close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 flying,first=0,duration=500,cooldown=500
1 position_switch,first=0,duration=500,cooldown=500
2 stun,duration=1.0,first=45.0,period=45.0
3 stun,duration=1.0,first=57.0,period=57.0
4 damage,first=6.0,period=6.0,last=59.5,amount=44000,type=shadow
5 damage,first=60.0,period=5.0,last=119.5,amount=44855,type=shadow
6 damage,first=120.0,period=4.0,last=179.5,amount=44855,type=shadow
7 damage,first=180.0,period=3.0,last=239.5,amount=44855,type=shadow
8 damage,first=240.0,period=2.0,last=299.5,amount=44855,type=shadow
9 damage,first=300.0,period=1.0,amount=44855,type=shadow
HPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 4.79 - 4.09 - - - 3.26 - 1.75 2.01 1.82 - - - - - - wowhead lootrank
priest_90_di_mb - - - 4.66 - 3.88 - - - 3.08 - 1.69 2.00 1.91 - - - - - - wowhead lootrank
priest_90_di_swi - - - 4.67 - 3.96 - - - 3.34 - 1.74 1.70 1.75 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 4.78 - 3.95 - - - 3.20 - 1.66 1.62 1.80 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 4.72 - 3.91 - - - 3.00 - 1.79 1.40 1.95 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 4.66 - 3.94 - - - 3.24 - 1.66 1.33 1.71 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 4.16 - 3.97 - - - 3.16 - 1.10 1.24 1.48 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 4.11 - 3.84 - - - 2.61 - 1.13 1.41 1.56 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 4.01 - 3.93 - - - 2.95 - 0.86 1.50 1.30 - - - - - - wowhead lootrank

priest_90_di_fdcl : 131554 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131553.9 131553.9 23.05 / 0.02% 4327 / 3.3% 27.8 6128.6 6128.6 30.93 / 0.50% 5556 / 90.7% 1.3 4591.5 4575.2 Mana 0.77% 46.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.79 0.00 4.09 3.26 1.75 2.01 1.82
Normalized 1.00 0.00 0.85 0.68 0.37 0.42 0.38
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste > Mastery > Crit
Pawn string
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=4.79, SpellDamage=4.09, HitRating=3.26, CritRating=1.75, HasteRating=2.01, MasteryRating=1.82 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=4.79, SpellDamage=4.09, HitRating=0.00, CritRating=1.75, HasteRating=2.01, MasteryRating=1.82 )

