00 0.0000 0.0000 1364181.43 1364181.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.59 80.07% 18331.17 16669 22484 18330.58 17582 19158 909050 909050 0.00
crit 12.34 19.93% 36880.41 33338 44968 36879.21 33338 44968 455131 455131 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8722 (11445) 8.5% (11.1%) 19.2 18.99sec 218235 185034 0 0 0 0.0% 0.0% 0.0% 0.0% 159.5 16504 34189 20017 19.9% 0.0% 97.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.19 19.19 159.48 159.48 1.1795 2.2364 3192381.77 3192381.77 0.00 11043.44 185033.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.8 80.13% 16503.96 15001 20366 16503.86 15983 17096 2109201 2109201 0.00
crit 31.7 19.87% 34189.35 30902 41955 34188.91 32195 36540 1083180 1083180 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2722 2.6% 49.8 7.15sec 20026 0 16530 34253 20048 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.76 49.70 0.00 0.00 0.0000 0.0000 996417.77 996417.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.83 80.15% 16529.67 15001 20366 16530.06 15614 17361 658414 658414 0.00
crit 9.87 19.85% 34253.23 30902 41955 34253.26 30902 39088 338004 338004 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52135 / 3969
melee 52135 3.9% 26.9 14.61sec 53903 54819 49923 100913 53902 20.6% 7.1% 24.2% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.95 26.95 0.00 0.00 0.9833 0.0000 1452644.45 1452644.45 0.00 54818.84 54818.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.34 45.81% 49922.65 38145 58728 49916.05 43704 57171 616272 616272 0.00
crit 5.55 20.60% 100912.83 76291 117456 100687.51 0 117456 560263 560263 0.00
glance 6.52 24.20% 37603.06 28609 44046 37576.26 0 44046 245228 245228 0.00
block 0.61 2.28% 50228.16 38145 58728 23353.93 0 58728 30881 30881 0.00
parry 1.92 7.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1874 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.40%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 11.4 0.4 29.2sec 28.2sec 5.03% 25.41%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.03%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.6sec 108.6sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.62%
glyph_mind_spike 22.3 8.1 15.6sec 11.4sec 34.74% 53.94%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:27.46%
  • glyph_mind_spike_2:7.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.94% 11.94%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.94%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.4 36.1sec 20.3sec 43.94% 44.31%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.94%

    Trigger Attempt Success

    • trigger_pct:2.17%
light_of_the_cosmos 8.0 0.0 48.8sec 48.8sec 42.66% 42.66%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.66%

    Trigger Attempt Success

    • trigger_pct:15.15%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.29% 49.41%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.29%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 26.3 5.1 13.4sec 11.2sec 21.62% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:19.70%
  • surge_of_darkness_2:1.92%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
vampiric_embrace 1.0 0.0 190.9sec 190.9sec 3.89% 4.05%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.89%

Trigger Attempt Success

  • trigger_pct:95.17%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.56% 80.40%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl
devouring_plague Shadow Orb 17.0 51.0 3.0 3.0 134777.4
halo Mana 9.0 364500.0 40500.0 40500.0 3.6
mind_blast Mana 43.3 282048.5 6510.4 6510.4 17.7
mind_flay Mana 100.3 300957.1 3000.0 3000.0 28.6
shadow_word_death Mana 11.9 92590.4 7800.0 7800.4 15.1
shadow_word_pain Mana 17.7 234070.8 13200.0 13200.0 19.5
vampiric_touch Mana 19.2 172745.3 9000.0 9000.0 24.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 25.03 131685.55 (9.26%) 5260.52 93609.65 41.55%
Shadow Orbs from Mind Blast Shadow Orb 43.32 43.32 (87.83%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.00 6.00 (12.17%) 1.00 0.00 0.00%
Devouring Plague Health Health 185.09 1924965.79 (81.74%) 10400.35 645261.31 25.11%
Vampiric Touch Mana Mana 209.18 914974.42 (64.35%) 4374.06 191015.66 17.27%
mp5_regen Mana 1463.00 375141.31 (26.38%) 256.42 63758.69 14.53%
vampiric_embrace Health 50.34 430071.59 (18.26%) 8543.42 257945.77 37.49%
pet - shadowfiend
vampiric_embrace Health 0.11 1087.21 (100.00%) 9934.34 942.43 46.43%
Resource RPS-Gain RPS-Loss
Health 13478.16 14867.22
Mana 3884.70 3953.31
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health -45485.53 -357837.89 462887.00
Mana 274891.89 208500.00 300000.00
Shadow Orb 1.37 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.7%
shadowfiend-Mana Cap 14.7%
lightwell-Mana Cap 14.7%

Procs

Count Interval
Shadowy Recall Extra Tick 216.6 1.7sec
Shadowy Apparition Procced 63.4 5.7sec
Divine Insight Mind Blast CD Reset 20.8 28.2sec
FDCL Mind Spike proc 31.4 11.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl Damage Per Second
Count 49992
Mean 102899.90
Minimum 93971.61
Maximum 111384.84
Spread ( max - min ) 17413.23
Range [ ( max - min ) / 2 * 100% ] 8.46%
Standard Deviation 2309.8890
5th Percentile 99114.75
95th Percentile 106722.81
( 95th Percentile - 5th Percentile ) 7608.05
Mean Distribution
Standard Deviation 10.3310
95.00% Confidence Intervall ( 102879.65 - 102920.14 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1935
0.1 Scale Factor Error with Delta=300 45547
0.05 Scale Factor Error with Delta=300 182190
0.01 Scale Factor Error with Delta=300 4554764
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 102899.90
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36208717.57
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_di_fdcl Healing Per Second
Count 49992
Mean 5494.40
Minimum 0.00
Maximum 29848.55
Spread ( max - min ) 29848.55
Range [ ( max - min ) / 2 * 100% ] 271.63%
Standard Deviation 4767.9251
5th Percentile 843.35
95th Percentile 15788.06
( 95th Percentile - 5th Percentile ) 14944.71
Mean Distribution
Standard Deviation 21.3245
95.00% Confidence Intervall ( 5452.61 - 5536.20 )
Normalized 95.00% Confidence Intervall ( 99.24% - 100.76% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28927
0.1% Error 2892772
0.1 Scale Factor Error with Delta=300 194062
0.05 Scale Factor Error with Delta=300 776251
0.01 Scale Factor Error with Delta=300 19406289
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 5494.40
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2010950.98
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl Healing taken Per Second
Count 49992
Mean 7043.81
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 228.27
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.99 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.87 shadow_word_death,if=active_enemies<=5
F 44.28 mind_blast,if=active_enemies<=6&cooldown_react
G 17.73 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 20.76 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.38 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.95 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 12.99 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.10 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 16.91 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 26.99 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 55.32 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTQFRTFMGHTFTRTFTHRGTFLMTFQQQQQQQFRHTGFMRTRTQFRTHFTGTFLDFRTHTFRTGRTQFMRRTHQFRTQFGTLTHFRTRTFMGTHFRTQFRTGRHFHLMRTQBFJRTGFHRTQQQQQQFMTFTGHTLRFTFMHRTGTFTJRRQFRTHJFMFGLQQQQQFTRTFHMTGQFRTRFHTFMTGLRFTHTRFEDETRGFTEEHTQFKMTEETRQFLGT9EDEHFTEEQFMRGTBEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb : 103751 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103751.2 103751.2 19.64 / 0.02% 3670 / 3.5% 23.4 5239.9 5239.9 39.97 / 0.76% 7085 / 135.2% 1.3 4047.1 3937.5 Mana 0.61% 32.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.92 0.00 3.12 2.41 1.19 1.01 1.36
Normalized 1.00 0.00 0.79 0.61 0.30 0.26 0.35
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_di_mb": Intellect=3.92, SpellDamage=3.12, HitRating=2.41, CritRating=1.19, HasteRating=1.01, MasteryRating=1.36 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_mb": Intellect=3.92, SpellDamage=3.12, HitRating=0.00, CritRating=1.19, HasteRating=1.01, MasteryRating=1.36 )

Charts

http://6.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:343089|218091|184307|121275|100070|97733|50666&chds=0,686179&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++343089++devouring_plague,9482C9,0,0,15|t++218091++shadow_word_pain,9482C9,1,0,15|t++184307++vampiric_touch,9482C9,2,0,15|t++121275++halo,9482C9,3,0,15|t++100070++shadow_word_death,9482C9,4,0,15|t++97733++mind_blast,9482C9,5,0,15|t++50666++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,14,10,10,9,9,7,7,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|devouring_plague_tick|vampiric_touch|mind_flay_mastery|devouring_plague|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.92,3.12,2.41,1.36,1.19,1.01|3.89,3.09,2.38,1.33,1.16,0.98|3.95,3.14,2.44,1.39,1.22,1.03&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.92++Int,FFFFFF,0,0,15,0.1,e|t++++3.12++SP,FFFFFF,0,1,15,0.1,e|t++++2.41++Hit,FFFFFF,0,2,15,0.1,e|t++++1.36++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.19++Crit,FFFFFF,0,4,15,0.1,e|t++++1.01++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.715&chtt=Scale Factors|priest_90_di_mb%20Damage%20Per%20Second&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:56678665445442200zyxwutrqoonmmljiijhihihhhhhhhhgfeeeeeefgggghiiijjjjjkklllkjjjihfedccbaaaaabbbbbbbbbbcddcbbcccddcdeefghijjkkkkklkkkkkkjiihgfedcbbbbccddddddddddeedcdddddddcbbbabbcccddeeffgghhhhiijjiihhggggggffeeeefffeddccbbbbbbbbbbbbbbbbcddeghhijklmmmmmmmmmmllkjihgffeccbbbaaaZYYYYYZaaaaabbbbbbbbbcefghijklkkllmmmmnnnnnnmmlkkjjklkkkkjkkllmmnnoooppppqqpppqqpppppooonmm&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5694,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103751|max=182196&chxp=1,1,57,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,16,0,32,32,112,48,144,224,408,440,688,792,1128,1440,1848,1840,2128,2240,2552,3032,2968,2832,3144,3088,2808,2928,2216,2232,1728,1440,1392,960,944,608,488,304,224,168,104,64,88,48,24,8,8,0,0,8&chds=0,3144&chbh=5&chxt=x&chxl=0:|min=95443|avg=103751|max=112790&chxp=0,1,48,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:55.9,13.4,6.2,5.7,5.3,3.8,2.9,1.9,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 204.5s|mind_blast 48.9s|vampiric_touch 22.8s|shadow_word_pain 21.0s|devouring_plague 19.4s|shadow_word_death 13.8s|halo 10.7s|mindbender 6.8s|waiting 2.2s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb 103751
devouring_plague 6441 (18151) 6.2% (17.5%) 16.4 23.55sec 406120 343089 118620 245660 144105 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.36 16.36 0.00 0.00 1.1837 0.0000 2357261.66 2357261.66 0.00 343089.41 343089.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.08 79.94% 118619.67 107519 143944 118614.76 110979 128326 1551096 1551096 0.00
crit 3.28 20.06% 245659.84 221488 296525 238758.49 0 296525 806166 806166 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2797 2.7% 42.7 8.55sec 23990 0 19793 41021 24025 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.67 42.61 0.00 0.00 0.0000 0.0000 1023756.86 1023756.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.12 80.07% 19792.92 17856 23904 19792.76 18533 21138 675297 675297 0.00
crit 8.49 19.93% 41021.15 36784 49242 41014.90 36784 49242 348460 348460 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8913 8.6% 16.4 23.55sec 199429 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.3 19709 40844 23930 20.0% 0.0% 27.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.36 16.36 136.32 136.32 0.0000 0.7454 3262221.72 3262221.72 0.00 32103.74 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.1 80.02% 19708.65 17856 30565 19708.05 18554 20631 2150026 2150026 0.00
crit 27.2 19.98% 40844.07 36784 62963 40838.33 37941 44790 1112196 1112196 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3531) 0.0% (3.4%) 9.0 42.01sec 143590 121275 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1841 0.0000 0.00 0.00 0.00 121275.15 121275.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 80.08% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.79 19.92% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3531 3.4% 9.0 42.01sec 143590 0 118752 245837 143590 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1292307.97 1292307.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.24 80.46% 118751.60 109581 139821 118755.33 109581 131152 859878 859878 0.00
crit 1.76 19.54% 245836.87 225736 288030 211390.46 0 288030 432430 432430 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 5240 100.0% 9.0 42.01sec 213090 0 18523 24948 20012 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.82 0.00 0.00 0.0000 0.0000 1917811.82 18978728.57 89.89 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.61 76.82% 18523.18 0 184948 18503.40 0 118788 1363749 11681597 88.32
crit 22.21 23.18% 24948.15 0 380994 25009.63 0 189935 554063 7297131 92.37
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13068 12.6% 41.5 8.83sec 115326 97733 94897 196612 115325 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.47 41.47 0.00 0.00 1.1800 0.0000 4782874.18 4782874.18 0.00 97733.34 97733.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.14 79.92% 94896.96 86183 115909 94897.15 91416 98940 3145196 3145196 0.00
crit 8.33 20.08% 196611.66 177536 238773 196632.19 177536 221218 1637678 1637678 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 21567 (28314) 20.8% (27.3%) 117.5 3.04sec 88207 50666 0 0 0 0.0% 0.0% 0.0% 0.0% 257.8 25218 52276 30615 19.9% 0.0% 52.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.48 117.48 257.83 257.83 1.7410 0.7375 7893628.16 7893628.16 0.00 50665.79 50665.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 206.4 80.05% 25217.54 22887 30640 25217.59 24616 25789 5204884 5204884 0.00
crit 51.4 19.95% 52275.98 47146 63119 52278.10 49437 54989 2688744 2688744 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6747 6.5% 80.7 4.38sec 30617 0 25225 52288 30621 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.65 80.64 0.00 0.00 0.0000 0.0000 2469300.12 2469300.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.56 80.06% 25225.32 22887 30640 25225.94 24306 26229 1628569 1628569 0.00
crit 16.08 19.94% 52287.98 47146 63119 52289.67 47430 57746 840731 840731 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 5.7 60.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.69 5.69 0.00 0.00 1.1929 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3769 3.6% 11.7 4.83sec 117662 100070 96248 199751 117662 20.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.72 11.72 0.00 0.00 1.1758 0.0000 1379459.40 1379459.40 0.00 100069.60 100069.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.30 79.31% 96247.74 83662 112752 96222.20 83662 107045 894954 894954 0.00
crit 2.43 20.69% 199751.42 172343 232270 186963.35 0 232270 484505 484505 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9527 (12511) 9.2% (12.1%) 17.8 21.19sec 256938 218091 0 0 0 0.0% 0.0% 0.0% 0.0% 179.9 14700 30383 19383 29.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.82 17.82 179.89 179.89 1.1781 2.0051 3486920.04 3486920.04 0.00 11996.35 218091.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.2 70.14% 14699.64 13422 17966 14699.92 14219 15207 1854689 1854689 0.00
crit 53.7 29.86% 30383.25 27649 37009 30381.47 28936 31740 1632231 1632231 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2984 2.9% 56.2 6.40sec 19429 0 14735 30479 19451 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.21 56.15 0.00 0.00 0.0000 0.0000 1092122.51 1092122.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.33 70.05% 14734.89 13422 17966 14734.99 13970 15490 579529 579529 0.00
crit 16.82 29.95% 30479.08 27649 37009 30480.46 28436 33666 512594 512594 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3732 3.6% 63.5 5.69sec 21518 0 18340 36878 22047 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.47 61.95 0.00 0.00 0.0000 0.0000 1365865.61 1365865.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.56 80.00% 18339.56 16669 22484 18339.12 17645 19211 908984 908984 0.00
crit 12.39 20.00% 36877.87 33338 44968 36880.20 33338 41453 456882 456882 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8722 (11458) 8.4% (11.0%) 19.3 19.01sec 217393 184307 0 0 0 0.0% 0.0% 0.0% 0.0% 159.4 16503 34203 20029 19.9% 0.0% 97.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.29 19.29 159.38 159.38 1.1796 2.2367 3192214.68 3192214.68 0.00 11058.29 184306.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.6 80.08% 16502.89 15001 20366 16502.89 15841 17167 2106179 2106179 0.00
crit 31.8 19.92% 34203.41 30902 41955 34201.40 32197 36494 1086036 1086036 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2736 2.6% 49.9 7.12sec 20067 0 16535 34281 20090 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.91 49.85 0.00 0.00 0.0000 0.0000 1001498.62 1001498.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.87 79.97% 16535.11 15001 20366 16535.05 15785 17445 659185 659185 0.00
crit 9.99 20.03% 34280.81 30902 41955 34275.50 30902 39662 342314 342314 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37172 / 9217
melee 37172 8.9% 81.3 4.17sec 41487 39636 38652 78042 41488 20.3% 7.4% 23.9% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 81.31 0.00 0.00 1.0467 0.0000 3373516.79 3373516.79 0.00 39636.21 39636.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.42 46.02% 38652.02 30516 46982 38652.34 35933 40826 1446453 1446453 0.00
crit 16.48 20.26% 78042.49 61032 93964 78039.14 70034 87565 1285875 1285875 0.00
glance 19.47 23.95% 29046.38 22887 35237 29044.74 26356 32092 565670 565670 0.00
block 1.95 2.40% 38691.28 30516 46982 33193.83 0 46982 75518 75518 0.00
parry 5.99 7.36% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.7 19.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.69 18.69 0.00 0.00 1.1871 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.39%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 11.3 0.5 29.6sec 28.3sec 5.68% 25.91%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.68%

Trigger Attempt Success

  • trigger_pct:4.98%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.5sec 108.5sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.53%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.5 36.3sec 20.2sec 44.02% 44.46%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.02%

    Trigger Attempt Success

    • trigger_pct:2.17%
light_of_the_cosmos 8.0 0.0 48.6sec 48.6sec 42.91% 42.91%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.91%

    Trigger Attempt Success

    • trigger_pct:15.18%
shadow_word_death_reset_cooldown 5.9 0.0 10.2sec 10.2sec 9.32% 49.24%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.32%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 1.0 0.0 192.7sec 192.7sec 3.91% 4.11%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.91%

Trigger Attempt Success

  • trigger_pct:95.55%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.7 0.0 19.8sec 19.8sec 85.38% 84.00%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.20% 2.20%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.20%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb
devouring_plague Shadow Orb 16.4 49.1 3.0 3.0 135372.6
halo Mana 9.0 364500.0 40500.0 40500.0 3.5
mind_blast Mana 41.5 263967.8 6364.8 6364.9 18.1
mind_flay Mana 117.5 352449.6 3000.0 3000.0 29.4
shadow_word_death Mana 11.7 91450.9 7800.0 7800.3 15.1
shadow_word_pain Mana 17.8 235245.1 13200.0 13200.0 19.5
vampiric_touch Mana 19.3 173617.9 9000.0 9000.0 24.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 75.33 214305.53 (14.87%) 2845.04 115694.44 35.06%
Shadow Orbs from Mind Blast Shadow Orb 41.47 41.47 (87.46%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.95 5.95 (12.54%) 1.00 0.00 0.00%
Devouring Plague Health Health 178.94 1854391.35 (82.10%) 10363.43 630423.10 25.37%
Vampiric Touch Mana Mana 209.23 870809.28 (60.43%) 4162.02 235004.64 21.25%
mp5_regen Mana 1463.00 355996.22 (24.70%) 243.33 82903.78 18.89%
vampiric_embrace Health 52.64 404203.27 (17.90%) 7678.59 259217.83 39.07%
pet - mindbender
vampiric_embrace Health 11.12 75404.12 (100.00%) 6779.09 64197.16 45.99%
Resource RPS-Gain RPS-Loss
Health 13488.12 14867.22
Mana 3937.46 4047.08
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health -41839.68 -346196.52 462887.00
Mana 259878.56 221400.00 300000.00
Shadow Orb 1.35 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 19.1%
shadowfiend-Mana Cap 19.1%
lightwell-Mana Cap 19.1%

Procs

Count Interval
Shadowy Recall Extra Tick 229.3 1.6sec
Shadowy Apparition Procced 63.5 5.7sec
Divine Insight Mind Blast CD Reset 20.7 28.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_di_mb Damage Per Second
Count 49992
Mean 103751.22
Minimum 95443.17
Maximum 112790.03
Spread ( max - min ) 17346.86
Range [ ( max - min ) / 2 * 100% ] 8.36%
Standard Deviation 2240.7689
5th Percentile 100107.31
95th Percentile 107446.88
( 95th Percentile - 5th Percentile ) 7339.57
Mean Distribution
Standard Deviation 10.0218
95.00% Confidence Intervall ( 103731.58 - 103770.87 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1791
0.1 Scale Factor Error with Delta=300 42862
0.05 Scale Factor Error with Delta=300 171450
0.01 Scale Factor Error with Delta=300 4286252
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103751.22
Distribution Chart