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:342888|244364|219341|185461|99870|97654|81970|49810&chds=0,685777&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++342888++devouring_plague,9482C9,0,0,15|t++244364++halo,9482C9,1,0,15|t++219341++shadow_word_pain,9482C9,2,0,15|t++185461++vampiric_touch,9482C9,3,0,15|t++99870++shadow_word_death,9482C9,4,0,15|t++97654++mind_blast,9482C9,5,0,15|t++81970++mind_spike,4A79D3,6,0,15|t++49810++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,13,12,11,8,8,6,6,5,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|mind_flay|devouring_plague|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.79,4.09,3.26,2.01,1.82,1.75|4.76,4.06,3.23,1.98,1.78,1.72|4.82,4.13,3.30,2.04,1.85,1.78&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.79++Int,FFFFFF,0,0,15,0.1,e|t++++4.09++SP,FFFFFF,0,1,15,0.1,e|t++++3.26++Hit,FFFFFF,0,2,15,0.1,e|t++++2.01++Haste,FFFFFF,0,3,15,0.1,e|t++++1.82++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.75++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.758&chtt=Scale Factors|priest_90_di_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:586655554554533330yxwusssrrqqponmlmlllmnnmmnmmmllkkkkjjjkkkjihihhhhghhggggggffggfggggggffgggggggghhgghhgfffggghhhhhhiiiiijjjjjjjjjjiiiiiiiiihhggffgggggggghhghhhhgggghhghhgfghhhiijjjklllkkjkjjklkkjjiiihhggggghhiiijjjiiiihhhhhhhhhhggggfffggghhhhhhhhhhiijjjjjjjjjiiiiiihhhhggffedddcccddddddeeeeffghhijjkklllmllmmnnmmmllkkkkjjjjjklllmmnmnnopqqrrsttuuvvvvuutvvvvvuvuuutts&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6114,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=131554|max=215166&chxp=1,1,61,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,32,24,32,48,56,136,208,352,304,512,608,736,1136,1032,1608,1704,1872,2152,2192,2464,2416,3016,2904,2864,2664,2592,2608,2048,1880,1656,1488,1384,1072,1080,632,576,400,408,312,176,192,104,64,88,80,16,24,16,16&chds=0,3016&chbh=5&chxt=x&chxl=0:|min=122828|avg=131554|max=141070&chxp=0,1,48,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:26.2,16.9,15.9,12.1,11.3,6.2,4.0,2.9,0.7,0.8&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 95.8s|mind_spike 61.9s|mind_blast 58.2s|vampiric_touch 44.2s|shadow_word_pain 41.5s|devouring_plague 22.6s|shadow_word_death 14.8s|halo 10.7s|shadowfiend 2.5s|waiting 2.8s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl 131554
devouring_plague 7516 (21171) 5.7% (16.1%) 19.1 19.94sec 405852 342888 118769 246408 144077 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.09 19.09 0.00 0.00 1.1836 0.0000 2750784.26 2750784.26 0.00 342888.35 342888.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.31 80.17% 118769.32 107519 143944 118763.75 111291 126214 1817909 1817909 0.00
crit 3.79 19.83% 246407.94 221488 296525 242878.97 0 296525 932876 932876 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3264 2.5% 49.6 7.33sec 24076 0 19812 41090 24106 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.61 49.55 0.00 0.00 0.0000 0.0000 1194473.20 1194473.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.55 79.82% 19812.37 17856 23904 19811.40 18747 21161 783645 783645 0.00
crit 10.00 20.18% 41090.31 36784 49242 41086.23 36784 46797 410828 410828 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10392 7.9% 19.1 19.94sec 199209 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.3 19777 40986 24019 20.0% 0.0% 32.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.09 19.09 158.35 158.35 0.0000 0.7465 3803333.55 3803333.55 0.00 32176.56 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 80.00% 19776.93 17856 40318 19776.64 18929 20979 2505200 2505200 0.00
crit 31.7 20.00% 40985.75 36784 83055 40982.79 38181 43923 1298134 1298134 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7123) 0.0% (5.4%) 9.0 42.96sec 290324 244364 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.1881 0.0000 0.00 0.00 0.00 244363.72 244363.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.20 80.18% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.78 19.82% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7123 5.4% 9.0 42.96sec 290324 0 119214 247588 145166 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 17.96 0.00 0.00 0.0000 0.0000 2606872.15 2606872.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.33 79.79% 119214.17 109581 139821 119203.93 110347 127819 1708189 1708189 0.00
crit 3.63 20.21% 247587.91 225736 288030 243643.94 0 288030 898683 898683 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 6129 100.0% 9.0 42.96sec 249807 0 22528 27003 23563 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.98 95.20 0.00 0.00 0.0000 0.0000 2243070.14 18946995.31 88.16 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.17 76.86% 22528.11 -0 184948 22390.10 0 100278 1648309 11663303 85.94
crit 22.03 23.14% 27002.81 0 380994 26971.32 0 173774 594761 7283692 91.84
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 15524 11.8% 49.3 7.43sec 115238 97654 95052 196949 115239 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.30 49.30 0.00 0.00 1.1801 0.0000 5681776.01 5681776.01 0.00 97653.54 97653.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.54 80.19% 95051.85 86183 115909 95052.12 91318 98663 3758045 3758045 0.00