Damage

Sample Data
Count 49992
Mean 34599431.52
Distribution Chart

DTPS

Sample Data priest_90_di_mb Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_di_mb Healing Per Second
Count 49992
Mean 5239.92
Minimum 0.00
Maximum 31964.83
Spread ( max - min ) 31964.83
Range [ ( max - min ) / 2 * 100% ] 305.01%
Standard Deviation 4559.4958
5th Percentile 805.98
95th Percentile 14975.75
( 95th Percentile - 5th Percentile ) 14169.76
Mean Distribution
Standard Deviation 20.3923
95.00% Confidence Intervall ( 5199.95 - 5279.89 )
Normalized 95.00% Confidence Intervall ( 99.24% - 100.76% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29085
0.1% Error 2908573
0.1 Scale Factor Error with Delta=300 177466
0.05 Scale Factor Error with Delta=300 709867
0.01 Scale Factor Error with Delta=300 17746687
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 5239.92
Distribution Chart

Heal

Sample Data
Count 49992
Mean 1917811.82
Distribution Chart

HTPS

Sample Data priest_90_di_mb Healing taken Per Second
Count 49992
Mean 7317.42
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 198.82
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 5.69 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.79 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.72 shadow_word_death,if=active_enemies<=5
F 42.81 mind_blast,if=active_enemies<=6&cooldown_react
G 17.82 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 20.65 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.96 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 12.57 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.02 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 14.77 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 57.01 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTQFTQFMTGHTFTFTHTGLFMTQFHTATGFTFTHFMTGTLFTTHFTFGMTHFTATQFTGLTHQFTFMTGTHFTFTGLHFMTTAFTGHFTFKMTHLGFTFTTFHMTGTFTATFHTLTGTFMTHFTTGTFTHQFMTLTGFTAHFTEDEFTGPEEFHMTEEFLTE9DEFGHTPEEFMTEEFG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi : 102953 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
102953.2 102953.2 19.87 / 0.02% 3706 / 3.6% 22.8 8348.0 8348.0 51.99 / 0.62% 9647 / 115.6% 1.9 4333.0 4194.5 Mana 0.56% 33.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.92 0.00 3.06 2.40 1.30 1.11 1.43
Normalized 1.00 0.00 0.78 0.61 0.33 0.28 0.37
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_di_swi": Intellect=3.92, SpellDamage=3.06, HitRating=2.40, CritRating=1.30, HasteRating=1.11, MasteryRating=1.43 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_swi": Intellect=3.92, SpellDamage=3.06, HitRating=0.00, CritRating=1.30, HasteRating=1.11, MasteryRating=1.43 )

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:340784|188357|183240|167204|121006|100019|97454|50812&chds=0,681569&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++340784++devouring_plague,9482C9,0,0,15|t++188357++shadow_word_pain,9482C9,1,0,15|t++183240++vampiric_touch,9482C9,2,0,15|t++167204++shadow_word_insanity,9482C9,3,0,15|t++121006++halo,9482C9,4,0,15|t++100019++shadow_word_death,9482C9,5,0,15|t++97454++mind_blast,9482C9,6,0,15|t++50812++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,13,9,9,9,8,6,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|devouring_plague_tick|vampiric_touch|shadow_word_insanity|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|devouring_plague_mastery|shadow_word_pain_mastery|vampiric_touch_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.92,3.06,2.40,1.43,1.30,1.11|3.89,3.03,2.37,1.40,1.27,1.08|3.95,3.09,2.43,1.46,1.33,1.14&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.92++Int,FFFFFF,0,0,15,0.1,e|t++++3.06++SP,FFFFFF,0,1,15,0.1,e|t++++2.40++Hit,FFFFFF,0,2,15,0.1,e|t++++1.43++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.30++Crit,FFFFFF,0,4,15,0.1,e|t++++1.11++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.710&chtt=Scale Factors|priest_90_di_swi%20Damage%20Per%20Second&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:7865433224310zzxxwvutrqppoonnmjiijiiiiihhggggggfeeeddddddccccccccccbdecdddddddddcbbabaabbaaaabbbbbbbbcddcccdcccddddeefffffffffffeeedddddccbbaaaaaaccccccddddddeeedddddddcccbbcccddddeeggggggggghiihhggffeeeeeeeeefeffffeeedccccccbbbbbbbbbbbcccdeeeeeeffffffffffeeefedddccccbbbbbbaaZZZZZaaaabbbbbbbbccccdeeffffgfffffggggggghhhhhhhhhijjkkkjjkklllmmnnnnnoooonmmopppppqppppoo&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5406,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=102953|max=190442&chxp=1,1,54,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,8,16,16,40,24,48,120,144,264,408,544,712,888,1128,1512,1872,2088,2192,2416,2744,3104,3048,3192,3040,2856,2696,2752,2384,2080,1592,1400,1104,1008,680,592,296,288,288,144,96,80,40,16,0,0,0,0,8&chds=0,3192&chbh=5&chxt=x&chxl=0:|min=94190|avg=102953|max=112038&chxp=0,1,49,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:52.1,13.2,6.3,6.1,5.3,4.7,3.8,2.9,0.7,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 190.8s|mind_blast 48.4s|vampiric_touch 22.9s|shadow_word_pain 22.4s|devouring_plague 19.3s|shadow_word_insanity 17.1s|shadow_word_death 13.9s|halo 10.6s|shadowfiend 2.4s|waiting 2.1s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi 102953
devouring_plague 6400 (17945) 6.2% (17.4%) 16.3 23.62sec 403070 340784 118301 245101 143744 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.29 16.29 0.00 0.00 1.1828 0.0000 2342275.13 2342275.13 0.00 340784.35 340784.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.03 79.93% 118301.22 107519 143944 118290.56 109993 126292 1540886 1540886 0.00
crit 3.27 20.07% 245100.84 221488 296525 238939.08 0 296525 801389 801389 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2760 2.7% 42.2 8.64sec 23946 0 19765 40975 23977 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.19 42.13 0.00 0.00 0.0000 0.0000 1010164.21 1010164.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.77 80.15% 19765.35 17856 23904 19764.26 18471 21102 667409 667409 0.00
crit 8.37 19.85% 40975.33 36784 49242 40951.85 0 47457 342755 342755 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8786 8.5% 16.3 23.62sec 197333 0 0 0 0 0.0% 0.0% 0.0% 0.0% 134.9 19637 40674 23833 19.9% 0.0% 27.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.29 16.29 134.92 134.92 0.0000 0.7471 3215497.48 3215497.48 0.00 31900.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.0 80.05% 19637.31 17856 28896 19635.65 18541 20593 2120993 2120993 0.00
crit 26.9 19.95% 40673.77 36784 59525 40664.21 37894 44146 1094504 1094504 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3519) 0.0% (3.4%) 9.0 41.67sec 143110 121006 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1827 0.0000 0.00 0.00 0.00 121006.32 121006.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.23 80.29% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.77 19.71% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3519 3.4% 9.0 41.67sec 143110 0 118140 244337 143108 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1287991.23 1287991.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.22 80.21% 118140.21 109581 139821 118137.51 109581 128727 852881 852881 0.00
crit 1.78 19.79% 244337.11 225736 288030 210144.57 0 288030 435110 435110 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 8348 100.0% 9.0 41.67sec 339487 0 28942 41826 31906 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.76 0.00 0.00 0.0000 0.0000 3055381.49 18846986.02 83.79 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.73 76.99% 28942.49 0 184948 28931.81 0 107984 2133927 11642358 81.66
crit 22.03 23.01% 41826.19 0 380994 41695.80 0 254455 921455 7204628 87.22
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12900 12.5% 41.1 8.92sec 114986 97454 94830 196425 114985 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.06 41.06 0.00 0.00 1.1799 0.0000 4721546.80 4721546.80 0.00 97453.96 97453.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.92 80.16% 94829.91 86183 115909 94829.79 91038 98442 3121387 3121387 0.00
crit 8.15 19.84% 196424.51 177536 238773 196472.24 177536 238773 1600160 1600160 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20169 (26486) 19.6% (25.7%) 109.3 3.27sec 88670 50812 0 0 0 0.0% 0.0% 0.0% 0.0% 241.1 25223 52305 30624 19.9% 0.0% 48.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.32 109.32 241.05 241.05 1.7451 0.7369 7381975.08 7381975.08 0.00 50811.97 50811.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 193.0 80.06% 25223.22 22887 30640 25223.33 24567 25834 4867602 4867602 0.00
crit 48.1 19.94% 52305.43 47146 63119 52306.03 49894 55053 2514373 2514373 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6316 6.1% 75.4 4.68sec 30642 0 25239 52316 30652 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.45 75.42 0.00 0.00 0.0000 0.0000 2311831.27 2311831.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.35 80.01% 25238.89 22887 30640 25238.94 24061 26337 1523067 1523067 0.00
crit 15.08 19.99% 52315.50 47146 63119 52321.93 47843 57584 788764 788764 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3812 3.7% 11.9 4.86sec 117670 100019 96314 200045 117675 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.86 11.86 0.00 0.00 1.1765 0.0000 1395171.15 1395171.15 0.00 100019.44 100019.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.42 79.41% 96313.72 83662 112752 96305.12 85381 105479 906853 906853 0.00
crit 2.44 20.59% 200045.29 172343 232270 187678.80 0 232270 488319 488319 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 7796 7.6% 14.4 23.39sec 197564 167204 163100 337737 197569 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.44 14.44 0.00 0.00 1.1816 0.0000 2853339.85 2853339.85 0.00 167204.21 167204.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.59 80.27% 163099.83 148247 199962 163081.67 150785 178698 1890719 1890719 0.00
crit 2.85 19.73% 337737.37 305389 411923 323362.10 0 411923 962621 962621 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 8790 (11549) 8.5% (11.2%) 19.0 19.44sec 222045 188357 0 0 0 0.0% 0.0% 0.0% 0.0% 166.2 14682 30358 19355 29.8% 0.0% 89.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.04 19.04 166.22 166.22 1.1789 1.9668 3217124.36 3217124.36 0.00 12098.68 188356.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.7 70.19% 14681.94 13422 17966 14681.81 14290 15173 1712978 1712978 0.00
crit 49.5 29.81% 30357.98 27649 37009 30358.84 29009 31921 1504146 1504146 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2759 2.7% 52.0 6.91sec 19413 0 14731 30493 19438 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.02 51.95 0.00 0.00 0.0000 0.0000 1009791.20 1009791.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.44 70.14% 14731.06 13422 17966 14730.76 13967 15635 536761 536761 0.00
crit 15.51 29.86% 30492.92 27649 37009 30489.93 27886 33638 473030 473030 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2230 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3524 3.4% 59.8 6.03sec 21557 0 18340 36906 22034 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.84 58.54 0.00 0.00 0.0000 0.0000 1289962.76 1289962.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.90 80.11% 18340.24 16669 22484 18340.16 17528 19196 860114 860114 0.00
crit 11.65 19.89% 36905.82 33338 44968 36902.80 33338 41952 429849 429849 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8719 (11455) 8.5% (11.1%) 19.4 18.98sec 216240 183240 0 0 0 0.0% 0.0% 0.0% 0.0% 159.5 16497 34171 20002 19.8% 0.0% 97.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.39 19.39 159.54 159.54 1.1801 2.2374 3191047.10 3191047.10 0.00 11038.24 183239.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.9 80.17% 16497.44 15001 20366 16497.47 15991 17116 2110080 2110080 0.00
crit 31.6 19.83% 34171.03 30902 41955 34170.20 32442 36657 1080968 1080968 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2737 2.7% 50.0 7.11sec 20040 0 16528 34266 20053 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.98 49.95 0.00 0.00 0.0000 0.0000 1001661.51 1001661.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.02 80.12% 16527.73 15001 20366 16527.74 15709 17349 661457 661457 0.00
crit 9.93 19.88% 34266.37 30902 41955 34265.95 30902 39188 340204 340204 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52086 / 3966
melee 52086 3.9% 26.9 14.65sec 53983 54922 49907 101088 53982 20.8% 7.2% 24.1% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.89 26.89 0.00 0.00 0.9829 0.0000 1451475.46 1451475.46 0.00 54921.88 54921.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.28 45.66% 49907.31 38145 58728 49905.35 44144 56029 612700 612700 0.00
crit 5.58 20.77% 101088.23 76291 117456 100838.06 0 117456 564534 564534 0.00
glance 6.47 24.06% 37615.06 28609 44046 37561.72 0 44046 243316 243316 0.00
block 0.62 2.29% 50171.60 38145 58728 23238.54 0 58728 30925 30925 0.00
parry 1.94 7.22% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1871 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.44%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 10.6 0.4 31.6sec 30.4sec 5.41% 24.41%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.41%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.5sec 108.5sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.77%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.94% 11.94%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.94%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.4 36.3sec 20.3sec 43.88% 44.31%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.88%

    Trigger Attempt Success

    • trigger_pct:2.20%
light_of_the_cosmos 8.0 0.0 48.8sec 48.8sec 42.69% 42.69%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.69%

    Trigger Attempt Success

    • trigger_pct:15.16%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.29% 49.40%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.29%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 1.0 0.0 195.6sec 195.6sec 3.90% 4.07%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.90%

Trigger Attempt Success

  • trigger_pct:95.36%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.56% 80.37%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi
devouring_plague Shadow Orb 16.3 48.9 3.0 3.0 134355.8
halo Mana 9.0 364500.0 40500.0 40500.0 3.5
mind_blast Mana 41.1 266816.2 6497.9 6497.9 17.7
mind_flay Mana 109.3 327972.0 3000.0 3000.0 29.6
shadow_word_death Mana 11.9 92485.5 7800.0 7800.3 15.1
shadow_word_insanity Mana 14.4 108318.0 7500.0 7499.9 26.3
shadow_word_pain Mana 19.0 251279.4 13200.0 13200.0 16.8
vampiric_touch Mana 19.4 174502.1 9000.0 9000.0 24.0
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.95 135929.33 (8.85%) 5448.93 88585.39 39.46%
Shadow Orbs from Mind Blast Shadow Orb 41.06 41.06 (87.26%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.00 6.00 (12.74%) 1.00 0.00 0.00%
Devouring Plague Health Health 177.05 1833096.12 (81.07%) 10353.31 625584.84 25.44%
Vampiric Touch Mana Mana 209.49 997114.85 (64.95%) 4759.81 109955.23 9.93%
mp5_regen Mana 1463.00 402141.31 (26.19%) 274.87 36758.69 8.38%
vampiric_embrace Health 50.50 427955.71 (18.93%) 8474.02 272782.55 38.93%
pet - shadowfiend
vampiric_embrace Health 0.22 2470.00 (100.00%) 11050.46 1730.26 41.19%
Resource RPS-Gain RPS-Loss
Health 13484.30 14867.22
Mana 4194.50 4332.99
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health -43267.05 -343951.28 462887.00
Mana 249319.01 185100.00 300000.00
Shadow Orb 1.17 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 8.5%
shadowfiend-Mana Cap 8.5%
lightwell-Mana Cap 8.5%

Procs

Count Interval
Shadowy Recall Extra Tick 219.5 1.7sec
Shadowy Apparition Procced 59.8 6.0sec
Divine Insight Mind Blast CD Reset 19.3 30.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_di_swi Damage Per Second
Count 49992
Mean 102953.15
Minimum 94189.77
Maximum 112038.32
Spread ( max - min ) 17848.54
Range [ ( max - min ) / 2 * 100% ] 8.67%
Standard Deviation 2266.6745
5th Percentile 99283.17
95th Percentile 106694.57
( 95th Percentile - 5th Percentile ) 7411.40
Mean Distribution
Standard Deviation 10.1377
95.00% Confidence Intervall ( 102933.29 - 102973.02 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1862
0.1 Scale Factor Error with Delta=300 43859
0.05 Scale Factor Error with Delta=300 175437
0.01 Scale Factor Error with Delta=300 4385932
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 102953.15
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36229379.13
Distribution Chart

DTPS

Sample Data priest_90_di_swi Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_di_swi Healing Per Second
Count 49992
Mean 8348.04
Minimum 0.00
Maximum 31029.78
Spread ( max - min ) 31029.78
Range [ ( max - min ) / 2 * 100% ] 185.85%
Standard Deviation 5930.8994
5th Percentile 1612.65
95th Percentile 20906.30
( 95th Percentile - 5th Percentile ) 19293.65
Mean Distribution
Standard Deviation 26.5259
95.00% Confidence Intervall ( 8296.05 - 8400.03 )
Normalized 95.00% Confidence Intervall ( 99.38% - 100.62% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19389
0.1% Error 1938958
0.1 Scale Factor Error with Delta=300 300278
0.05 Scale Factor Error with Delta=300 1201115
0.01 Scale Factor Error with Delta=300 30027887
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 8348.04
Distribution Chart

Heal

Sample Data
Count 49992
Mean 3055381.49
Distribution Chart

HTPS

Sample Data priest_90_di_swi Healing taken Per Second
Count 49992
Mean 7306.78
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 205.02
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.95 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.86 shadow_word_death,if=active_enemies<=5
F 42.57 mind_blast,if=active_enemies<=6&cooldown_react
G 19.04 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 20.95 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 14.44 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.96 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 12.35 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.10 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 13.72 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 52.08 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTIFGHMTFTFTHGTFLMTFTHIGQFTFMTFHIGTQFLTTFHIGMTFTFHIGQQFTLFMTHIGFTFTFMHIGTFTLQFTHIGTQFMBTFHTIGTFTFKMHLIGTQFTFTHIGTFTFMHFIGLTFTFHIGMTFTFHGTLTFMTHFIGEETFMPEETHFIGEDEFLTFTE9DEHIFGTEETFMTBEEH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl : 103499 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103499.4 103499.4 18.60 / 0.02% 3465 / 3.3% 24.7 9563.9 9563.9 63.48 / 0.66% 12170 / 127.2% 2.4 4025.5 3916.3 Mana 0.49% 36.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.93 0.00 3.10 2.39 1.25 1.13 1.35
Normalized 1.00 0.00 0.79 0.61 0.32 0.29 0.34
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=3.93, SpellDamage=3.10, HitRating=2.39, CritRating=1.25, HasteRating=1.13, MasteryRating=1.35 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=3.93, SpellDamage=3.10, HitRating=0.00, CritRating=1.25, HasteRating=1.13, MasteryRating=1.35 )

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:348283|230224|190869|125926|101324|99461|83504|52710&chds=0,696566&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++348283++devouring_plague,9482C9,0,0,15|t++230224++shadow_word_pain,9482C9,1,0,15|t++190869++vampiric_touch,9482C9,2,0,15|t++125926++halo,9482C9,3,0,15|t++101324++shadow_word_death,9482C9,4,0,15|t++99461++mind_blast,9482C9,5,0,15|t++83504++mind_spike,4A79D3,6,0,15|t++52710++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,12,10,9,8,8,6,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.93,3.10,2.39,1.35,1.25,1.13|3.90,3.07,2.36,1.32,1.23,1.11|3.96,3.12,2.42,1.38,1.28,1.16&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.93++Int,FFFFFF,0,0,15,0.1,e|t++++3.10++SP,FFFFFF,0,1,15,0.1,e|t++++2.39++Hit,FFFFFF,0,2,15,0.1,e|t++++1.35++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.25++Crit,FFFFFF,0,4,15,0.1,e|t++++1.13++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.727&chtt=Scale Factors|priest_90_pi_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:7864432100zyxwwvutsrqomllkjjihggfffddcdccccccdccbbbbbbbabbaZYYXXXXWXXYYYYZZZZZZZZYYYYYXXXWWWWWWXXXXXYYZZZZZZaaabbaaaaaaaabbbbbcccddddcdccccbbaaZZYZZZZZZZZaaaaaaaZaaaaaaZZYXXXXYYYZaabccccccccddeeddcbbaZZZYZZZZZaaaabbaaaZZZZZZYYYXXXXXXXXXYZZabcccddeeeeeeeeddddddcbbbbaaZZZYYYYYXXXWWWXXWWWWXXXXXXXYYZaabbbcccbbbbcccccccccccccddddeffffffffggghhiijjjjjjjjiiijklllllllkkjj&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4838,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103499|max=213918&chxp=1,1,48,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,24,16,24,24,24,64,208,104,240,352,568,512,728,944,1304,1416,2016,1792,2144,2344,2672,2872,3016,3104,2448,3040,2720,2336,2208,2008,1800,1528,1152,1168,688,608,440,392,224,232,144,120,72,56,40,24,8,0,8&chds=0,3104&chbh=5&chxt=x&chxl=0:|min=95860|avg=103499|max=111398&chxp=0,1,49,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:49.4,12.2,10.0,6.2,5.6,4.9,3.8,2.8,0.7,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 181.0s|mind_blast 44.7s|mind_spike 36.4s|vampiric_touch 22.7s|shadow_word_pain 20.6s|devouring_plague 17.9s|shadow_word_death 13.9s|halo 10.3s|shadowfiend 2.4s|waiting 1.8s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl 103499
devouring_plague 6029 (17009) 5.8% (16.4%) 15.4 25.00sec 404094 348283 117872 244350 143241 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.41 15.41 0.00 0.00 1.1603 0.0000 2206643.19 2206643.19 0.00 348283.15 348283.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.32 79.94% 117871.82 107519 143944 117862.08 110241 125391 1451662 1451662 0.00
crit 3.09 20.06% 244350.04 221488 296525 236691.28 0 296525 754981 754981 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2629 2.5% 40.3 9.06sec 23875 0 19728 40887 23919 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.29 40.22 0.00 0.00 0.0000 0.0000 962038.53 962038.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.25 80.19% 19728.13 17856 23904 19726.32 18475 20908 636302 636302 0.00
crit 7.97 19.81% 40887.28 36784 49242 40892.92 36784 49242 325736 325736 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8351 8.1% 15.4 25.00sec 198407 0 0 0 0 0.0% 0.0% 0.0% 0.0% 128.8 19566 40516 23737 19.9% 0.0% 25.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.41 15.41 128.77 128.77 0.0000 0.7324 3056531.24 3056531.24 0.00 32410.10 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.1 80.09% 19565.64 17856 23904 19564.76 18629 20509 2017739 2017739 0.00
crit 25.6 19.91% 40515.86 36784 49242 40509.67 37507 43849 1038792 1038792 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3533) 0.0% (3.4%) 9.0 41.79sec 143682 125926 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1410 0.0000 0.00 0.00 0.00 125926.32 125926.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.20 80.04% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.80 19.96% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3533 3.4% 9.0 41.79sec 143682 0 118308 245082 143683 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1293137.36 1293137.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.20 79.98% 118307.62 109581 139821 118300.60 109581 129644 851648 851648 0.00
crit 1.80 20.02% 245082.41 225736 288030 213052.26 0 288030 441490 441490 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 9564 100.0% 9.0 41.79sec 388932 0 33651 45876 36475 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.97 0.00 0.00 0.0000 0.0000 3500390.61 18938298.94 81.52 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.80 76.90% 33650.87 0 184948 33625.19 0 112060 2483541 11676410 78.70
crit 22.16 23.10% 45876.10 0 380994 46034.11 0 208089 1016850 7261889 85.89
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12142 11.7% 38.6 9.54sec 115205 99461 94908 196661 115204 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.57 38.57 0.00 0.00 1.1583 0.0000 4443813.06 4443813.06 0.00 99460.89 99460.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.88 80.05% 94908.49 86183 115909 94905.77 91243 98900 2930665 2930665 0.00
crit 7.69 19.95% 196661.16 177536 238773 196604.87 0 227911 1513148 1513148 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 19857 (26063) 19.2% (25.2%) 108.6 3.28sec 87861 52710 0 0 0 0.0% 0.0% 0.0% 0.0% 236.0 25343 52580 30798 20.0% 0.0% 45.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.57 108.57 235.97 235.97 1.6669 0.7057 7267519.40 7267519.40 0.00 52709.76 52709.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 188.7 79.97% 25343.39 22887 30640 25343.20 24676 26009 4782599 4782599 0.00
crit 47.3 20.03% 52579.95 47146 63119 52577.74 50051 55352 2484920 2484920 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6207 6.0% 73.8 4.77sec 30793 0 25355 52567 30798 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.77 73.76 0.00 0.00 0.0000 0.0000 2271630.16 2271630.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.01 80.00% 25355.35 22887 30640 25355.85 24289 26577 1496161 1496161 0.00
crit 14.75 20.00% 52567.48 47146 63119 52569.50 48090 59279 775469 775469 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8310 8.0% 31.5 11.04sec 96681 83504 79541 164989 96682 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.46 31.46 0.00 0.00 1.1578 0.0000 3041383.76 3041383.76 0.00 83504.03 83504.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.15 79.94% 79541.26 72412 97688 79535.24 74954 84835 2000307 2000307 0.00
crit 6.31 20.06% 164988.87 149169 201238 164557.48 0 201238 1041077 1041077 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.0 121.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3840 3.7% 12.0 4.81sec 117500 101324 96170 199930 117499 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.96 11.96 0.00 0.00 1.1597 0.0000 1405559.64 1405559.64 0.00 101323.50 101323.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.50 79.44% 96169.58 83662 112752 96160.93 87306 104282 913912 913912 0.00
crit 2.46 20.56% 199929.68 172343 232270 187294.30 0 232270 491648 491648 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9843 (12937) 9.5% (12.5%) 17.9 21.24sec 265173 230224 0 0 0 0.0% 0.0% 0.0% 0.0% 185.7 14706 30402 19404 29.9% 0.0% 98.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 185.66 185.66 1.1518 1.9452 3602540.92 3602540.92 0.00 12404.93 230223.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.1 70.07% 14705.63 13422 17966 14705.87 14174 15207 1912945 1912945 0.00
crit 55.6 29.93% 30401.51 27649 37009 30399.85 29087 32158 1689596 1689596 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3094 3.0% 58.3 6.19sec 19434 0 14753 30534 19465 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.27 58.18 0.00 0.00 0.0000 0.0000 1132469.73 1132469.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.81 70.14% 14752.79 13422 17966 14752.29 14047 15537 602071 602071 0.00
crit 17.37 29.86% 30533.66 27649 37009 30537.90 28370 32956 530399 530399 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2109 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3838 3.7% 65.2 5.55sec 21539 0 18366 36970 22062 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.22 63.67 0.00 0.00 0.0000 0.0000 1404741.58 1404741.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.02 80.13% 18365.70 16669 22484 18366.05 17692 19203 937029 937029 0.00
crit 12.65 19.87% 36970.05 33338 44968 36971.03 33338 41926 467713 467713 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9013 (11840) 8.7% (11.4%) 19.6 18.80sec 220686 190869 0 0 0 0.0% 0.0% 0.0% 0.0% 164.4 16540 34274 20062 19.9% 0.0% 97.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.64 19.64 164.43 164.43 1.1562 2.1660 3298741.02 3298741.02 0.00 11438.31 190869.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.8 80.14% 16539.61 15001 20366 16539.80 15937 17260 2179323 2179323 0.00
crit 32.7 19.86% 34273.53 30902 41955 34270.87 32307 36815 1119419 1119419 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2827 2.7% 51.5 6.92sec 20092 0 16568 34337 20110 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.49 51.45 0.00 0.00 0.0000 0.0000 1034559.23 1034559.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.19 80.07% 16567.75 15001 20366 16567.86 15772 17395 682436 682436 0.00
crit 10.25 19.93% 34337.09 30902 41955 34343.00 30902 38855 352123 352123 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52436 / 3988
melee 52436 3.9% 26.9 14.62sec 54186 55249 50062 101397 54186 20.8% 7.3% 23.8% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.93 26.93 0.00 0.00 0.9808 0.0000 1459468.78 1459468.78 0.00 55249.42 55249.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.33 45.78% 50062.35 38145 58728 50053.81 42723 57451 617329 617329 0.00
crit 5.62 20.85% 101397.36 76291 117456 101104.70 0 117456 569359 569359 0.00
glance 6.42 23.82% 37714.67 28609 44046 37674.43 0 44046 241941 241941 0.00
block 0.61 2.28% 50290.36 38145 58728 23410.60 0 58728 30840 30840 0.00
parry 1.96 7.28% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1442 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.10%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.3sec 108.3sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.63%
glyph_mind_spike 22.5 9.0 15.6sec 11.0sec 37.33% 55.16%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.97%
  • glyph_mind_spike_2:8.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.2 7.8 36.1sec 19.8sec 44.72% 45.37%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.72%

    Trigger Attempt Success

    • trigger_pct:2.19%
light_of_the_cosmos 8.0 0.0 48.7sec 48.7sec 42.88% 42.88%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.88%

    Trigger Attempt Success

    • trigger_pct:15.20%
power_infusion 4.0 0.0 121.0sec 121.2sec 17.18% 19.89%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.36% 49.68%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.36%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 27.2 5.2 13.0sec 10.9sec 21.30% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:19.44%
  • surge_of_darkness_2:1.86%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
vampiric_embrace 0.9 0.0 199.7sec 199.7sec 3.83% 4.11%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.83%

Trigger Attempt Success

  • trigger_pct:93.79%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.55% 80.24%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl
devouring_plague Shadow Orb 15.4 46.2 3.0 3.0 134697.3
halo Mana 9.0 340201.3 37800.1 37800.1 3.8
mind_blast Mana 38.6 333565.9 8647.7 8647.6 13.3
mind_flay Mana 108.6 310954.1 2864.1 2864.1 30.7
shadow_word_death Mana 12.0 91594.2 7656.5 7656.9 15.3
shadow_word_pain Mana 17.9 226242.9 12670.2 12670.2 20.9
vampiric_touch Mana 19.6 170775.1 8697.2 8697.2 25.4
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.97 125272.95 (8.74%) 5016.05 99496.65 44.27%
Shadow Orbs from Mind Blast Shadow Orb 38.57 38.57 (86.50%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.02 6.02 (13.50%) 1.00 0.00 0.00%
Devouring Plague Health Health 168.99 1746026.69 (79.70%) 10332.32 600628.21 25.60%
Vampiric Touch Mana Mana 215.87 933718.20 (65.14%) 4325.36 207169.32 18.16%
mp5_regen Mana 1463.00 374391.30 (26.12%) 255.91 64508.70 14.70%
vampiric_embrace Health 52.50 444734.39 (20.30%) 8471.08 272099.41 37.96%
pet - shadowfiend
vampiric_embrace Health 0.06 738.95 (100.00%) 11842.21 481.15 39.44%
Resource RPS-Gain RPS-Loss
Health 13456.57 14867.22
Mana 3916.35 4025.50
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health -53413.06 -352017.21 462887.00
Mana 260052.77 204300.00 300000.00
Shadow Orb 1.38 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.9%
shadowfiend-Mana Cap 14.9%
lightwell-Mana Cap 14.9%

Procs

Count Interval
Shadowy Recall Extra Tick 223.6 1.6sec
Shadowy Apparition Procced 65.2 5.6sec
FDCL Mind Spike proc 32.4 10.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl Damage Per Second
Count 49992
Mean 103499.39
Minimum 95859.90
Maximum 111398.03
Spread ( max - min ) 15538.12
Range [ ( max - min ) / 2 * 100% ] 7.51%
Standard Deviation 2121.6915
5th Percentile 100046.12
95th Percentile 106975.47
( 95th Percentile - 5th Percentile ) 6929.35
Mean Distribution
Standard Deviation 9.4893
95.00% Confidence Intervall ( 103480.79 - 103517.99 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1614
0.1 Scale Factor Error with Delta=300 38428
0.05 Scale Factor Error with Delta=300 153712
0.01 Scale Factor Error with Delta=300 3842803
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103499.39
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36421308.81
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl Healing Per Second
Count 49992
Mean 9563.91
Minimum 0.00
Maximum 33813.49
Spread ( max - min ) 33813.49
Range [ ( max - min ) / 2 * 100% ] 176.78%
Standard Deviation 7241.2038
5th Percentile 1610.49
95th Percentile 25950.22
( 95th Percentile - 5th Percentile ) 24339.73
Mean Distribution
Standard Deviation 32.3862
95.00% Confidence Intervall ( 9500.43 - 9627.38 )
Normalized 95.00% Confidence Intervall ( 99.34% - 100.66% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22021
0.1% Error 2202149
0.1 Scale Factor Error with Delta=300 447615
0.05 Scale Factor Error with Delta=300 1790462
0.01 Scale Factor Error with Delta=300 44761559
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 9563.91
Distribution Chart

Heal

Sample Data
Count 49992
Mean 3500390.61
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl Healing taken Per Second
Count 49992
Mean 7470.86
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 220.54
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.00 power_infusion,if=talent.power_infusion.enabled
D 3.21 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.96 shadow_word_death,if=active_enemies<=5
F 39.74 mind_blast,if=active_enemies<=6&cooldown_react
G 17.86 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 21.12 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.35 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.94 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 12.20 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.11 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.61 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 28.11 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 57.33 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFRTFGHMTFTJRTFHTGTLFMTFHRGTQFTJRTFHMTGFTLTTFHRTFGMTFHTCRFTGRTLQFJRHTTQFMTGFTHRTFTFGHHLMRFTBTRFTGHRTQFMTRTFRRTHTGFLTFMTRTHQFGTFTCTHTQFKMTGTLTFTRTHTFJRTGRQFMTRHTFTRTQFGLTHQFMTEEQFTTGPEDEFHTEEFMTGLE9EFHTEDEFTEBCEFG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb : 103991 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103990.9 103990.9 17.99 / 0.02% 3342 / 3.2% 23.0 9352.2 9352.2 62.36 / 0.67% 12122 / 129.6% 2.3 4115.4 3979.1 Mana 0.41% 31.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.99 0.00 3.14 2.20 1.26 1.19 1.41
Normalized 1.00 0.00 0.79 0.55 0.32 0.30 0.35
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=3.99, SpellDamage=3.14, HitRating=2.20, CritRating=1.26, HasteRating=1.19, MasteryRating=1.41 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=3.99, SpellDamage=3.14, HitRating=0.00, CritRating=1.26, HasteRating=1.19, MasteryRating=1.41 )

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:350911|229400|190732|125902|101152|99081|53225&chds=0,701821&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++350911++devouring_plague,9482C9,0,0,15|t++229400++shadow_word_pain,9482C9,1,0,15|t++190732++vampiric_touch,9482C9,2,0,15|t++125902++halo,9482C9,3,0,15|t++101152++shadow_word_death,9482C9,4,0,15|t++99081++mind_blast,9482C9,5,0,15|t++53225++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:25,12,10,10,10,8,8,6,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_mb Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.99,3.14,2.20,1.41,1.26,1.19|3.96,3.11,2.17,1.38,1.24,1.17|4.02,3.17,2.23,1.43,1.29,1.22&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.99++Int,FFFFFF,0,0,15,0.1,e|t++++3.14++SP,FFFFFF,0,1,15,0.1,e|t++++2.20++Hit,FFFFFF,0,2,15,0.1,e|t++++1.41++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.26++Crit,FFFFFF,0,4,15,0.1,e|t++++1.19++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.797&chtt=Scale Factors|priest_90_pi_mb%20Damage%20Per%20Second&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:667786654322200zzyxwutrpnmlkjiiigfgedccddcdddddcbbbbbbcbcddddcdccbccdedeeeeeeeddcbaaaZZYYYYYYYXXXWWWWXXXXXXYYZZZZabcdefggghhiiiiiiiiiiihgfedcbbbbabcbbbbaaaaaaaaaZZZZZZZZYYXXXXXXYYZZZabbbbcccddeeefeeeeddddddccbbbbbaaaZZYXYYYYYXXYYYYYYYYYabbdefghhijjkllllllllkkkihgffedbbaZYYXXWVWWWVWXXXXXXYYYYYYZZabcdeefgggfghiiiiiiiiiiihhgggfghggggfggghiijjjkkkkkkkkkkklllllkkkkjiii&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5160,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103991|max=201544&chxp=1,1,52,100&chtt=priest_90_pi_mb DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,16,8,32,48,24,88,216,296,336,376,504,912,928,1328,1656,1680,2256,2288,2384,2696,2968,3256,2904,3016,2800,2808,2504,2176,2088,1584,1208,1208,920,584,536,408,240,248,184,80,80,32,32,16,16,0,0,8&chds=0,3256&chbh=5&chxt=x&chxl=0:|min=96364|avg=103991|max=112079&chxp=0,1,49,100&chtt=priest_90_pi_mb DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:58.7,11.4,6.2,5.6,4.6,3.8,2.8,1.8,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 214.9s|mind_blast 41.8s|vampiric_touch 22.8s|shadow_word_pain 20.6s|devouring_plague 16.9s|shadow_word_death 13.8s|halo 10.3s|mindbender 6.5s|waiting 1.5s&chtt=priest_90_pi_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb 103991
devouring_plague 5715 (16226) 5.5% (15.6%) 14.6 26.63sec 406186 350911 118286 245065 143070 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.62 14.62 0.00 0.00 1.1576 0.0000 2091799.51 2091799.51 0.00 350910.65 350910.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.76 80.45% 118285.54 107519 143944 118271.09 109940 125558 1391357 1391357 0.00
crit 2.86 19.55% 245064.78 221488 296525 235601.71 0 296525 700443 700443 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2516 2.4% 38.4 9.54sec 23968 0 19780 40966 24022 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.42 38.34 0.00 0.00 0.0000 0.0000 920939.82 920939.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.66 79.98% 19779.58 17856 23904 19778.22 18446 21156 606483 606483 0.00
crit 7.68 20.02% 40966.02 36784 49242 40935.14 0 46680 314457 314457 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7995 7.7% 14.6 26.63sec 200129 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122.8 19638 40667 23823 19.9% 0.0% 24.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.62 14.62 122.82 122.82 0.0000 0.7299 2926072.43 2926072.43 0.00 32640.67 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.4 80.10% 19638.22 17856 23904 19637.38 18599 20728 1932018 1932018 0.00
crit 24.4 19.90% 40667.37 36784 49242 40661.79 37972 43899 994054 994054 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3528) 0.0% (3.4%) 9.0 41.79sec 143486 125902 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1397 0.0000 0.00 0.00 0.00 125902.16 125902.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.23 80.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.77 19.63% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3528 3.4% 9.0 41.79sec 143486 0 118391 245216 143490 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1291378.41 1291378.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.22 80.21% 118391.10 109581 139821 118387.16 109581 128571 854675 854675 0.00
crit 1.78 19.79% 245216.05 225736 288030 212137.34 0 288030 436703 436703 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 9352 100.0% 9.0 41.79sec 380325 0 32914 44818 35669 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.97 0.00 0.00 0.0000 0.0000 3422921.79 18960015.12 81.95 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.76 76.86% 32914.35 0 184948 32874.91 0 114222 2427794 11675982 79.19
crit 22.21 23.14% 44818.19 0 380994 44949.43 0 228115 995127 7284033 86.25
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11315 10.9% 36.0 10.22sec 114978 99081 94870 196518 114978 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.02 36.02 0.00 0.00 1.1605 0.0000 4141174.37 4141174.37 0.00 99080.64 99080.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.89 80.22% 94870.41 86183 115909 94869.95 91483 98559 2740990 2740990 0.00
crit 7.12 19.78% 196518.45 177536 238773 196502.68 0 238773 1400185 1400185 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 23788 (31246) 22.9% (30.0%) 126.7 2.83sec 90283 53225 0 0 0 0.0% 0.0% 0.0% 0.0% 283.1 25318 52513 30758 20.0% 0.0% 54.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.67 126.67 283.07 283.07 1.6962 0.7080 8706466.91 8706466.91 0.00 53224.93 53224.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 226.4 80.00% 25317.98 22887 30640 25318.07 24716 25992 5733157 5733157 0.00
crit 56.6 20.00% 52512.56 47146 63119 52512.79 50238 55195 2973310 2973310 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7458 7.2% 88.7 3.99sec 30761 0 25330 52561 30772 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.74 88.70 0.00 0.00 0.0000 0.0000 2729601.65 2729601.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.97 80.01% 25330.11 22887 30640 25330.18 24368 26459 1797788 1797788 0.00
crit 17.73 19.99% 52560.68 47146 63119 52559.19 47797 57758 931814 931814 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 5.7 60.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.71 5.71 0.00 0.00 1.1451 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.0 120.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 3.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3811 3.7% 11.9 4.81sec 117608 101152 96259 200001 117610 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.86 11.86 0.00 0.00 1.1627 0.0000 1394883.22 1394883.22 0.00 101151.79 101151.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.42 79.42% 96258.70 83662 112752 96237.63 87081 107044 906732 906732 0.00
crit 2.44 20.58% 200001.31 172343 232270 186789.86 0 232270 488151 488151 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9853 (12940) 9.5% (12.4%) 17.9 21.20sec 264511 229400 0 0 0 0.0% 0.0% 0.0% 0.0% 185.9 14709 30409 19403 29.9% 0.0% 98.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.90 17.90 185.86 185.86 1.1531 1.9456 3606299.37 3606299.37 0.00 12389.59 229400.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.3 70.10% 14709.05 13422 17966 14709.29 14185 15231 1916457 1916457 0.00
crit 55.6 29.90% 30408.83 27649 37009 30408.29 28891 32095 1689842 1689842 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3087 3.0% 58.1 6.22sec 19452 0 14765 30547 19481 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.08 57.99 0.00 0.00 0.0000 0.0000 1129672.76 1129672.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.66 70.12% 14764.51 13422 17966 14764.62 14063 15572 600307 600307 0.00
crit 17.33 29.88% 30547.25 27649 37009 30545.00 28134 33327 529366 529366 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3832 3.7% 65.1 5.56sec 21547 0 18377 36976 22090 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.09 63.49 0.00 0.00 0.0000 0.0000 1402476.28 1402476.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.81 80.03% 18376.66 16669 22484 18375.90 17539 19198 933757 933757 0.00
crit 12.68 19.97% 36976.44 33338 44968 36975.55 33632 41436 468719 468719 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9039 (11870) 8.7% (11.4%) 19.7 18.81sec 220423 190732 0 0 0 0.0% 0.0% 0.0% 0.0% 164.6 16569 34320 20105 19.9% 0.0% 97.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.71 19.71 164.55 164.55 1.1557 2.1635 3308321.14 3308321.14 0.00 11469.13 190731.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.8 80.08% 16568.64 15001 20366 16568.79 16005 17228 2183232 2183232 0.00
crit 32.8 19.92% 34319.55 30902 41955 34317.21 32421 37026 1125089 1125089 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2831 2.7% 51.5 6.93sec 20105 0 16579 34379 20133 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.53 51.46 0.00 0.00 0.0000 0.0000 1035980.73 1035980.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.19 80.04% 16578.83 15001 20366 16578.34 15744 17361 682802 682802 0.00
crit 10.27 19.96% 34378.50 30902 41955 34377.20 30902 40975 353179 353179 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37187 / 9223
melee 37187 8.9% 81.3 4.17sec 41510 39651 38690 78029 41511 20.3% 7.4% 24.0% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.32 81.32 0.00 0.00 1.0469 0.0000 3375614.78 3375614.78 0.00 39651.07 39651.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.30 45.86% 38690.06 30516 46982 38688.90 36257 41292 1442984 1442984 0.00
crit 16.54 20.34% 78029.36 61032 93964 78029.93 70248 85769 1290421 1290421 0.00
glance 19.49 23.96% 29098.63 22887 35237 29095.45 25264 31857 567041 567041 0.00
block 1.94 2.39% 38727.40 30516 46982 33248.34 0 46982 75168 75168 0.00
parry 6.06 7.45% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.7 19.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.71 18.71 0.00 0.00 1.1320 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.21%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.5sec 108.5sec 21.85% 21.85%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.85%