crit 9.77 19.81% 196949.39 177536 238773 196963.00 177536 223517 1923731 1923731 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 9930 (13031) 7.5% (9.9%) 58.2 5.96sec 81997 49810 0 0 0 0.0% 0.0% 0.0% 0.0% 118.1 25334 52549 30779 20.0% 0.0% 23.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.17 58.17 118.08 118.08 1.6462 0.7278 3634490.50 3634490.50 0.00 49810.19 49810.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.5 79.99% 25333.57 22887 30640 25334.58 24228 26409 2392844 2392844 0.00
crit 23.6 20.01% 52548.71 47146 63119 52551.52 48825 56997 1241647 1241647 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3101 2.4% 36.9 9.11sec 30778 0 25327 52559 30779 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.87 36.87 0.00 0.00 0.0000 0.0000 1134934.50 1134934.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.49 79.98% 25326.98 22887 30640 25328.43 23807 27314 746889 746889 0.00
crit 7.38 20.02% 52559.01 47146 63119 52511.86 0 63119 388046 388046 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13874 10.5% 52.6 6.63sec 96557 81970 79611 164933 96558 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.59 52.59 0.00 0.00 1.1780 0.0000 5077737.31 5077737.31 0.00 81970.38 81970.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.14 80.14% 79610.53 72412 97688 79610.67 75449 83767 3355054 3355054 0.00
crit 10.44 19.86% 164933.00 149169 201238 164936.16 149169 185805 1722684 1722684 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4029 3.1% 12.5 4.89sec 117712 99870 96452 200446 117711 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.53 12.53 0.00 0.00 1.1787 0.0000 1474473.64 1474473.64 0.00 99869.52 99869.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.97 79.56% 96451.75 83662 112752 96455.94 87100 106072 961182 961182 0.00
crit 2.56 20.44% 200445.81 172343 232270 189191.43 0 232270 513291 513291 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18954 (24871) 14.4% (18.9%) 35.2 10.47sec 258708 219341 0 0 0 0.0% 0.0% 0.0% 0.0% 356.4 14753 30516 19467 29.9% 0.0% 196.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.18 35.18 356.36 356.36 1.1795 2.0137 6937232.74 6937232.74 0.00 11991.25 219341.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 249.8 70.09% 14752.57 13422 17966 14752.54 14273 15153 3684912 3684912 0.00
crit 106.6 29.91% 30515.65 27649 37009 30515.28 29385 31639 3252321 3252321 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5916 4.5% 111.4 3.25sec 19437 0 14750 30518 19470 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.41 111.22 0.00 0.00 0.0000 0.0000 2165421.74 2165421.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.92 70.06% 14749.99 13422 17966 14750.00 14141 15242 1149362 1149362 0.00
crit 33.29 29.94% 30517.70 27649 37009 30517.11 28896 32395 1016059 1016059 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2261 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5598 4.3% 94.8 3.83sec 21605 0 18399 37043 22110 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.83 92.66 0.00 0.00 0.0000 0.0000 2048741.35 2048741.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.22 80.10% 18399.12 16669 22484 18398.90 17700 19040 1365585 1365585 0.00
crit 18.44 19.90% 37042.71 33338 44968 37043.96 33525 40709 683156 683156 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17069 (22412) 13.0% (17.0%) 37.5 9.55sec 218541 185461 0 0 0 0.0% 0.0% 0.0% 0.0% 310.8 16561 34326 20099 19.9% 0.0% 189.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.53 37.53 310.83 310.83 1.1784 2.2256 6247370.62 6247370.62 0.00 11144.83 185460.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 248.9 80.09% 16561.09 15001 20366 16561.50 16062 17049 4122663 4122663 0.00
crit 61.9 19.91% 34326.10 30902 41955 34325.62 32508 36088 2124708 2124708 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5343 4.1% 97.2 3.67sec 20112 0 16585 34386 20136 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.24 97.12 0.00 0.00 0.0000 0.0000 1955558.63 1955558.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.75 80.06% 16585.48 15001 20366 16585.16 15876 17191 1289516 1289516 0.00
crit 19.37 19.94% 34385.70 30902 41955 34387.39 31688 38402 666043 666043 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51539 / 3922
melee 51539 3.0% 26.9 14.64sec 53350 54247 49367 99960 53349 20.6% 7.1% 24.0% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.91 26.91 0.00 0.00 0.9835 0.0000 1435542.93 1435542.93 0.00 54247.17 54247.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.37 45.97% 49367.09 38145 58728 49355.73 42596 57634 610669 610669 0.00
crit 5.54 20.61% 99960.11 76291 117456 99744.21 0 117456 554236 554236 0.00
glance 6.46 24.02% 37137.55 28609 44046 37110.02 0 44046 240067 240067 0.00
block 0.62 2.29% 49669.60 38145 58728 23022.45 0 58728 30571 30571 0.00
parry 1.91 7.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1883 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.54%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 21.8 1.6 16.0sec 14.8sec 8.76% 43.33%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.76%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.8sec 107.8sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.82%
glyph_mind_spike 31.6 20.9 11.1sec 6.6sec 45.70% 74.98%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:29.36%
  • glyph_mind_spike_2:16.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 336.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.3 36.2sec 20.3sec 43.80% 44.05%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.80%