    Trigger Attempt Success

    • trigger_pct:16.71%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.2 7.8 36.1sec 19.8sec 44.75% 45.47%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.75%

    Trigger Attempt Success

    • trigger_pct:2.17%
light_of_the_cosmos 8.0 0.0 48.5sec 48.5sec 43.08% 43.08%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.08%

    Trigger Attempt Success

    • trigger_pct:15.15%
power_infusion 4.0 0.0 121.0sec 121.0sec 17.23% 20.30%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.37% 49.53%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 0.9 0.0 0.0sec 0.0sec 3.67% 3.87%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.67%

Trigger Attempt Success

  • trigger_pct:89.76%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.7 0.0 19.8sec 19.8sec 85.31% 83.72%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.17% 2.17%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.17%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb
devouring_plague Shadow Orb 14.6 43.9 3.0 3.0 135394.9
halo Mana 9.0 340200.0 37800.0 37800.0 3.8
mind_blast Mana 36.0 312875.7 8686.9 8686.9 13.2
mind_flay Mana 126.7 363503.3 2869.7 2869.7 31.5
shadow_word_death Mana 11.9 91147.9 7684.7 7685.0 15.3
shadow_word_pain Mana 17.9 227192.5 12689.0 12689.0 20.8
vampiric_touch Mana 19.7 171317.7 8692.4 8692.4 25.4
Resource Gains Type Count Total Average Overflow
mindbender Mana 75.26 212388.27 (14.58%) 2822.00 117329.22 35.58%
Shadow Orbs from Mind Blast Shadow Orb 36.02 36.02 (85.75%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.98 5.98 (14.25%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.16 1644197.37 (81.30%) 10202.15 593795.36 26.53%
Vampiric Touch Mana Mana 216.01 887512.48 (60.94%) 4108.66 254174.72 22.26%
mp5_regen Mana 1463.00 356433.00 (24.47%) 243.63 82467.00 18.79%
vampiric_embrace Health 50.93 378152.74 (18.70%) 7425.03 255963.99 40.37%
pet - mindbender
vampiric_embrace Health 8.62 51279.54 (100.00%) 5950.89 53585.98 51.10%
Resource RPS-Gain RPS-Loss
Health 13470.09 14867.22
Mana 3979.05 4115.40
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health -48446.63 -379790.42 454821.07
Mana 250099.24 208920.95 291302.86
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 18.9%
shadowfiend-Mana Cap 18.9%
lightwell-Mana Cap 18.9%

Procs

Count Interval
Shadowy Recall Extra Tick 236.5 1.5sec
Shadowy Apparition Procced 65.1 5.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_pi_mb Damage Per Second
Count 49992
Mean 103990.93
Minimum 96364.04
Maximum 112078.62
Spread ( max - min ) 15714.58
Range [ ( max - min ) / 2 * 100% ] 7.56%
Standard Deviation 2052.0519
5th Percentile 100668.38
95th Percentile 107351.67
( 95th Percentile - 5th Percentile ) 6683.30
Mean Distribution
Standard Deviation 9.1778
95.00% Confidence Intervall ( 103972.94 - 104008.92 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1495
0.1 Scale Factor Error with Delta=300 35946
0.05 Scale Factor Error with Delta=300 143787
0.01 Scale Factor Error with Delta=300 3594680
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103990.93
Distribution Chart

Damage

Sample Data
Count 49992
Mean 34685066.60
Distribution Chart

DTPS

Sample Data priest_90_pi_mb Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_pi_mb Healing Per Second
Count 49992
Mean 9352.25
Minimum 0.00
Maximum 32165.03
Spread ( max - min ) 32165.03
Range [ ( max - min ) / 2 * 100% ] 171.96%
Standard Deviation 7113.7255
5th Percentile 1432.71
95th Percentile 25677.46
( 95th Percentile - 5th Percentile ) 24244.75
Mean Distribution
Standard Deviation 31.8161
95.00% Confidence Intervall ( 9289.89 - 9414.60 )
Normalized 95.00% Confidence Intervall ( 99.33% - 100.67% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22225
0.1% Error 2222586
0.1 Scale Factor Error with Delta=300 431994
0.05 Scale Factor Error with Delta=300 1727976
0.01 Scale Factor Error with Delta=300 43199415
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 9352.25
Distribution Chart

Heal

Sample Data
Count 49992
Mean 3422921.79
Distribution Chart

HTPS

Sample Data priest_90_pi_mb Healing taken Per Second
Count 49992
Mean 7944.53
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 189.43
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 5.71 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 3.96 power_infusion,if=talent.power_infusion.enabled
D 3.30 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.86 shadow_word_death,if=active_enemies<=5
F 38.19 mind_blast,if=active_enemies<=6&cooldown_react
G 17.90 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 20.96 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.90 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.99 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.86 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 57.47 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFTFHGMTQFTFHTGTLTFMTHFHAGTQFTFHMTGLFTTHFTGQFMTHFTCTATGFLTHFHMTQFGTHFTFMTGLTHFTTAFTGTHQFMTQFTHGFLTQFMTTHQFGTFCTATFHMGTLTFTHTFTGTFTHTFKMTGLQFTAHTFEDETTFGEEHTFDEETQFLGE9DEHTFTEETFMTCEEGAH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi : 103610 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103609.6 103609.6 18.76 / 0.02% 3468 / 3.3% 22.6 13547.3 13547.3 70.48 / 0.52% 12470 / 92.0% 3.1 4408.1 4242.6 Mana 0.38% 32.8 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.98 0.00 3.17 2.34 1.32 1.19 1.37
Normalized 1.00 0.00 0.80 0.59 0.33 0.30 0.35
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=3.98, SpellDamage=3.17, HitRating=2.34, CritRating=1.32, HasteRating=1.19, MasteryRating=1.37 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=3.98, SpellDamage=3.17, HitRating=0.00, CritRating=1.32, HasteRating=1.19, MasteryRating=1.37 )

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:349567|197198|189603|167962|125634|101167|99276|53437&chds=0,699134&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++349567++devouring_plague,9482C9,0,0,15|t++197198++shadow_word_pain,9482C9,1,0,15|t++189603++vampiric_touch,9482C9,2,0,15|t++167962++shadow_word_insanity,9482C9,3,0,15|t++125634++halo,9482C9,4,0,15|t++101167++shadow_word_death,9482C9,5,0,15|t++99276++mind_blast,9482C9,6,0,15|t++53437++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,11,9,9,8,8,7,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|vampiric_touch|shadow_word_pain|shadow_word_insanity|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|vampiric_touch_mastery|shadow_word_pain_mastery|devouring_plague_mastery&chtt=priest_90_pi_swi Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.98,3.17,2.34,1.37,1.32,1.19|3.95,3.15,2.31,1.35,1.30,1.16|4.00,3.20,2.37,1.40,1.35,1.22&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.98++Int,FFFFFF,0,0,15,0.1,e|t++++3.17++SP,FFFFFF,0,1,15,0.1,e|t++++2.34++Hit,FFFFFF,0,2,15,0.1,e|t++++1.37++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.32++Crit,FFFFFF,0,4,15,0.1,e|t++++1.19++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.781&chtt=Scale Factors|priest_90_pi_swi%20Damage%20Per%20Second&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:7865432210zzyxxvuutsqommlkkihiiigfgeeddccccdddcccdcaaaaZaaaaZYYXWVVWXXWXXXYYZaaaZYYYYZZaZZYYYYXXXXWWWXYYYYZaZZZaabbcdddddcccccccbbccccccbbaZZaaaaaccbbbaaaaZZaaaaaZaaaaZZZZYYZZaaaaaabcdccbbbcccdeddccccccccbbbbbbbbbbaaZZYYYYYYYXXYYYYYZZZZZaabcddddddeeeeeeeefffffeddcbbbaZZYYYXXWVVVWWXXWXXXXYYYYYYZZaabbbbbccbbbbbcccccccddddddddeeffffgffgghhiiiiiiiiiijjiihjkllkkkkkkkkk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4893,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103610|max=211744&chxp=1,1,49,100&chtt=priest_90_pi_swi DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,32,24,64,32,120,216,224,424,416,640,944,1112,1504,1640,2032,2096,2560,2624,2608,3224,2944,2664,3000,2768,2296,2256,2184,1848,1440,1416,1112,984,648,424,472,216,224,176,104,112,80,16,8,16,16,8,0,8&chds=0,3224&chbh=5&chxt=x&chxl=0:|min=96253|avg=103610|max=112240&chxp=0,1,46,100&chtt=priest_90_pi_swi DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.6,11.5,6.3,6.0,4.8,4.7,3.8,2.8,0.7,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 199.8s|mind_blast 42.1s|vampiric_touch 22.9s|shadow_word_pain 21.9s|shadow_word_insanity 17.7s|devouring_plague 17.0s|shadow_word_death 13.8s|halo 10.3s|shadowfiend 2.4s|waiting 1.4s&chtt=priest_90_pi_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi 103610
devouring_plague 5753 (16266) 5.6% (15.7%) 14.7 26.36sec 404286 349567 118046 244415 142991 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.73 14.73 0.00 0.00 1.1566 0.0000 2105642.98 2105642.98 0.00 349566.77 349566.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.82 80.26% 118045.51 107519 143944 118031.39 109940 125863 1395204 1395204 0.00
crit 2.91 19.74% 244414.68 221488 296525 234218.17 0 296525 710439 710439 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2517 2.4% 38.4 9.54sec 23976 0 19774 40982 24026 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.43 38.35 0.00 0.00 0.0000 0.0000 921304.83 921304.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.66 79.95% 19774.29 17856 23904 19772.58 18502 21109 606258 606258 0.00
crit 7.69 20.05% 40981.97 36784 49242 40967.93 0 49242 315047 315047 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7996 7.7% 14.7 26.36sec 198733 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.2 19580 40533 23757 19.9% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.73 14.73 123.19 123.19 0.0000 0.7323 2926523.80 2926523.80 0.00 32442.67 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.6 80.06% 19579.61 17856 23904 19578.26 18606 20652 1931098 1931098 0.00
crit 24.6 19.94% 40533.24 36784 49242 40529.25 37592 43566 995426 995426 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3520) 0.0% (3.4%) 9.0 41.56sec 143167 125634 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1396 0.0000 0.00 0.00 0.00 125633.96 125633.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 80.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.79 19.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3520 3.4% 9.0 41.56sec 143167 0 118084 244514 143163 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1288501.86 1288501.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 80.16% 118084.00 109581 139821 118074.51 109581 127193 851906 851906 0.00
crit 1.79 19.84% 244513.86 225736 288030 210092.19 0 288030 436596 436596 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 13547 100.0% 9.0 41.56sec 550925 0 46917 67517 51681 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.93 0.00 0.00 0.0000 0.0000 4958324.50 18904722.74 73.77 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.75 76.87% 46916.74 0 184948 46885.40 0 113278 3460151 11648231 70.29
crit 22.19 23.13% 67516.73 0 380994 67538.22 0 231846 1498173 7256492 79.31
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11409 11.0% 36.3 10.15sec 115120 99276 94849 196581 115120 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.27 36.27 0.00 0.00 1.1596 0.0000 4175655.00 4175655.00 0.00 99276.17 99276.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.04 80.07% 94848.75 86183 115909 94847.77 91170 98845 2754814 2754814 0.00
crit 7.23 19.93% 196580.85 177536 238773 196527.71 0 226375 1420841 1420841 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 22226 (29176) 21.5% (28.2%) 118.8 3.03sec 89903 53437 0 0 0 0.0% 0.0% 0.0% 0.0% 264.0 25360 52596 30813 20.0% 0.0% 50.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.78 118.78 264.00 264.00 1.6824 0.7047 8134652.87 8134652.87 0.00 53437.38 53437.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 211.2 79.98% 25360.46 22887 30640 25360.49 24655 25984 5354889 5354889 0.00
crit 52.9 20.02% 52596.49 47146 63119 52595.72 50268 55262 2779764 2779764 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6950 6.7% 82.6 4.29sec 30804 0 25367 52600 30822 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.58 82.53 0.00 0.00 0.0000 0.0000 2543739.20 2543739.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.00 79.97% 25366.70 22887 30640 25366.51 24390 26396 1674169 1674169 0.00
crit 16.53 20.03% 52600.28 47146 63119 52594.60 47364 58020 869570 869570 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.0 121.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3811 3.7% 11.9 4.83sec 117443 101167 96329 199712 117444 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.88 11.88 0.00 0.00 1.1609 0.0000 1394788.59 1394788.59 0.00 101166.94 101166.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.45 79.58% 96329.33 83662 112752 96315.51 86922 106678 910392 910392 0.00
crit 2.43 20.42% 199712.15 172343 232270 185734.28 0 232270 484397 484397 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 8122 7.8% 15.3 21.31sec 194897 167962 161100 333184 194899 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.25 15.25 0.00 0.00 1.1604 0.0000 2972757.23 2972757.23 0.00 167961.88 167961.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.26 80.36% 161099.97 148247 199962 161039.19 151148 171388 1974655 1974655 0.00
crit 3.00 19.64% 333183.53 305389 411923 320478.02 0 411923 998103 998103 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 8998 (11824) 8.7% (11.4%) 19.0 19.47sec 227242 197198 0 0 0 0.0% 0.0% 0.0% 0.0% 170.0 14686 30367 19367 29.9% 0.0% 89.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.04 19.04 170.05 170.05 1.1524 1.9204 3293364.30 3293364.30 0.00 12418.08 197198.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.3 70.15% 14686.33 13422 17966 14686.18 14194 15144 1751857 1751857 0.00
crit 50.8 29.85% 30367.01 27649 37009 30364.93 29010 31903 1541507 1541507 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2826 2.7% 53.1 6.79sec 19474 0 14778 30572 19498 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.11 53.05 0.00 0.00 0.0000 0.0000 1034349.36 1034349.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.20 70.11% 14777.57 13422 17966 14777.48 14025 15519 549654 549654 0.00
crit 15.85 29.89% 30572.07 27649 37009 30573.21 28030 34334 484696 484696 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2143 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3614 3.5% 61.1 5.92sec 21631 0 18385 37016 22098 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.14 59.85 0.00 0.00 0.0000 0.0000 1322567.14 1322567.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.92 80.07% 18384.94 16669 22484 18384.71 17596 19143 881010 881010 0.00
crit 11.93 19.93% 37015.52 33338 44968 37016.33 33990 41362 441557 441557 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9048 (11883) 8.7% (11.5%) 19.8 18.74sec 219182 189603 0 0 0 0.0% 0.0% 0.0% 0.0% 165.1 16540 34271 20057 19.8% 0.0% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.84 19.84 165.11 165.11 1.1560 2.1626 3311532.96 3311532.96 0.00 11445.18 189603.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.4 80.16% 16540.23 15001 20366 16540.29 15917 17266 2189210 2189210 0.00
crit 32.7 19.84% 34270.50 30902 41955 34270.48 32293 37086 1122323 1122323 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2835 2.7% 51.6 6.90sec 20090 0 16572 34366 20109 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.65 51.60 0.00 0.00 0.0000 0.0000 1037588.84 1037588.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.34 80.12% 16572.12 15001 20366 16571.21 15725 17448 685105 685105 0.00
crit 10.26 19.88% 34366.38 30902 41955 34366.09 30902 39717 352484 352484 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52475 / 3984
melee 52475 3.8% 26.8 14.67sec 54329 55451 50076 101456 54330 21.0% 7.2% 24.0% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.84 26.84 0.00 0.00 0.9798 0.0000 1458129.29 1458129.29 0.00 55450.61 55450.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.22 45.52% 50076.43 38145 58728 50071.51 43145 57561 611850 611850 0.00
crit 5.64 21.01% 101455.83 76291 117456 101296.27 0 117456 572043 572043 0.00
glance 6.43 23.98% 37757.12 28609 44046 37717.91 0 44046 242959 242959 0.00
block 0.62 2.31% 50414.47 38145 58728 23492.66 0 58728 31278 31278 0.00
parry 1.93 7.18% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1456 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.25%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.5sec 108.5sec 21.85% 21.85%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.85%

    Trigger Attempt Success

    • trigger_pct:16.92%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.94% 11.94%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.94%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.3 7.7 35.8sec 19.8sec 44.87% 45.58%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.87%

    Trigger Attempt Success

    • trigger_pct:2.22%
light_of_the_cosmos 8.0 0.0 48.7sec 48.7sec 42.92% 42.92%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.92%

    Trigger Attempt Success

    • trigger_pct:15.15%
power_infusion 4.0 0.0 121.1sec 121.2sec 17.14% 19.70%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.31% 49.57%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.31%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 0.9 0.0 0.0sec 0.0sec 3.83% 4.02%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.83%

Trigger Attempt Success

  • trigger_pct:94.43%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.6sec 90.6sec 85.52% 80.12%

Buff details

  • buff initial source:priest_90_pi_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi
devouring_plague Shadow Orb 14.7 44.2 3.0 3.0 134761.7
halo Mana 9.0 340201.3 37800.1 37800.1 3.8
mind_blast Mana 36.3 315034.0 8685.3 8685.3 13.3
mind_flay Mana 118.8 339887.3 2861.6 2861.5 31.4
shadow_word_death Mana 11.9 91047.1 7666.1 7666.3 15.3
shadow_word_insanity Mana 15.3 111625.4 7318.2 7318.3 26.6
shadow_word_pain Mana 19.0 243185.0 12769.3 12769.3 17.8
vampiric_touch Mana 19.8 172393.3 8688.1 8688.1 25.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.91 124039.19 (7.99%) 4979.13 100167.37 44.68%
Shadow Orbs from Mind Blast Shadow Orb 36.27 36.27 (85.83%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.99 5.99 (14.17%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.53 1628458.17 (80.28%) 10081.31 614678.16 27.40%
Vampiric Touch Mana Mana 216.70 1026663.44 (66.12%) 4737.69 118756.72 10.37%
mp5_regen Mana 1463.00 402101.71 (25.90%) 274.85 36798.29 8.38%
vampiric_embrace Health 51.16 399964.50 (19.72%) 7817.47 289795.29 42.01%
pet - shadowfiend
vampiric_embrace Health 0.16 1791.64 (100.00%) 11402.99 998.29 35.78%
Resource RPS-Gain RPS-Loss
Health 13457.40 14867.22
Mana 4242.63 4408.12
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health -53084.26 -379790.43 462887.00
Mana 239433.30 177300.00 290820.00
Shadow Orb 1.08 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 8.5%
shadowfiend-Mana Cap 8.5%
lightwell-Mana Cap 8.5%

Procs

Count Interval
Shadowy Recall Extra Tick 225.5 1.6sec
Shadowy Apparition Procced 61.1 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_pi_swi Damage Per Second
Count 49992
Mean 103609.56
Minimum 96252.67
Maximum 112239.70
Spread ( max - min ) 15987.03
Range [ ( max - min ) / 2 * 100% ] 7.72%
Standard Deviation 2139.6997
5th Percentile 100198.65
95th Percentile 107134.04
( 95th Percentile - 5th Percentile ) 6935.40
Mean Distribution
Standard Deviation 9.5698
95.00% Confidence Intervall ( 103590.80 - 103628.31 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1638
0.1 Scale Factor Error with Delta=300 39083
0.05 Scale Factor Error with Delta=300 156332
0.01 Scale Factor Error with Delta=300 3908312
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103609.56
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36462968.96
Distribution Chart

DTPS

Sample Data priest_90_pi_swi Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_pi_swi Healing Per Second
Count 49992
Mean 13547.33
Minimum 0.00
Maximum 32730.34
Spread ( max - min ) 32730.34
Range [ ( max - min ) / 2 * 100% ] 120.80%
Standard Deviation 8040.3178
5th Percentile 2389.31
95th Percentile 27328.96
( 95th Percentile - 5th Percentile ) 24939.64
Mean Distribution
Standard Deviation 35.9603
95.00% Confidence Intervall ( 13476.85 - 13617.82 )
Normalized 95.00% Confidence Intervall ( 99.48% - 100.52% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13531
0.1% Error 1353115
0.1 Scale Factor Error with Delta=300 551861
0.05 Scale Factor Error with Delta=300 2207446
0.01 Scale Factor Error with Delta=300 55186150
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 13547.33
Distribution Chart

Heal

Sample Data
Count 49992
Mean 4958324.50
Distribution Chart

HTPS

Sample Data priest_90_pi_swi Healing taken Per Second
Count 49992
Mean 7915.42
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 199.84
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.00 power_infusion,if=talent.power_infusion.enabled
D 3.43 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.88 shadow_word_death,if=active_enemies<=5
F 38.21 mind_blast,if=active_enemies<=6&cooldown_react
G 19.04 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 21.06 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 15.25 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.94 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.30 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.16 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.64 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 54.92 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTQFTFIGHMTFTFHIGTLQFMTFHGTQFTFHTIGTFLMTTFHIGTQFTFHIGTCTFMTLTQFHTGTFTFHMTIGFTLHFTIGQFBTHFTIGTFKMTHFLTIGTFTHTFMTIGTFTCTHTFTIGLTFMTHTFTIGTFTHTFMTIGTLFTHTQFTEDEGFTHPEETFMTEEGTFLHPE9DETFTEEIFGMHTBECEFT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl : 103117 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103117.1 103117.1 19.85 / 0.02% 3725 / 3.6% 23.8 5486.5 5486.5 42.57 / 0.78% 7453 / 135.8% 1.3 4163.0 4056.9 Mana 0.51% 35.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.97 0.00 3.05 2.33 1.04 0.82 1.21
Normalized 1.00 0.00 0.77 0.59 0.26 0.21 0.30
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=3.97, SpellDamage=3.05, HitRating=2.33, CritRating=1.04, HasteRating=0.82, MasteryRating=1.21 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=3.97, SpellDamage=3.05, HitRating=0.00, CritRating=1.04, HasteRating=0.82, MasteryRating=1.21 )

Charts

http://1.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:347399|223621|188139|123638|114287|99598|83456|51033&chds=0,694798&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++347399++devouring_plague,9482C9,0,0,15|t++223621++shadow_word_pain,9482C9,1,0,15|t++188139++vampiric_touch,9482C9,2,0,15|t++123638++halo,9482C9,3,0,15|t++114287++shadow_word_death,9482C9,4,0,15|t++99598++mind_blast,9482C9,5,0,15|t++83456++mind_spike,4A79D3,6,0,15|t++51033++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,12,10,9,9,8,6,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.97,3.05,2.33,1.21,1.04,0.82|3.94,3.02,2.30,1.18,1.01,0.79|4.00,3.08,2.36,1.24,1.07,0.85&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.97++Int,FFFFFF,0,0,15,0.1,e|t++++3.05++SP,FFFFFF,0,1,15,0.1,e|t++++2.33++Hit,FFFFFF,0,2,15,0.1,e|t++++1.21++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.04++Crit,FFFFFF,0,4,15,0.1,e|t++++0.82++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.774&chtt=Scale Factors|priest_90_tof_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:68643210zz0yyxxvwuusrqnnnmmmmlkihhgfeeffffffgggfeedeeeeeeedcbbaaaaZZabbbccccccdccbbbbaaZZZYZZZZZaaaaabcccbbccdddddccccccccccccddddddddcdccccbaZZZZZaabbbbccccddddccddddddcbaZaabbccddefgffffggggihhgfeddcbbabbcccdddeeedddcccccccbaaaaZZZZZZaabbccdddeeeefeeeeddcccccbcbbbbaaaaaaaaZZZZYYZZZZZZZZaaaaaabccdeeffghggghhhiiiijjjjkkkklllnnnooonnooppqrrsstttttuussruvvvvvvvvutts&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5366,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103117|max=192156&chxp=1,1,54,100&chtt=priest_90_tof_fdcl DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,24,80,40,120,96,232,208,368,552,648,776,1024,1280,1560,1744,1944,2288,2416,2296,2712,2912,2920,2824,2608,2600,2240,1968,2024,1632,1464,1256,1168,864,680,512,496,384,320,240,104,80,72,40,72,24,24,8,24&chds=0,2920&chbh=5&chxt=x&chxl=0:|min=95651|avg=103117|max=111388&chxp=0,1,47,100&chtt=priest_90_tof_fdcl DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:48.9,12.4,9.8,6.2,5.7,5.0,3.8,2.9,0.7,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 178.8s|mind_blast 45.4s|mind_spike 35.9s|vampiric_touch 22.7s|shadow_word_pain 20.9s|devouring_plague 18.3s|shadow_word_death 14.0s|halo 10.7s|shadowfiend 2.4s|waiting 1.9s&chtt=priest_90_tof_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl 103117
devouring_plague 6249 (17415) 6.1% (16.9%) 15.4 25.12sec 414333 347399 122431 253782 148687 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 0.00 0.00 1.1927 0.0000 2287263.66 2287263.66 0.00 347399.00 347399.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.31 80.01% 122430.99 107519 165536 122400.84 113358 133425 1506895 1506895 0.00
crit 3.08 19.99% 253781.58 221488 341004 245642.69 0 341004 780369 780369 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2671 2.6% 39.4 9.24sec 24803 0 20442 42379 24842 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.41 39.35 0.00 0.00 0.0000 0.0000 977537.39 977537.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.46 79.95% 20442.37 17856 27490 20441.46 18976 22405 643103 643103 0.00
crit 7.89 20.05% 42379.03 36784 56629 42360.58 0 54087 334434 334434 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8494 8.2% 15.4 25.12sec 202100 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.2 20292 42053 24633 19.9% 0.0% 26.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 126.21 126.21 0.0000 0.7549 3108928.45 3108928.45 0.00 32631.45 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.0 80.05% 20292.20 17856 27490 20290.52 19378 21386 2050217 2050217 0.00
crit 25.2 19.95% 42053.37 36784 56629 42046.69 38549 46640 1058712 1058712 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3603) 0.0% (3.5%) 9.0 41.97sec 146511 123638 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00 123638.35 123638.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.20 80.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.80 19.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3603 3.5% 9.0 41.97sec 146511 0 120441 249714 146507 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1318602.99 1318602.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.18 79.83% 120441.44 109581 160794 120433.55 110474 136731 865369 865369 0.00
crit 1.82 20.17% 249714.13 225736 331235 215655.06 0 331235 453234 453234 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 5486 100.0% 9.0 41.97sec 223117 0 19387 26097 20936 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.90 0.00 0.00 0.0000 0.0000 2008055.13 19225212.59 89.56 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.75 76.90% 19386.71 0 212691 19367.66 0 113806 1429993 11852600 87.95
crit 22.15 23.10% 26096.66 0 438143 26217.09 0 199802 578062 7372612 92.13
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12367 12.0% 38.4 9.53sec 117720 99598 96871 200870 117719 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.45 38.45 0.00 0.00 1.1820 0.0000 4526324.71 4526324.71 0.00 99597.87 99597.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.74 79.95% 96870.85 86183 133296 96864.76 91852 100738 2977975 2977975 0.00
crit 7.71 20.05% 200869.75 177536 274589 200839.34 177536 246934 1548349 1548349 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18989 (24937) 18.4% (24.2%) 104.2 3.41sec 87590 51033 0 0 0 0.0% 0.0% 0.0% 0.0% 223.7 25580 53054 31066 20.0% 0.0% 45.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.20 104.20 223.72 223.72 1.7163 0.7358 6949898.95 6949898.95 0.00 51032.99 51032.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.0 80.03% 25580.32 22887 35236 25580.38 24863 26431 4580138 4580138 0.00
crit 44.7 19.97% 53054.49 47146 72586 53053.54 49822 57322 2369761 2369761 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5948 5.8% 70.0 5.02sec 31118 0 25596 53110 31119 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.96 69.96 0.00 0.00 0.0000 0.0000 2176942.23 2176942.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.91 79.93% 25595.87 22887 35236 25596.92 24439 27035 1431152 1431152 0.00
crit 14.04 20.07% 53109.88 47146 72586 53108.32 48562 59202 745790 745790 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8185 7.9% 30.5 11.32sec 98307 83456 81140 168242 98308 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.47 30.47 0.00 0.00 1.1779 0.0000 2995752.34 2995752.34 0.00 83456.44 83456.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.47 80.29% 81140.26 72412 112341 81146.80 74736 88723 1985277 1985277 0.00
crit 6.01 19.71% 168242.15 149169 231423 167837.11 0 220802 1010475 1010475 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4370 4.2% 11.9 4.85sec 134474 114287 110064 228945 134471 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.89 11.89 0.00 0.00 1.1767 0.0000 1599334.09 1599334.09 0.00 114287.13 114287.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.45 79.47% 110064.43 83662 129665 110047.35 98082 122888 1040252 1040252 0.00
crit 2.44 20.53% 228944.84 172343 267111 214372.19 0 267111 559082 559082 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9722 (12778) 9.4% (12.4%) 17.8 21.20sec 263287 223621 0 0 0 0.0% 0.0% 0.0% 0.0% 179.9 14985 30985 19775 29.9% 0.0% 98.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.76 17.76 179.94 179.94 1.1774 2.0045 3558359.06 3558359.06 0.00 12255.38 223621.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.1 70.06% 14985.40 13422 20660 14985.78 14390 15642 1889173 1889173 0.00
crit 53.9 29.94% 30984.62 27649 42560 30983.64 29278 33325 1669187 1669187 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3055 3.0% 56.3 6.38sec 19859 0 15070 31215 19889 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.31 56.22 0.00 0.00 0.0000 0.0000 1118232.50 1118232.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.44 70.15% 15070.01 13422 20660 15069.38 14170 16044 594404 594404 0.00
crit 16.78 29.85% 31215.48 27649 42560 31215.32 27857 35589 523828 523828 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2233 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3810 3.7% 63.5 5.68sec 21956 0 18711 37691 22480 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.52 62.04 0.00 0.00 0.0000 0.0000 1394637.96 1394637.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.72 80.14% 18711.40 16669 25856 18710.75 17774 19795 930338 930338 0.00
crit 12.32 19.86% 37690.97 33338 51713 37681.53 33338 44808 464300 464300 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8886 (11687) 8.6% (11.3%) 19.3 18.96sec 222181 188139 0 0 0 0.0% 0.0% 0.0% 0.0% 159.7 16789 34789 20362 19.9% 0.0% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.25 19.25 159.72 159.72 1.1810 2.2367 3252258.01 3252258.01 0.00 11257.00 188139.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.0 80.15% 16788.71 15001 23421 16788.65 16165 17553 2149242 2149242 0.00
crit 31.7 19.85% 34789.31 30902 48248 34788.10 31941 37999 1103016 1103016 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2801 2.7% 49.9 7.12sec 20529 0 16914 35120 20548 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.94 49.90 0.00 0.00 0.0000 0.0000 1025279.76 1025279.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.93 80.04% 16913.59 15001 23421 16913.55 15992 18445 675426 675426 0.00
crit 9.96 19.96% 35120.21 30902 48248 35124.64 30902 42725 349853 349853 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52188 / 3966
melee 52188 3.8% 26.9 14.65sec 53984 54873 49846 101028 53983 20.9% 7.2% 24.0% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.89 26.89 0.00 0.00 0.9838 0.0000 1451493.16 1451493.16 0.00 54872.72 54872.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.23 45.49% 49846.22 38145 58728 49842.10 43405 56580 609696 609696 0.00
crit 5.61 20.88% 101028.05 76291 117456 100845.13 0 117456 567210 567210 0.00
glance 6.46 24.04% 37570.24 28609 44046 37545.68 0 44046 242861 242861 0.00
block 0.63 2.35% 50243.56 38145 58728 23672.34 0 58728 31727 31727 0.00
parry 1.95 7.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1871 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.25%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.4sec 108.4sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.46%
glyph_mind_spike 21.9 8.5 15.9sec 11.3sec 36.55% 54.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.65%
  • glyph_mind_spike_2:7.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.2 36.2sec 20.4sec 43.75% 44.09%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.75%

    Trigger Attempt Success

    • trigger_pct:2.18%
light_of_the_cosmos 8.0 0.0 48.8sec 48.8sec 42.70% 42.70%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.70%

    Trigger Attempt Success

    • trigger_pct:15.29%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.35% 49.36%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.35%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 26.6 4.9 13.2sec 11.1sec 20.96% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:19.18%
  • surge_of_darkness_2:1.78%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.1 89.2 28.0sec 0.7sec 15.69% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:15.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.9 0.0 194.2sec 194.2sec 3.81% 4.02%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.81%

Trigger Attempt Success

  • trigger_pct:93.05%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.6sec 90.6sec 85.54% 80.34%

Buff details

  • buff initial source:priest_90_tof_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl
devouring_plague Shadow Orb 15.4 46.1 3.0 3.0 138110.2
halo Mana 9.0 364500.0 40500.0 40500.0 3.6
mind_blast Mana 38.5 346050.7 9000.0 9000.0 13.1
mind_flay Mana 104.2 312598.6 3000.0 3000.0 29.2
shadow_word_death Mana 11.9 92770.1 7800.0 7800.2 17.2
shadow_word_pain Mana 17.8 234463.7 13200.0 13200.0 19.9
vampiric_touch Mana 19.3 173273.8 9000.0 9000.1 24.7
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.94 138157.87 (9.30%) 5539.29 86315.09 38.45%
Shadow Orbs from Mind Blast Shadow Orb 38.45 38.45 (86.46%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.02 6.02 (13.54%) 1.00 0.00 0.00%
Devouring Plague Health Health 165.56 1746055.67 (78.97%) 10546.20 553047.03 24.05%
Vampiric Touch Mana Mana 209.62 958109.33 (64.53%) 4570.74 149914.03 13.53%
mp5_regen Mana 1463.00 388571.62 (26.17%) 265.60 50328.38 11.47%
vampiric_embrace Health 49.46 465057.24 (21.03%) 9401.87 249245.72 34.89%
pet - shadowfiend
vampiric_embrace Health 0.05 516.07 (100.00%) 11238.36 520.96 50.24%
Resource RPS-Gain RPS-Loss
Health 13454.80 14867.22
Mana 4056.94 4163.00
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health -54045.20 -401742.96 462887.00
Mana 261182.62 212400.00 300000.00
Shadow Orb 1.32 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 11.7%
shadowfiend-Mana Cap 11.7%
lightwell-Mana Cap 11.7%

Procs

Count Interval
Shadowy Recall Extra Tick 215.4 1.7sec
Shadowy Apparition Procced 63.5 5.7sec
FDCL Mind Spike proc 31.5 11.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl Damage Per Second
Count 49992
Mean 103117.06
Minimum 95650.78
Maximum 111388.19
Spread ( max - min ) 15737.42
Range [ ( max - min ) / 2 * 100% ] 7.63%
Standard Deviation 2263.9737
5th Percentile 99495.11
95th Percentile 106945.33
( 95th Percentile - 5th Percentile ) 7450.23
Mean Distribution
Standard Deviation 10.1256
95.00% Confidence Intervall ( 103097.22 - 103136.91 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1851
0.1 Scale Factor Error with Delta=300 43754
0.05 Scale Factor Error with Delta=300 175019
0.01 Scale Factor Error with Delta=300 4375487
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103117.06
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36289352.09
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl Healing Per Second
Count 49992
Mean 5486.49
Minimum 0.00
Maximum 31695.48
Spread ( max - min ) 31695.48
Range [ ( max - min ) / 2 * 100% ] 288.85%
Standard Deviation 4855.9459
5th Percentile 783.37
95th Percentile 15689.00
( 95th Percentile - 5th Percentile ) 14905.63
Mean Distribution
Standard Deviation 21.7182
95.00% Confidence Intervall ( 5443.92 - 5529.06 )
Normalized 95.00% Confidence Intervall ( 99.22% - 100.78% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30092
0.1% Error 3009225
0.1 Scale Factor Error with Delta=300 201294
0.05 Scale Factor Error with Delta=300 805176
0.01 Scale Factor Error with Delta=300 20129424
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 5486.49
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2008055.13
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl Healing taken Per Second
Count 49992
Mean 7413.71
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 214.86
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.89 shadow_word_death,if=active_enemies<=5
F 39.47 mind_blast,if=active_enemies<=6&cooldown_react
G 17.76 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 21.21 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.18 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.93 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 12.16 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.10 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 8.23 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 27.29 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 56.41 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTQFRTFMGHTQFTRTFHTRTGTFLMRTHFTGFTRRTHRFMTFGTLHQFRTFMGRTHFTTFRTGTHLFMTRTQFJRTGHFRTRTRFMJRTFHGTLRTFTBTJFHMRGTFRTFHTGFLJMRTRQFHHTTFGRTRTQFHMRTFTRTGLQFTHRTFMTTGFRTHTFTRTQFMGLHRTFRTEEQFKMTGEEFHTPEDEFTLE9EFGHMRTEEFTRTEBDE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb : 103870 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103870.2 103870.2 18.84 / 0.02% 3503 / 3.4% 22.3 6647.2 6647.2 45.83 / 0.69% 8193 / 123.3% 1.6 4242.6 4117.6 Mana 0.51% 30.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.07 0.00 3.21 2.38 1.02 0.76 1.23
Normalized 1.00 0.00 0.79 0.58 0.25 0.19 0.30
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=4.07, SpellDamage=3.21, HitRating=2.38, CritRating=1.02, HasteRating=0.76, MasteryRating=1.23 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=4.07, SpellDamage=3.21, HitRating=0.00, CritRating=1.02, HasteRating=0.76, MasteryRating=1.23 )

Charts

http://8.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:351703|222654|187642|123276|114366|99623|51727&chds=0,703405&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++351703++devouring_plague,9482C9,0,0,15|t++222654++shadow_word_pain,9482C9,1,0,15|t++187642++vampiric_touch,9482C9,2,0,15|t++123276++halo,9482C9,3,0,15|t++114366++shadow_word_death,9482C9,4,0,15|t++99623++mind_blast,9482C9,5,0,15|t++51727++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:24,12,10,10,9,9,8,6,5,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.07,3.21,2.38,1.23,1.02,0.76|4.04,3.18,2.35,1.20,0.99,0.74|4.09,3.24,2.40,1.26,1.05,0.79&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.07++Int,FFFFFF,0,0,15,0.1,e|t++++3.21++SP,FFFFFF,0,1,15,0.1,e|t++++2.38++Hit,FFFFFF,0,2,15,0.1,e|t++++1.23++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.02++Crit,FFFFFF,0,4,15,0.1,e|t++++0.76++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.891&chtt=Scale Factors|priest_90_tof_mb%20Damage%20Per%20Second&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:56777654324331101zyxwvtrqoonnnmjjiiggeghgghhhhhgffeeffffhhhghhhggggghihijjiijiiigfeeedcbbbbbaaaaZZaZZbcccbbcdddddefghijjjjjjjiijjiiiijiihgfedccbbbcdcccccccccccdeeeeededddcbcbbccccdccdddefggghijijkiiihhgggggfeeeddddedcccbbbbbcbbbbbbbcccbddeffghijjklmmmmmmmnmllkjiihgfeccbbaaaZZYYYYYYaZaaabbcbcccccdefghjklmllmnooppppqqqqqqqppoopqqqqqppqqrrssttuuvvvvvwuuuwvvvvuuuutssr&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5802,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103870|max=179020&chxp=1,1,58,100&chtt=priest_90_tof_mb DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,24,32,16,104,152,168,280,328,576,728,1072,1464,1432,1864,2240,2760,2728,2920,3264,3360,3240,3072,3024,2648,2344,2032,1880,1552,1400,944,656,520,384,224,216,152,24,64,48,8,8,8,0,8,0,0,8&chds=0,3360&chbh=5&chxt=x&chxl=0:|min=95749|avg=103870|max=113479&chxp=0,1,46,100&chtt=priest_90_tof_mb DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:58.1,11.7,6.2,5.7,4.8,3.8,2.9,1.9,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 212.5s|mind_blast 43.0s|vampiric_touch 22.7s|shadow_word_pain 21.0s|devouring_plague 17.5s|shadow_word_death 13.8s|halo 10.7s|mindbender 6.8s|waiting 1.9s&chtt=priest_90_tof_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb 103870
devouring_plague 6000 (16809) 5.8% (16.2%) 14.7 26.49sec 418490 351703 123149 254788 149386 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 0.00 0.00 1.1899 0.0000 2196022.17 2196022.17 0.00 351702.72 351702.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.77 80.07% 123149.42 107519 165536 123120.64 114183 134040 1449552 1449552 0.00
crit 2.93 19.93% 254788.01 221488 341004 244475.48 0 341004 746470 746470 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2589 2.5% 38.1 9.60sec 24906 0 20524 42597 24944 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.05 37.99 0.00 0.00 0.0000 0.0000 947691.35 947691.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.38 79.98% 20524.39 17856 27490 20522.75 19172 22568 623631 623631 0.00
crit 7.61 20.02% 42596.69 36784 56629 42585.99 0 56629 324060 324060 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8219 7.9% 14.7 26.49sec 204638 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.4 20408 42316 24782 20.0% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 121.39 121.39 0.0000 0.7510 3008270.44 3008270.44 0.00 32997.36 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.1 80.03% 20408.12 17856 27490 20405.11 19420 21495 1982640 1982640 0.00
crit 24.2 19.97% 42315.76 36784 56629 42303.35 38842 46592 1025630 1025630 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3589) 0.0% (3.5%) 9.0 41.80sec 145972 123276 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1842 0.0000 0.00 0.00 0.00 123275.99 123275.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.22 80.17% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.78 19.83% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3589 3.5% 9.0 41.80sec 145972 0 120352 249357 145974 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1313752.22 1313752.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 80.14% 120351.76 109581 160794 120340.06 109581 138633 868036 868036 0.00
crit 1.79 19.86% 249357.21 225736 331235 214804.03 0 331235 445716 445716 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 6647 100.0% 9.0 41.80sec 270318 0 23183 32620 25351 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.96 0.00 0.00 0.0000 0.0000 2432864.05 19211856.77 87.34 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.91 77.02% 23182.92 0 212691 23148.66 0 111628 1713511 11876021 85.60
crit 22.05 22.98% 32620.44 0 438143 32653.86 0 209908 719353 7335836 90.20
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11692 11.3% 36.4 10.09sec 117696 99623 96869 200912 117696 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.36 36.36 0.00 0.00 1.1814 0.0000 4279091.90 4279091.90 0.00 99622.66 99622.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.08 79.98% 96869.00 86183 133296 96865.04 91960 101175 2816880 2816880 0.00
crit 7.28 20.02% 200911.76 177536 274589 200903.59 0 243515 1462211 1462211 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 22892 (30038) 22.0% (28.9%) 120.3 2.97sec 91352 51727 0 0 0 0.0% 0.0% 0.0% 0.0% 269.5 25599 53083 31088 20.0% 0.0% 54.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.35 120.35 269.51 269.51 1.7661 0.7376 8378543.15 8378543.15 0.00 51726.66 51726.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 215.7 80.03% 25599.12 22887 35236 25599.19 24896 26297 5521534 5521534 0.00
crit 53.8 19.97% 53083.23 47146 72586 53083.95 50444 56070 2857009 2857009 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7145 6.9% 84.2 4.21sec 31069 0 25604 53113 31075 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.18 84.16 0.00 0.00 0.0000 0.0000 2615233.55 2615233.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.42 80.11% 25604.20 22887 35236 25604.74 24438 26697 1726314 1726314 0.00
crit 16.74 19.89% 53112.64 47146 72586 53115.22 48158 60503 888920 888920 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 5.7 60.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.70 5.70 0.00 0.00 1.1934 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4301 4.1% 11.7 4.84sec 134478 114366 110227 229580 134476 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.71 11.71 0.00 0.00 1.1759 0.0000 1574245.47 1574245.47 0.00 114365.82 114365.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.33 79.68% 110226.61 83662 129665 110193.98 98057 122888 1028187 1028187 0.00
crit 2.38 20.32% 229580.30 172343 267111 213512.90 0 267111 546058 546058 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9741 (12797) 9.4% (12.3%) 17.9 21.17sec 262202 222654 0 0 0 0.0% 0.0% 0.0% 0.0% 180.2 15003 31022 19788 29.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 180.17 180.17 1.1777 2.0035 3565130.28 3565130.28 0.00 12260.91 222654.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.4 70.13% 15003.12 13422 20660 15003.26 14432 15968 1895650 1895650 0.00
crit 53.8 29.87% 31022.21 27649 42560 31020.15 29559 33206 1669481 1669481 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3056 2.9% 56.2 6.40sec 19894 0 15084 31231 19917 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.23 56.16 0.00 0.00 0.0000 0.0000 1118624.93 1118624.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.35 70.07% 15083.67 13422 20660 15083.83 14277 16154 593589 593589 0.00
crit 16.81 29.93% 31231.37 27649 42560 31232.94 28341 35038 525036 525036 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3813 3.7% 63.5 5.68sec 21968 0 18727 37704 22499 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.53 62.04 0.00 0.00 0.0000 0.0000 1395724.91 1395724.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.70 80.12% 18726.67 16669 25856 18725.86 17625 19708 930807 930807 0.00
crit 12.33 19.88% 37704.20 33338 51713 37697.91 33750 44341 464918 464918 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8843 (11626) 8.5% (11.2%) 19.2 19.07sec 221450 187642 0 0 0 0.0% 0.0% 0.0% 0.0% 158.9 16797 34809 20372 19.8% 0.0% 97.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.21 19.21 158.88 158.88 1.1802 2.2375 3236562.70 3236562.70 0.00 11251.55 187641.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.4 80.16% 16797.42 15001 23421 16797.49 16170 17394 2139179 2139179 0.00
crit 31.5 19.84% 34809.42 30902 48248 34807.88 32853 37551 1097384 1097384 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2783 2.7% 49.7 7.16sec 20509 0 16939 35109 20530 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.66 49.61 0.00 0.00 0.0000 0.0000 1018403.49 1018403.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.80 80.24% 16939.14 15001 23421 16938.93 15903 18152 674207 674207 0.00
crit 9.80 19.76% 35109.15 30902 48248 35098.84 30902 42359 344197 344197 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37106 / 9205
melee 37106 8.9% 81.3 4.17sec 41429 39574 38631 77900 41429 20.2% 7.4% 24.0% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.32 81.32 0.00 0.00 1.0469 0.0000 3369210.50 3369210.50 0.00 39574.45 39574.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.38 45.97% 38630.97 30516 46982 38633.44 36005 40996 1444185 1444185 0.00
crit 16.46 20.24% 77899.52 61032 93964 77899.54 69700 87463 1282181 1282181 0.00
glance 19.50 23.98% 29075.45 22887 35237 29079.23 26638 32020 567060 567060 0.00
block 1.95 2.40% 38773.65 30516 46982 33566.20 0 46982 75784 75784 0.00
parry 6.02 7.41% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.7 19.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.70 18.70 0.00 0.00 1.1871 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.33%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.5sec 108.5sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.56%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.94% 11.94%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.94%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.3 36.2sec 20.3sec 43.85% 44.26%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.85%

    Trigger Attempt Success

    • trigger_pct:2.18%
light_of_the_cosmos 8.0 0.0 48.6sec 48.6sec 42.89% 42.89%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.89%

    Trigger Attempt Success

    • trigger_pct:15.16%
shadow_word_death_reset_cooldown 5.9 0.0 10.2sec 10.2sec 9.34% 49.16%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.34%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
twist_of_fate 1.2 90.8 26.6sec 0.7sec 15.82% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:15.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 1.0 0.0 194.9sec 194.9sec 3.90% 4.13%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.90%

Trigger Attempt Success

  • trigger_pct:95.30%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.7 0.0 19.8sec 19.8sec 85.41% 84.00%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.20% 2.20%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.20%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb
devouring_plague Shadow Orb 14.7 44.1 3.0 3.0 139496.2
halo Mana 9.0 364500.0 40500.0 40500.0 3.6
mind_blast Mana 36.4 327215.5 9000.0 9000.0 13.1
mind_flay Mana 120.3 361034.9 3000.0 3000.0 30.5
shadow_word_death Mana 11.7 91313.7 7800.0 7800.4 17.2
shadow_word_pain Mana 17.9 235794.2 13200.0 13200.0 19.9
vampiric_touch Mana 19.2 172926.7 9000.0 9000.0 24.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 75.30 228218.28 (15.14%) 3030.74 101672.35 30.82%
Shadow Orbs from Mind Blast Shadow Orb 36.36 36.36 (85.94%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.95 5.95 (14.06%) 1.00 0.00 0.00%
Devouring Plague Health Health 159.38 1669708.12 (79.46%) 10476.20 543555.33 24.56%
Vampiric Touch Mana Mana 208.48 908938.05 (60.31%) 4359.78 193141.47 17.53%
mp5_regen Mana 1463.00 369866.98 (24.54%) 252.81 69033.02 15.73%
vampiric_embrace Health 52.46 431689.48 (20.54%) 8228.55 229596.32 34.72%
pet - mindbender
vampiric_embrace Health 7.04 53339.15 (100.00%) 7576.41 34353.64 39.17%
Resource RPS-Gain RPS-Loss
Health 13448.13 14867.22
Mana 4117.55 4242.58
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health -56484.10 -379790.43 462887.00
Mana 254237.89 219000.00 297061.90
Shadow Orb 1.20 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.9%
shadowfiend-Mana Cap 15.9%
lightwell-Mana Cap 15.9%

Procs

Count Interval
Shadowy Recall Extra Tick 227.9 1.6sec
Shadowy Apparition Procced 63.5 5.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_tof_mb Damage Per Second
Count 49992
Mean 103870.24
Minimum 95748.60
Maximum 113479.06
Spread ( max - min ) 17730.46
Range [ ( max - min ) / 2 * 100% ] 8.53%
Standard Deviation 2149.2621
5th Percentile 100382.00
95th Percentile 107387.12
( 95th Percentile - 5th Percentile ) 7005.12
Mean Distribution
Standard Deviation 9.6126
95.00% Confidence Intervall ( 103851.40 - 103889.08 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1644
0.1 Scale Factor Error with Delta=300 39433
0.05 Scale Factor Error with Delta=300 157732
0.01 Scale Factor Error with Delta=300 3943323
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103870.24
Distribution Chart

Damage

Sample Data
Count 49992
Mean 34647296.56
Distribution Chart

DTPS

Sample Data priest_90_tof_mb Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_tof_mb Healing Per Second
Count 49992
Mean 6647.17
Minimum 0.00
Maximum 33162.78
Spread ( max - min ) 33162.78
Range [ ( max - min ) / 2 * 100% ] 249.45%
Standard Deviation 5228.2481
5th Percentile 1078.70
95th Percentile 17465.10
( 95th Percentile - 5th Percentile ) 16386.40
Mean Distribution
Standard Deviation 23.3833
95.00% Confidence Intervall ( 6601.34 - 6693.00 )
Normalized 95.00% Confidence Intervall ( 99.31% - 100.69% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23764
0.1% Error 2376484
0.1 Scale Factor Error with Delta=300 233343
0.05 Scale Factor Error with Delta=300 933374
0.01 Scale Factor Error with Delta=300 23334368
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 6647.17
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2432864.05
Distribution Chart

HTPS

Sample Data priest_90_tof_mb Healing taken Per Second
Count 49992
Mean 7706.80
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 183.26
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 5.70 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.30 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.71 shadow_word_death,if=active_enemies<=5
F 37.88 mind_blast,if=active_enemies<=6&cooldown_react
G 17.86 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 20.85 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.95 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.40 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.10 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.94 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 54.57 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTQFMGHTQFTFTHTGLFMTFHATGTFTFHMTGTFLTHFTGQFMTHQFTATFGTLTHFHMTFTGTFHTQFMTGLTHFTTAQFTGHFMTQFTLGFHTFTTHFGMTQFATHFLGTFMTHFHTGTFTTHFMLTGTFTATHEEFKMTTEEFGTHEDEFLTE9EFGTHTEDEFTEEFA

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi : 103254 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103254.1 103254.1 19.33 / 0.02% 3609 / 3.5% 22.0 7296.0 7296.0 38.86 / 0.53% 7037 / 96.5% 1.6 4512.6 4306.7 Mana 0.42% 30.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.06 0.00 3.21 2.37 1.13 0.84 1.24
Normalized 1.00 0.00 0.79 0.58 0.28 0.21 0.30
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=4.06, SpellDamage=3.21, HitRating=2.37, CritRating=1.13, HasteRating=0.84, MasteryRating=1.24 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=4.06, SpellDamage=3.21, HitRating=0.00, CritRating=1.13, HasteRating=0.84, MasteryRating=1.24 )

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:347921|194124|186368|169722|123089|114585|99685|52004&chds=0,695842&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++347921++devouring_plague,9482C9,0,0,15|t++194124++shadow_word_pain,9482C9,1,0,15|t++186368++vampiric_touch,9482C9,2,0,15|t++169722++shadow_word_insanity,9482C9,3,0,15|t++123089++halo,9482C9,4,0,15|t++114585++shadow_word_death,9482C9,5,0,15|t++99685++mind_blast,9482C9,6,0,15|t++52004++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,12,9,9,8,7,7,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|shadow_word_insanity|mind_flay_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.06,3.21,2.37,1.24,1.13,0.84|4.03,3.18,2.34,1.21,1.10,0.82|4.09,3.23,2.39,1.26,1.16,0.87&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.06++Int,FFFFFF,0,0,15,0.1,e|t++++3.21++SP,FFFFFF,0,1,15,0.1,e|t++++2.37++Hit,FFFFFF,0,2,15,0.1,e|t++++1.24++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.13++Crit,FFFFFF,0,4,15,0.1,e|t++++0.84++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.884&chtt=Scale Factors|priest_90_tof_swi%20Damage%20Per%20Second&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:68644221020zyxxvwvvttrpooonnmnjjijhghfgffefffffededddddddcdbbbaZZYYXYbZabbcccffedcccccbeedabaaaaZbYZabdeddchedeeffffggffeddcbaccYZaZaZabbbbaaaaabcddcdcccccdccddddccddddcccccdeeeeeeedeggffeefffhhhhggggffggffffffeffdedccbaabbbcabbcccdccccccbcdecdccdcccddeeeffffffeeeddcbbbbaZZYXXWXXXYZYZabbbccccccccdeeffggggggghhiiiiijkkklllmmmnooooonoopqrrsstssssttttssrtuvvvvvuutttt&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5451,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=103254|max=189430&chxp=1,1,55,100&chtt=priest_90_tof_swi DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,0,8,24,64,48,88,96,160,216,272,480,688,752,1040,1120,1464,1552,1792,2264,2416,2760,2824,2688,2736,2872,2792,2640,2520,2232,2088,1808,1528,1336,1136,960,624,512,392,240,240,168,136,48,64,32,32,24&chds=0,2872&chbh=5&chxt=x&chxl=0:|min=94678|avg=103254|max=110680&chxp=0,1,54,100&chtt=priest_90_tof_swi DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.2,11.8,6.3,6.1,4.8,4.4,3.8,2.9,0.7,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 198.5s|mind_blast 43.2s|vampiric_touch 22.9s|shadow_word_pain 22.4s|devouring_plague 17.7s|shadow_word_insanity 16.0s|shadow_word_death 13.9s|halo 10.7s|shadowfiend 2.4s|waiting 1.5s&chtt=priest_90_tof_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi 103254
devouring_plague 6058 (16857) 5.9% (16.3%) 14.9 26.02sec 414443 347921 122893 254764 148927 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 14.89 0.00 0.00 1.1913 0.0000 2217068.01 2217068.01 0.00 347921.23 347921.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.95 80.26% 122893.40 107519 165536 122874.59 112130 134315 1468265 1468265 0.00
crit 2.94 19.74% 254763.88 221488 341004 245264.36 0 341004 748803 748803 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2587 2.5% 38.0 9.62sec 24917 0 20545 42627 24945 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.00 37.96 0.00 0.00 0.0000 0.0000 946898.64 946898.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.40 80.07% 20545.11 17856 27490 20541.20 18981 22792 624486 624486 0.00
crit 7.56 19.93% 42626.86 36784 56629 42611.95 0 56629 322413 322413 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8212 8.0% 14.9 26.02sec 201906 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.7 20344 42179 24702 20.0% 0.0% 25.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 14.89 121.68 121.68 0.0000 0.7571 3005720.47 3005720.47 0.00 32625.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.4 80.04% 20343.57 17856 27490 20340.09 19319 21557 1981283 1981283 0.00
crit 24.3 19.96% 42178.89 36784 56629 42164.36 38495 47212 1024438 1024438 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3583) 0.0% (3.5%) 9.0 41.67sec 145710 123089 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1839 0.0000 0.00 0.00 0.00 123089.22 123089.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.22 80.19% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.78 19.81% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3583 3.5% 9.0 41.67sec 145710 0 120166 248592 145709 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1311392.59 1311392.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 80.11% 120165.57 109581 160794 120157.01 109581 135679 866362 866362 0.00
crit 1.79 19.89% 248592.09 225736 331235 215423.90 0 331235 445031 445031 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 7296 100.0% 9.0 41.67sec 296706 0 25331 36213 27834 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.95 0.00 0.00 0.0000 0.0000 2670351.99 19179978.23 86.08 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.89 77.00% 25331.14 0 212691 25325.25 0 102065 1871397 11851211 84.22
crit 22.07 23.00% 36213.19 0 438143 36288.32 0 211375 798955 7328767 89.09
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11777 11.4% 36.6 10.00sec 117679 99685 96860 200812 117679 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.63 36.63 0.00 0.00 1.1805 0.0000 4310387.27 4310387.27 0.00 99685.18 99685.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.29 79.97% 96859.70 86183 133296 96855.30 92546 101512 2837222 2837222 0.00
crit 7.34 20.03% 200812.04 177536 274589 200738.31 0 274589 1473166 1473166 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 21484 (28202) 20.8% (27.3%) 112.9 3.18sec 91447 52004 0 0 0 0.0% 0.0% 0.0% 0.0% 252.9 25602 53119 31094 20.0% 0.0% 50.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.87 112.87 252.89 252.89 1.7585 0.7360 7863292.38 7863292.38 0.00 52004.20 52004.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 202.4 80.04% 25601.74 22887 35236 25601.64 24930 26363 5182266 5182266 0.00
crit 50.5 19.96% 53118.77 47146 72586 53117.50 50150 56717 2681027 2681027 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6718 6.5% 79.1 4.47sec 31092 0 25610 53118 31105 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.08 79.04 0.00 0.00 0.0000 0.0000 2458656.85 2458656.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.25 80.02% 25610.34 22887 35236 25610.17 24260 26873 1619922 1619922 0.00
crit 15.79 19.98% 53118.40 47146 72586 53114.96 48284 61621 838735 838735 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4353 4.2% 11.8 4.87sec 134844 114585 110360 228877 134849 20.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.82 11.82 0.00 0.00 1.1768 0.0000 1593187.65 1593187.65 0.00 114584.84 114584.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.37 79.34% 110360.10 83662 129665 110340.91 96211 121132 1034524 1034524 0.00
crit 2.44 20.66% 228876.57 172343 267111 213854.18 0 267111 558664 558664 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 7408 7.2% 13.5 25.22sec 200563 169722 165476 343517 200565 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.52 13.52 0.00 0.00 1.1818 0.0000 2711302.44 2711302.44 0.00 169721.59 169721.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.85 80.29% 165475.95 148247 229957 165402.07 151304 184753 1796129 1796129 0.00
crit 2.66 19.71% 343516.87 305389 473711 324359.78 0 473711 915173 915173 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9031 (11877) 8.7% (11.5%) 19.0 19.52sec 228774 194124 0 0 0 0.0% 0.0% 0.0% 0.0% 167.2 14990 31004 19765 29.8% 0.0% 89.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.00 19.00 167.24 167.24 1.1785 1.9653 3305481.71 3305481.71 0.00 12382.19 194124.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.4 70.18% 14989.72 13422 20660 14989.59 14414 15613 1759272 1759272 0.00
crit 49.9 29.82% 31003.74 27649 42560 31002.50 29300 33014 1546210 1546210 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2846 2.8% 52.4 6.86sec 19894 0 15084 31240 19913 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.35 52.31 0.00 0.00 0.0000 0.0000 1041547.08 1041547.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.67 70.11% 15084.14 13422 20660 15083.87 14011 16260 553185 553185 0.00
crit 15.63 29.89% 31240.05 27649 42560 31242.38 28102 35247 488362 488362 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2240 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3615 3.5% 60.1 6.01sec 22029 0 18737 37722 22510 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.06 58.77 0.00 0.00 0.0000 0.0000 1323013.78 1323013.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.10 80.13% 18737.24 16669 25856 18736.40 17783 19774 882432 882432 0.00
crit 11.68 19.87% 37722.25 33338 51713 37721.02 33338 45681 440582 440582 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8865 (11659) 8.6% (11.3%) 19.4 19.01sec 220132 186368 0 0 0 0.0% 0.0% 0.0% 0.0% 159.4 16779 34771 20360 19.9% 0.0% 97.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.39 19.39 159.36 159.36 1.1812 2.2384 3244607.09 3244607.09 0.00 11241.25 186368.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.6 80.09% 16778.74 15001 23421 16778.62 16176 17384 2141589 2141589 0.00
crit 31.7 19.91% 34770.68 30902 48248 34769.06 32614 37377 1103018 1103018 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2794 2.7% 49.8 7.14sec 20540 0 16925 35171 20552 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.79 49.76 0.00 0.00 0.0000 0.0000 1022662.03 1022662.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.87 80.12% 16924.91 15001 23421 16924.74 15827 18669 674726 674726 0.00
crit 9.89 19.88% 35170.57 30902 48248 35155.00 0 42409 347936 347936 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51979 / 3923
melee 51979 3.8% 26.6 14.80sec 53912 54916 49809 100946 53911 20.8% 7.3% 23.8% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.63 26.63 0.00 0.00 0.9817 0.0000 1435785.47 1435785.47 0.00 54916.25 54916.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.21 45.84% 49808.56 38145 58728 49801.52 43816 56870 608070 608070 0.00
crit 5.53 20.78% 100946.43 76291 117456 100756.46 0 117456 558635 558635 0.00
glance 6.35 23.85% 37575.07 28609 44046 37539.00 0 44046 238663 238663 0.00
block 0.61 2.27% 50232.60 38145 58728 23243.88 0 58728 30418 30418 0.00
parry 1.93 7.26% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1875 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.33%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 108.5sec 108.5sec 21.84% 21.84%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.84%

    Trigger Attempt Success

    • trigger_pct:16.69%
jade_serpent_potion 1.0 0.0 341.4sec 0.0sec 11.94% 11.94%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.94%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.3 36.2sec 20.4sec 43.76% 44.18%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.76%

    Trigger Attempt Success

    • trigger_pct:2.21%
light_of_the_cosmos 8.0 0.0 48.8sec 48.8sec 42.78% 42.78%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.78%

    Trigger Attempt Success

    • trigger_pct:15.27%
shadow_word_death_reset_cooldown 6.0 0.0 10.2sec 10.2sec 9.28% 49.39%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.28%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
twist_of_fate 1.2 90.8 31.5sec 0.7sec 15.77% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:15.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.9 0.0 0.0sec 0.0sec 3.71% 3.99%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.71%

Trigger Attempt Success

  • trigger_pct:91.65%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.6sec 90.6sec 85.44% 80.21%

Buff details

  • buff initial source:priest_90_tof_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi
devouring_plague Shadow Orb 14.9 44.7 3.0 3.0 138147.4
halo Mana 9.0 364500.0 40500.0 40500.0 3.6
mind_blast Mana 36.6 329654.9 9000.0 9000.0 13.1
mind_flay Mana 112.9 338619.4 3000.0 3000.0 30.5
shadow_word_death Mana 11.8 92159.8 7800.0 7800.2 17.3
shadow_word_insanity Mana 13.5 101389.2 7500.0 7500.0 26.7
shadow_word_pain Mana 19.0 250819.0 13200.0 13200.0 17.3
vampiric_touch Mana 19.4 174466.1 9000.0 9000.0 24.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.70 143112.53 (9.08%) 5794.18 79181.71 35.62%
Shadow Orbs from Mind Blast Shadow Orb 36.63 36.63 (85.97%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.98 5.98 (14.03%) 1.00 0.00 0.00%
Devouring Plague Health Health 159.64 1664728.64 (79.41%) 10427.96 552140.89 24.91%
Vampiric Touch Mana Mana 209.12 1021144.75 (64.78%) 4883.12 84287.57 7.62%
mp5_regen Mana 1463.00 411982.99 (26.14%) 281.60 26917.01 6.13%
vampiric_embrace Health 49.28 431663.93 (20.59%) 8758.65 257712.48 37.38%
pet - shadowfiend
vampiric_embrace Health 0.23 2449.20 (100.00%) 10856.36 2588.85 51.39%
Resource RPS-Gain RPS-Loss
Health 13482.35 14867.22
Mana 4306.67 4512.59
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health -43952.97 -401742.96 462887.00
Mana 224635.57 152100.00 285000.00
Shadow Orb 0.94 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.2%
shadowfiend-Mana Cap 6.2%
lightwell-Mana Cap 6.2%

Procs

Count Interval
Shadowy Recall Extra Tick 219.1 1.7sec
Shadowy Apparition Procced 60.1 6.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_tof_swi Damage Per Second
Count 49992
Mean 103254.11
Minimum 94678.35
Maximum 110680.47
Spread ( max - min ) 16002.12
Range [ ( max - min ) / 2 * 100% ] 7.75%
Standard Deviation 2204.5630
5th Percentile 99630.46
95th Percentile 106848.34
( 95th Percentile - 5th Percentile ) 7217.88
Mean Distribution
Standard Deviation 9.8599
95.00% Confidence Intervall ( 103234.78 - 103273.43 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1751
0.1 Scale Factor Error with Delta=300 41488
0.05 Scale Factor Error with Delta=300 165954
0.01 Scale Factor Error with Delta=300 4148859
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103254.11
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36355217.99
Distribution Chart

DTPS

Sample Data priest_90_tof_swi Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_tof_swi Healing Per Second
Count 49992
Mean 7296.04
Minimum 0.00
Maximum 32071.76
Spread ( max - min ) 32071.76
Range [ ( max - min ) / 2 * 100% ] 219.79%
Standard Deviation 4433.2068
5th Percentile 1922.54
95th Percentile 15996.64
( 95th Percentile - 5th Percentile ) 14074.10
Mean Distribution
Standard Deviation 19.8275
95.00% Confidence Intervall ( 7257.18 - 7334.90 )
Normalized 95.00% Confidence Intervall ( 99.47% - 100.53% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14182
0.1% Error 1418264
0.1 Scale Factor Error with Delta=300 167772
0.05 Scale Factor Error with Delta=300 671088
0.01 Scale Factor Error with Delta=300 16777206
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 7296.04
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2670351.99
Distribution Chart

HTPS

Sample Data priest_90_tof_swi Healing taken Per Second
Count 49992
Mean 7754.52
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 188.57
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.45 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 11.82 shadow_word_death,if=active_enemies<=5
F 37.97 mind_blast,if=active_enemies<=6&cooldown_react
G 19.00 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 21.19 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 13.52 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.92 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.44 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.09 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.18 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 48.99 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTIFGHMTQFTFHIGTLFMTHFHGTFTHFIGMTLFTTHTFGTQFMTHTFIGTQFLTHTQFIGMTQFTHTFIGTFMTLTHTFIGTBTFTHTIFGKMTFTHLTIFGTQFTHTFIGMTFTHTLFGTFMHTTFIGTFTHTQFIGLMTFTHTEEFGMTEEFHTPEDEFIGTLTE9EFHTEDEFGTPEEBFHM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 366 - 366 ( 366.0 )

Performance:

Total Events Processed: 921795104
Max Event Queue: 169
Sim Seconds: 18300000
CPU Seconds: 2169.6200
Speed Up: 8435

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 366.00
95th Percentile 366.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 366.00 - 366.00 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl priest_90_di_fdcl devouring_plague 2944 2441875 6672 2.78 118468 245561 17.0 17.0 19.9% 0.0% 0.0% 0.0% 22.59sec 2441875 366.00sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_mastery 124467 1055039 2883 7.21 19772 40968 44.1 44.0 19.8% 0.0% 0.0% 0.0% 8.26sec 1055039 366.00sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_tick ticks -2944 3371042 9210 23.13 19683 40770 17.0 141.1 20.0% 0.0% 0.0% 0.0% 22.59sec 3371042 366.00sec
priest_90_di_fdcl priest_90_di_fdcl halo 120644 0 0 1.48 0 0 9.0 9.0 20.3% 0.0% 0.0% 0.0% 42.02sec 0 366.00sec
priest_90_di_fdcl priest_90_di_fdcl halo_damage 120696 1295741 3540 1.48 118630 245490 9.0 9.0 20.0% 0.0% 0.0% 0.0% 42.02sec 1295741 366.00sec
priest_90_di_fdcl priest_90_di_fdcl halo_heal 120696 2010951 5494 15.70 19567 25770 9.0 95.8 23.0% 0.0% 0.0% 0.0% 42.02sec 18925846 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_blast 8092 4993631 13644 7.10 94902 196611 43.3 43.3 20.0% 0.0% 0.0% 0.0% 8.45sec 4993631 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay ticks -15407 6558185 17919 35.10 25228 52299 100.3 214.1 20.0% 0.0% 0.0% 0.0% 3.54sec 6558185 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay_mastery 124468 2044813 5587 10.95 25234 52287 66.8 66.8 19.9% 0.0% 0.0% 0.0% 5.25sec 2044813 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_spike 73510 2928844 8002 4.98 79417 164587 30.4 30.4 20.0% 0.0% 0.0% 0.0% 11.36sec 2928844 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_death 32379 1395493 3813 1.95 96251 199795 11.9 11.9 20.6% 0.0% 0.0% 0.0% 4.86sec 1395493 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain ticks -589 3480847 9511 29.47 14690 30368 17.7 179.8 29.8% 0.0% 0.0% 0.0% 21.21sec 3480847 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain_mastery 124464 1090228 2979 9.19 14724 30468 56.2 56.1 30.0% 0.0% 0.0% 0.0% 6.41sec 1090228 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.97sec 0 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadowy_apparition 87532 1364181 3727 10.15 18331 36880 63.4 61.9 19.9% 0.0% 0.0% 0.0% 5.69sec 1364181 366.00sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 190.93sec 0 366.00sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch ticks -34914 3192382 8722 26.14 16504 34189 19.2 159.5 19.9% 0.0% 0.0% 0.0% 18.99sec 3192382 366.00sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch_mastery 124465 996418 2722 8.15 16530 34253 49.8 49.7 19.9% 0.0% 0.0% 0.0% 7.15sec 996418 366.00sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend melee 0 1452644 52135 58.03 49923 100913 26.9 26.9 20.6% 7.1% 24.2% 2.3% 14.61sec 1452644 27.86sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend shadowcrawl 63619 0 0 10.77 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.54sec 0 27.86sec
priest_90_di_mb priest_90_di_mb devouring_plague 2944 2357262 6441 2.68 118620 245660 16.4 16.4 20.1% 0.0% 0.0% 0.0% 23.55sec 2357262 366.00sec
priest_90_di_mb priest_90_di_mb devouring_plague_mastery 124467 1023757 2797 6.99 19793 41021 42.7 42.6 19.9% 0.0% 0.0% 0.0% 8.55sec 1023757 366.00sec
priest_90_di_mb priest_90_di_mb devouring_plague_tick ticks -2944 3262222 8913 22.35 19709 40844 16.4 136.3 20.0% 0.0% 0.0% 0.0% 23.55sec 3262222 366.00sec
priest_90_di_mb priest_90_di_mb halo 120644 0 0 1.48 0 0 9.0 9.0 19.9% 0.0% 0.0% 0.0% 42.01sec 0 366.00sec
priest_90_di_mb priest_90_di_mb halo_damage 120696 1292308 3531 1.48 118752 245837 9.0 9.0 19.5% 0.0% 0.0% 0.0% 42.01sec 1292308 366.00sec
priest_90_di_mb priest_90_di_mb halo_heal 120696 1917812 5240 15.71 18523 24948 9.0 95.8 23.2% 0.0% 0.0% 0.0% 42.01sec 18978729 366.00sec
priest_90_di_mb priest_90_di_mb mind_blast 8092 4782874 13068 6.80 94897 196612 41.5 41.5 20.1% 0.0% 0.0% 0.0% 8.83sec 4782874 366.00sec
priest_90_di_mb priest_90_di_mb mind_flay ticks -15407 7893628 21567 42.27 25218 52276 117.5 257.8 19.9% 0.0% 0.0% 0.0% 3.04sec 7893628 366.00sec
priest_90_di_mb priest_90_di_mb mind_flay_mastery 124468 2469300 6747 13.22 25225 52288 80.7 80.6 19.9% 0.0% 0.0% 0.0% 4.38sec 2469300 366.00sec
priest_90_di_mb priest_90_di_mb mindbender 123040 0 0 0.93 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 60.89sec 0 366.00sec
priest_90_di_mb priest_90_di_mb shadow_word_death 32379 1379459 3769 1.92 96248 199751 11.7 11.7 20.7% 0.0% 0.0% 0.0% 4.83sec 1379459 366.00sec
priest_90_di_mb priest_90_di_mb shadow_word_pain ticks -589 3486920 9527 29.49 14700 30383 17.8 179.9 29.9% 0.0% 0.0% 0.0% 21.19sec 3486920 366.00sec
priest_90_di_mb priest_90_di_mb shadow_word_pain_mastery 124464 1092123 2984 9.20 14735 30479 56.2 56.1 30.0% 0.0% 0.0% 0.0% 6.40sec 1092123 366.00sec
priest_90_di_mb priest_90_di_mb shadowy_apparition 87532 1365866 3732 10.16 18340 36878 63.5 62.0 20.0% 0.0% 0.0% 0.0% 5.69sec 1365866 366.00sec
priest_90_di_mb priest_90_di_mb vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 192.69sec 0 366.00sec
priest_90_di_mb priest_90_di_mb vampiric_touch ticks -34914 3192215 8722 26.13 16503 34203 19.3 159.4 19.9% 0.0% 0.0% 0.0% 19.01sec 3192215 366.00sec
priest_90_di_mb priest_90_di_mb vampiric_touch_mastery 124465 1001499 2736 8.17 16535 34281 49.9 49.9 20.0% 0.0% 0.0% 0.0% 7.12sec 1001499 366.00sec
priest_90_di_mb priest_90_di_mb_mindbender melee 0 3373517 37172 53.76 38652 78042 81.3 81.3 20.3% 7.4% 23.9% 2.4% 4.17sec 3373517 90.75sec
priest_90_di_mb priest_90_di_mb_mindbender shadowcrawl 63619 0 0 12.36 0 0 18.7 18.7 0.0% 0.0% 0.0% 0.0% 19.81sec 0 90.75sec
priest_90_di_swi priest_90_di_swi devouring_plague 2944 2342275 6400 2.67 118301 245101 16.3 16.3 20.1% 0.0% 0.0% 0.0% 23.62sec 2342275 366.00sec
priest_90_di_swi priest_90_di_swi devouring_plague_mastery 124467 1010164 2760 6.91 19765 40975 42.2 42.1 19.9% 0.0% 0.0% 0.0% 8.64sec 1010164 366.00sec
priest_90_di_swi priest_90_di_swi devouring_plague_tick ticks -2944 3215497 8786 22.12 19637 40674 16.3 134.9 19.9% 0.0% 0.0% 0.0% 23.62sec 3215497 366.00sec
priest_90_di_swi priest_90_di_swi halo 120644 0 0 1.48 0 0 9.0 9.0 19.7% 0.0% 0.0% 0.0% 41.67sec 0 366.00sec
priest_90_di_swi priest_90_di_swi halo_damage 120696 1287991 3519 1.48 118140 244337 9.0 9.0 19.8% 0.0% 0.0% 0.0% 41.67sec 1287991 366.00sec
priest_90_di_swi priest_90_di_swi halo_heal 120696 3055381 8348 15.70 28942 41826 9.0 95.8 23.0% 0.0% 0.0% 0.0% 41.67sec 18846986 366.00sec
priest_90_di_swi priest_90_di_swi mind_blast 8092 4721547 12900 6.73 94830 196425 41.1 41.1 19.8% 0.0% 0.0% 0.0% 8.92sec 4721547 366.00sec
priest_90_di_swi priest_90_di_swi mind_flay ticks -15407 7381975 20169 39.52 25223 52305 109.3 241.1 19.9% 0.0% 0.0% 0.0% 3.27sec 7381975 366.00sec
priest_90_di_swi priest_90_di_swi mind_flay_mastery 124468 2311831 6316 12.36 25239 52316 75.4 75.4 20.0% 0.0% 0.0% 0.0% 4.68sec 2311831 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_death 32379 1395171 3812 1.94 96314 200045 11.9 11.9 20.6% 0.0% 0.0% 0.0% 4.86sec 1395171 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_insanity 129249 2853340 7796 2.37 163100 337737 14.4 14.4 19.7% 0.0% 0.0% 0.0% 23.39sec 2853340 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_pain ticks -589 3217124 8790 27.25 14682 30358 19.0 166.2 29.8% 0.0% 0.0% 0.0% 19.44sec 3217124 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_pain_mastery 124464 1009791 2759 8.52 14731 30493 52.0 52.0 29.9% 0.0% 0.0% 0.0% 6.91sec 1009791 366.00sec
priest_90_di_swi priest_90_di_swi shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.98sec 0 366.00sec
priest_90_di_swi priest_90_di_swi shadowy_apparition 87532 1289963 3524 9.60 18340 36906 59.8 58.5 19.9% 0.0% 0.0% 0.0% 6.03sec 1289963 366.00sec
priest_90_di_swi priest_90_di_swi vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 195.65sec 0 366.00sec
priest_90_di_swi priest_90_di_swi vampiric_touch ticks -34914 3191047 8719 26.15 16497 34171 19.4 159.5 19.8% 0.0% 0.0% 0.0% 18.98sec 3191047 366.00sec
priest_90_di_swi priest_90_di_swi vampiric_touch_mastery 124465 1001662 2737 8.19 16528 34266 50.0 49.9 19.9% 0.0% 0.0% 0.0% 7.11sec 1001662 366.00sec
priest_90_di_swi priest_90_di_swi_shadowfiend melee 0 1451475 52090 57.90 49907 101088 26.9 26.9 20.8% 7.2% 24.1% 2.3% 14.65sec 1451475 27.86sec
priest_90_di_swi priest_90_di_swi_shadowfiend shadowcrawl 63619 0 0 10.77 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.54sec 0 27.86sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague 2944 2206643 6029 2.53 117872 244350 15.4 15.4 20.1% 0.0% 0.0% 0.0% 25.00sec 2206643 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_mastery 124467 962039 2629 6.59 19728 40887 40.3 40.2 19.8% 0.0% 0.0% 0.0% 9.06sec 962039 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_tick ticks -2944 3056531 8351 21.11 19566 40516 15.4 128.8 19.9% 0.0% 0.0% 0.0% 25.00sec 3056531 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl halo 120644 0 0 1.48 0 0 9.0 9.0 20.0% 0.0% 0.0% 0.0% 41.79sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_damage 120696 1293137 3533 1.48 118308 245082 9.0 9.0 20.0% 0.0% 0.0% 0.0% 41.79sec 1293137 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_heal 120696 3500391 9564 15.73 33651 45876 9.0 96.0 23.1% 0.0% 0.0% 0.0% 41.79sec 18938299 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_blast 8092 4443813 12142 6.32 94908 196661 38.6 38.6 19.9% 0.0% 0.0% 0.0% 9.54sec 4443813 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay ticks -15407 7267519 19857 38.68 25343 52580 108.6 236.0 20.0% 0.0% 0.0% 0.0% 3.28sec 7267519 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay_mastery 124468 2271630 6207 12.09 25355 52567 73.8 73.8 20.0% 0.0% 0.0% 0.0% 4.77sec 2271630 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_spike 73510 3041384 8310 5.16 79541 164989 31.5 31.5 20.1% 0.0% 0.0% 0.0% 11.04sec 3041384 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl power_infusion 10060 0 0 0.66 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 121.15sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_death 32379 1405560 3840 1.96 96170 199930 12.0 12.0 20.6% 0.0% 0.0% 0.0% 4.81sec 1405560 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain ticks -589 3602541 9843 30.44 14706 30402 17.9 185.7 29.9% 0.0% 0.0% 0.0% 21.24sec 3602541 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain_mastery 124464 1132470 3094 9.54 14753 30534 58.3 58.2 29.9% 0.0% 0.0% 0.0% 6.19sec 1132470 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.98sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowy_apparition 87532 1404742 3838 10.44 18366 36970 65.2 63.7 19.9% 0.0% 0.0% 0.0% 5.55sec 1404742 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_embrace 15286 0 0 0.15 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% 199.65sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch ticks -34914 3298741 9013 26.95 16540 34274 19.6 164.4 19.9% 0.0% 0.0% 0.0% 18.80sec 3298741 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch_mastery 124465 1034559 2827 8.43 16568 34337 51.5 51.4 19.9% 0.0% 0.0% 0.0% 6.92sec 1034559 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend melee 0 1459469 52438 58.06 50062 101397 26.9 26.9 20.8% 7.3% 23.8% 2.3% 14.62sec 1459469 27.83sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend shadowcrawl 63619 0 0 10.78 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.55sec 0 27.83sec
priest_90_pi_mb priest_90_pi_mb devouring_plague 2944 2091800 5715 2.40 118286 245065 14.6 14.6 19.5% 0.0% 0.0% 0.0% 26.63sec 2091800 366.00sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_mastery 124467 920940 2516 6.28 19780 40966 38.4 38.3 20.0% 0.0% 0.0% 0.0% 9.54sec 920940 366.00sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_tick ticks -2944 2926072 7995 20.14 19638 40667 14.6 122.8 19.9% 0.0% 0.0% 0.0% 26.63sec 2926072 366.00sec
priest_90_pi_mb priest_90_pi_mb halo 120644 0 0 1.48 0 0 9.0 9.0 19.6% 0.0% 0.0% 0.0% 41.79sec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb halo_damage 120696 1291378 3528 1.48 118391 245216 9.0 9.0 19.8% 0.0% 0.0% 0.0% 41.79sec 1291378 366.00sec
priest_90_pi_mb priest_90_pi_mb halo_heal 120696 3422922 9352 15.73 32914 44818 9.0 96.0 23.1% 0.0% 0.0% 0.0% 41.79sec 18960015 366.00sec
priest_90_pi_mb priest_90_pi_mb mind_blast 8092 4141174 11315 5.90 94870 196518 36.0 36.0 19.8% 0.0% 0.0% 0.0% 10.22sec 4141174 366.00sec
priest_90_pi_mb priest_90_pi_mb mind_flay ticks -15407 8706467 23788 46.40 25318 52513 126.7 283.1 20.0% 0.0% 0.0% 0.0% 2.83sec 8706467 366.00sec
priest_90_pi_mb priest_90_pi_mb mind_flay_mastery 124468 2729602 7458 14.54 25330 52561 88.7 88.7 20.0% 0.0% 0.0% 0.0% 3.99sec 2729602 366.00sec
priest_90_pi_mb priest_90_pi_mb mindbender 123040 0 0 0.94 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 60.84sec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb power_infusion 10060 0 0 0.65 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 120.96sec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb shadow_word_death 32379 1394883 3811 1.94 96259 200001 11.9 11.9 20.6% 0.0% 0.0% 0.0% 4.81sec 1394883 366.00sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain ticks -589 3606299 9853 30.47 14709 30409 17.9 185.9 29.9% 0.0% 0.0% 0.0% 21.20sec 3606299 366.00sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain_mastery 124464 1129673 3087 9.51 14765 30547 58.1 58.0 29.9% 0.0% 0.0% 0.0% 6.22sec 1129673 366.00sec
priest_90_pi_mb priest_90_pi_mb shadowy_apparition 87532 1402476 3832 10.41 18377 36976 65.1 63.5 20.0% 0.0% 0.0% 0.0% 5.56sec 1402476 366.00sec
priest_90_pi_mb priest_90_pi_mb vampiric_embrace 15286 0 0 0.15 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch ticks -34914 3308321 9039 26.98 16569 34320 19.7 164.6 19.9% 0.0% 0.0% 0.0% 18.81sec 3308321 366.00sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch_mastery 124465 1035981 2831 8.44 16579 34379 51.5 51.5 20.0% 0.0% 0.0% 0.0% 6.93sec 1035981 366.00sec
priest_90_pi_mb priest_90_pi_mb_mindbender melee 0 3375615 37187 53.75 38690 78029 81.3 81.3 20.3% 7.4% 24.0% 2.4% 4.17sec 3375615 90.77sec
priest_90_pi_mb priest_90_pi_mb_mindbender shadowcrawl 63619 0 0 12.37 0 0 18.7 18.7 0.0% 0.0% 0.0% 0.0% 19.85sec 0 90.77sec
priest_90_pi_swi priest_90_pi_swi devouring_plague 2944 2105643 5753 2.41 118046 244415 14.7 14.7 19.7% 0.0% 0.0% 0.0% 26.36sec 2105643 366.00sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_mastery 124467 921305 2517 6.29 19774 40982 38.4 38.3 20.0% 0.0% 0.0% 0.0% 9.54sec 921305 366.00sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_tick ticks -2944 2926524 7996 20.19 19580 40533 14.7 123.2 19.9% 0.0% 0.0% 0.0% 26.36sec 2926524 366.00sec
priest_90_pi_swi priest_90_pi_swi halo 120644 0 0 1.48 0 0 9.0 9.0 19.9% 0.0% 0.0% 0.0% 41.56sec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi halo_damage 120696 1288502 3520 1.48 118084 244514 9.0 9.0 19.8% 0.0% 0.0% 0.0% 41.56sec 1288502 366.00sec
priest_90_pi_swi priest_90_pi_swi halo_heal 120696 4958325 13547 15.73 46917 67517 9.0 95.9 23.1% 0.0% 0.0% 0.0% 41.56sec 18904723 366.00sec
priest_90_pi_swi priest_90_pi_swi mind_blast 8092 4175655 11409 5.95 94849 196581 36.3 36.3 19.9% 0.0% 0.0% 0.0% 10.15sec 4175655 366.00sec
priest_90_pi_swi priest_90_pi_swi mind_flay ticks -15407 8134653 22226 43.28 25360 52596 118.8 264.0 20.0% 0.0% 0.0% 0.0% 3.03sec 8134653 366.00sec
priest_90_pi_swi priest_90_pi_swi mind_flay_mastery 124468 2543739 6950 13.53 25367 52600 82.6 82.5 20.0% 0.0% 0.0% 0.0% 4.29sec 2543739 366.00sec
priest_90_pi_swi priest_90_pi_swi power_infusion 10060 0 0 0.66 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 121.17sec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_death 32379 1394789 3811 1.95 96329 199712 11.9 11.9 20.4% 0.0% 0.0% 0.0% 4.83sec 1394789 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_insanity 129249 2972757 8122 2.50 161100 333184 15.3 15.3 19.6% 0.0% 0.0% 0.0% 21.31sec 2972757 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain ticks -589 3293364 8998 27.88 14686 30367 19.0 170.0 29.9% 0.0% 0.0% 0.0% 19.47sec 3293364 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain_mastery 124464 1034349 2826 8.70 14778 30572 53.1 53.0 29.9% 0.0% 0.0% 0.0% 6.79sec 1034349 366.00sec
priest_90_pi_swi priest_90_pi_swi shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi shadowy_apparition 87532 1322567 3614 9.81 18385 37016 61.1 59.8 19.9% 0.0% 0.0% 0.0% 5.92sec 1322567 366.00sec
priest_90_pi_swi priest_90_pi_swi vampiric_embrace 15286 0 0 0.15 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch ticks -34914 3311533 9048 27.07 16540 34271 19.8 165.1 19.8% 0.0% 0.0% 0.0% 18.74sec 3311533 366.00sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch_mastery 124465 1037589 2835 8.46 16572 34366 51.6 51.6 19.9% 0.0% 0.0% 0.0% 6.90sec 1037589 366.00sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend melee 0 1458129 52479 57.96 50076 101456 26.8 26.8 21.0% 7.2% 24.0% 2.3% 14.67sec 1458129 27.78sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend shadowcrawl 63619 0 0 10.80 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.56sec 0 27.78sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague 2944 2287264 6249 2.52 122431 253782 15.4 15.4 20.0% 0.0% 0.0% 0.0% 25.12sec 2287264 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_mastery 124467 977537 2671 6.45 20442 42379 39.4 39.4 20.1% 0.0% 0.0% 0.0% 9.24sec 977537 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_tick ticks -2944 3108928 8494 20.69 20292 42053 15.4 126.2 19.9% 0.0% 0.0% 0.0% 25.12sec 3108928 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl halo 120644 0 0 1.48 0 0 9.0 9.0 20.0% 0.0% 0.0% 0.0% 41.97sec 0 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_damage 120696 1318603 3603 1.48 120441 249714 9.0 9.0 20.2% 0.0% 0.0% 0.0% 41.97sec 1318603 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_heal 120696 2008055 5486 15.72 19387 26097 9.0 95.9 23.1% 0.0% 0.0% 0.0% 41.97sec 19225213 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_blast 8092 4526325 12367 6.30 96871 200870 38.4 38.4 20.0% 0.0% 0.0% 0.0% 9.53sec 4526325 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay ticks -15407 6949899 18989 36.67 25580 53054 104.2 223.7 20.0% 0.0% 0.0% 0.0% 3.41sec 6949899 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay_mastery 124468 2176942 5948 11.47 25596 53110 70.0 70.0 20.1% 0.0% 0.0% 0.0% 5.02sec 2176942 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_spike 73510 2995752 8185 5.00 81140 168242 30.5 30.5 19.7% 0.0% 0.0% 0.0% 11.32sec 2995752 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_death 32379 1599334 4370 1.95 110064 228945 11.9 11.9 20.5% 0.0% 0.0% 0.0% 4.85sec 1599334 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain ticks -589 3558359 9722 29.50 14985 30985 17.8 179.9 29.9% 0.0% 0.0% 0.0% 21.20sec 3558359 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain_mastery 124464 1118232 3055 9.22 15070 31215 56.3 56.2 29.8% 0.0% 0.0% 0.0% 6.38sec 1118232 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowy_apparition 87532 1394638 3810 10.17 18711 37691 63.5 62.0 19.9% 0.0% 0.0% 0.0% 5.68sec 1394638 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_embrace 15286 0 0 0.15 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% 194.20sec 0 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch ticks -34914 3252258 8886 26.18 16789 34789 19.3 159.7 19.9% 0.0% 0.0% 0.0% 18.96sec 3252258 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch_mastery 124465 1025280 2801 8.18 16914 35120 49.9 49.9 20.0% 0.0% 0.0% 0.0% 7.12sec 1025280 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend melee 0 1451493 52188 58.00 49846 101028 26.9 26.9 20.9% 7.2% 24.0% 2.3% 14.65sec 1451493 27.81sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend shadowcrawl 63619 0 0 10.79 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.55sec 0 27.81sec
priest_90_tof_mb priest_90_tof_mb devouring_plague 2944 2196022 6000 2.41 123149 254788 14.7 14.7 19.9% 0.0% 0.0% 0.0% 26.49sec 2196022 366.00sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_mastery 124467 947691 2589 6.23 20524 42597 38.1 38.0 20.0% 0.0% 0.0% 0.0% 9.60sec 947691 366.00sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_tick ticks -2944 3008270 8219 19.90 20408 42316 14.7 121.4 20.0% 0.0% 0.0% 0.0% 26.49sec 3008270 366.00sec
priest_90_tof_mb priest_90_tof_mb halo 120644 0 0 1.48 0 0 9.0 9.0 19.8% 0.0% 0.0% 0.0% 41.80sec 0 366.00sec
priest_90_tof_mb priest_90_tof_mb halo_damage 120696 1313752 3589 1.48 120352 249357 9.0 9.0 19.9% 0.0% 0.0% 0.0% 41.80sec 1313752 366.00sec
priest_90_tof_mb priest_90_tof_mb halo_heal 120696 2432864 6647 15.73 23183 32620 9.0 96.0 23.0% 0.0% 0.0% 0.0% 41.80sec 19211857 366.00sec
priest_90_tof_mb priest_90_tof_mb mind_blast 8092 4279092 11692 5.96 96869 200912 36.4 36.4 20.0% 0.0% 0.0% 0.0% 10.09sec 4279092 366.00sec
priest_90_tof_mb priest_90_tof_mb mind_flay ticks -15407 8378543 22892 44.18 25599 53083 120.3 269.5 20.0% 0.0% 0.0% 0.0% 2.97sec 8378543 366.00sec
priest_90_tof_mb priest_90_tof_mb mind_flay_mastery 124468 2615234 7145 13.80 25604 53113 84.2 84.2 19.9% 0.0% 0.0% 0.0% 4.21sec 2615234 366.00sec
priest_90_tof_mb priest_90_tof_mb mindbender 123040 0 0 0.94 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 60.91sec 0 366.00sec
priest_90_tof_mb priest_90_tof_mb shadow_word_death 32379 1574245 4301 1.92 110227 229580 11.7 11.7 20.3% 0.0% 0.0% 0.0% 4.84sec 1574245 366.00sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain ticks -589 3565130 9741 29.54 15003 31022 17.9 180.2 29.9% 0.0% 0.0% 0.0% 21.17sec 3565130 366.00sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain_mastery 124464 1118625 3056 9.21 15084 31231 56.2 56.2 29.9% 0.0% 0.0% 0.0% 6.40sec 1118625 366.00sec
priest_90_tof_mb priest_90_tof_mb shadowy_apparition 87532 1395725 3813 10.17 18727 37704 63.5 62.0 19.9% 0.0% 0.0% 0.0% 5.68sec 1395725 366.00sec
priest_90_tof_mb priest_90_tof_mb vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 194.89sec 0 366.00sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch ticks -34914 3236563 8843 26.05 16797 34809 19.2 158.9 19.8% 0.0% 0.0% 0.0% 19.07sec 3236563 366.00sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch_mastery 124465 1018403 2783 8.13 16939 35109 49.7 49.6 19.8% 0.0% 0.0% 0.0% 7.16sec 1018403 366.00sec
priest_90_tof_mb priest_90_tof_mb_mindbender melee 0 3369210 37106 53.74 38631 77900 81.3 81.3 20.2% 7.4% 24.0% 2.4% 4.17sec 3369210 90.80sec
priest_90_tof_mb priest_90_tof_mb_mindbender shadowcrawl 63619 0 0 12.36 0 0 18.7 18.7 0.0% 0.0% 0.0% 0.0% 19.82sec 0 90.80sec
priest_90_tof_swi priest_90_tof_swi devouring_plague 2944 2217068 6058 2.44 122893 254764 14.9 14.9 19.7% 0.0% 0.0% 0.0% 26.02sec 2217068 366.00sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_mastery 124467 946899 2587 6.22 20545 42627 38.0 38.0 19.9% 0.0% 0.0% 0.0% 9.62sec 946899 366.00sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_tick ticks -2944 3005720 8212 19.95 20344 42179 14.9 121.7 20.0% 0.0% 0.0% 0.0% 26.02sec 3005720 366.00sec
priest_90_tof_swi priest_90_tof_swi halo 120644 0 0 1.48 0 0 9.0 9.0 19.8% 0.0% 0.0% 0.0% 41.67sec 0 366.00sec
priest_90_tof_swi priest_90_tof_swi halo_damage 120696 1311393 3583 1.48 120166 248592 9.0 9.0 19.9% 0.0% 0.0% 0.0% 41.67sec 1311393 366.00sec
priest_90_tof_swi priest_90_tof_swi halo_heal 120696 2670352 7296 15.73 25331 36213 9.0 96.0 23.0% 0.0% 0.0% 0.0% 41.67sec 19179978 366.00sec
priest_90_tof_swi priest_90_tof_swi mind_blast 8092 4310387 11777 6.00 96860 200812 36.6 36.6 20.0% 0.0% 0.0% 0.0% 10.00sec 4310387 366.00sec
priest_90_tof_swi priest_90_tof_swi mind_flay ticks -15407 7863292 21484 41.46 25602 53119 112.9 252.9 20.0% 0.0% 0.0% 0.0% 3.18sec 7863292 366.00sec
priest_90_tof_swi priest_90_tof_swi mind_flay_mastery 124468 2458657 6718 12.96 25610 53118 79.1 79.0 20.0% 0.0% 0.0% 0.0% 4.47sec 2458657 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_death 32379 1593188 4353 1.94 110360 228877 11.8 11.8 20.7% 0.0% 0.0% 0.0% 4.87sec 1593188 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_insanity 129249 2711302 7408 2.22 165476 343517 13.5 13.5 19.7% 0.0% 0.0% 0.0% 25.22sec 2711302 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain ticks -589 3305482 9031 27.42 14990 31004 19.0 167.2 29.8% 0.0% 0.0% 0.0% 19.52sec 3305482 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain_mastery 124464 1041547 2846 8.57 15084 31240 52.4 52.3 29.9% 0.0% 0.0% 0.0% 6.86sec 1041547 366.00sec
priest_90_tof_swi priest_90_tof_swi shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.14sec 0 366.00sec
priest_90_tof_swi priest_90_tof_swi shadowy_apparition 87532 1323014 3615 9.64 18737 37722 60.1 58.8 19.9% 0.0% 0.0% 0.0% 6.01sec 1323014 366.00sec
priest_90_tof_swi priest_90_tof_swi vampiric_embrace 15286 0 0 0.15 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch ticks -34914 3244607 8865 26.12 16779 34771 19.4 159.4 19.9% 0.0% 0.0% 0.0% 19.01sec 3244607 366.00sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch_mastery 124465 1022662 2794 8.16 16925 35171 49.8 49.8 19.9% 0.0% 0.0% 0.0% 7.14sec 1022662 366.00sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend melee 0 1435785 51979 57.85 49809 100946 26.6 26.6 20.8% 7.3% 23.8% 2.3% 14.80sec 1435785 27.62sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend shadowcrawl 63619 0 0 10.86 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.60sec 0 27.62sec

Fluffy_Pillow : 154077 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
154077.2 154077.2 2.06 / 0.00% 368 / 0.2% -1.0 0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:100&chds=0,100&chdls=ffffff&chco=9482C9&chl=raid_damage_shadow&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:JIPONMMLNMLLLLOOOJJJLLLGGGIIIGGGIIIGGGIIIGGGIIIGGGIIIGGJJJJHKKKKKLLLLLNLLLLNKKKKMJJJJLIIIILIIIILIIIILIIIILIIIILIIILLJJMMMKNNNNOOOOQOOOQNNNPMMMOLLLOLLLNLLLNLLLNLLLNLLLNLLLNLLPPNSSSUUUZXXaaYbbbbbbZZZWWWTTTQQQPPPPPPPPPPPPPPPPPPPPPPPPPPRPSSTTWUXXYYbYccccfcfcfcebdacZbYaXZWZWYWYWYWYWYWYWYWYWYWYWYYaacdghklopstwx014577877776543210zzyxwvuuuuuuuuuuuuuuuuuuuuuuuwy00111223445&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3679,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=154077|max=418785&chxp=1,1,37,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,16,0,0,312,0,0,0,1400,0,0,4056,0,0,7128,0,0,0,10112,0,0,10552,0,0,7504,0,0,4752,0,0,0,2528,0,0,1184,0,0,288,0,0,0,136,0,0,8,0,0,8&chds=0,10552&chbh=5&chxt=x&chxl=0:|min=153249|avg=154077|max=155087&chxp=0,1,45,100&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 154077
raid_damage_shadow 154077 100.0% 1533.8 2.38sec 36767 0 36767 0 36767 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raid_damage_shadow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1533.76 1533.76 0.00 0.00 0.0000 0.0000 56392259.49 56392259.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1533.76 100.00% 36767.40 35156 44855 36767.39 36732 36811 56392259 56392259 0.00
DPS Timeline Chart

Action details: raid_damage_shadow

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:44000.00
  • base_dd_max:44000.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 6.54% 6.54%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:6.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.94% 8.94%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 12.24% 12.24%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:12.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.82% 10.82%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.68% 10.68%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.76% 11.76%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.92% 10.92%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.92%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.97% 11.97%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.99% 9.99%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.99%

Trigger Attempt Success

  • trigger_pct:100.00%
flying 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_flying
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • flying_1:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 930739.47
Combat End Resource Mean Min Max
Health 6027326.75 0.00 17201367.27
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data Fluffy_Pillow Damage Per Second
Count 49992
Mean 154077.21
Minimum 153249.10
Maximum 155087.42
Spread ( max - min ) 1838.32
Range [ ( max - min ) / 2 * 100% ] 0.60%
Standard Deviation 235.4754
5th Percentile 153739.32
95th Percentile 154474.65
( 95th Percentile - 5th Percentile ) 735.33
Mean Distribution
Standard Deviation 1.0532
95.00% Confidence Intervall ( 154075.15 - 154079.28 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 8
0.1 Scale Factor Error with Delta=300 473
0.05 Scale Factor Error with Delta=300 1893
0.01 Scale Factor Error with Delta=300 47334
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 154077.21
Distribution Chart

Damage

Sample Data
Count 49992
Mean 56392259.49
Distribution Chart

DTPS

Sample Data Fluffy_Pillow Damage Taken Per Second
Count 49992
Mean 930945.57
Distribution Chart

HPS

Sample Data Fluffy_Pillow Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data Fluffy_Pillow Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 346732486 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 366.00
Vary Combat Length: 0.00

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.