    Trigger Attempt Success

    • trigger_pct:1.61%
light_of_the_cosmos 8.0 0.0 47.9sec 47.9sec 43.46% 43.46%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.46%

    Trigger Attempt Success

    • trigger_pct:14.62%
shadow_word_death_reset_cooldown 6.4 0.0 10.2sec 10.2sec 9.92% 49.13%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.92%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 34.2 27.0 10.3sec 5.8sec 47.47% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:34.72%
  • surge_of_darkness_2:12.75%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
vampiric_embrace 0.8 0.0 0.0sec 0.0sec 3.28% 3.39%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.28%

Trigger Attempt Success

  • trigger_pct:80.20%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.56% 80.52%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl
devouring_plague Shadow Orb 19.1 57.3 3.0 3.0 135281.7
halo Mana 9.0 363657.6 40500.0 40500.0 7.2
mind_blast Mana 49.3 242390.9 4916.1 4916.2 23.4
mind_flay Mana 58.2 174493.4 3000.0 2999.9 27.3
shadow_word_death Mana 12.5 97705.9 7800.0 7800.1 15.1
shadow_word_pain Mana 35.2 464443.6 13200.0 13200.0 19.6
vampiric_touch Mana 37.5 337815.4 9000.0 9000.0 24.3
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.99 106286.59 (6.35%) 4252.44 118661.57 52.75%
Shadow Orbs from Mind Blast Shadow Orb 49.31 49.31 (88.55%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.38 6.38 (11.45%) 1.00 0.00 0.00%
Devouring Plague Health Health 207.90 2041183.66 (82.54%) 9818.00 845871.44 29.30%
Vampiric Touch Mana Mana 407.95 1286870.83 (76.85%) 3154.45 869497.49 40.32%
mp5_regen Mana 1463.00 281357.71 (16.80%) 192.32 157542.29 35.89%
vampiric_embrace Health 55.13 431844.86 (17.46%) 7833.43 355620.28 45.16%
pet - shadowfiend
vampiric_embrace Health 0.09 616.27 (100.00%) 7003.05 655.72 51.55%
Resource RPS-Gain RPS-Loss
Health 14206.62 14867.22
Mana 4575.18 4591.55
Shadow Orb 0.15 0.16
Combat End Resource Mean Min Max
Health 221113.50 -128916.41 462887.00
Mana 294010.85 257700.00 300000.00
Shadow Orb 1.40 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 36.1%
shadowfiend-Mana Cap 36.1%
lightwell-Mana Cap 36.1%

Procs

Count Interval
Shadowy Recall Extra Tick 294.8 1.2sec
Shadowy Apparition Procced 94.8 3.8sec
Divine Insight Mind Blast CD Reset 41.3 14.8sec
FDCL Mind Spike proc 61.2 5.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl Damage Per Second
Count 49992
Mean 131553.94
Minimum 122828.37
Maximum 141070.16
Spread ( max - min ) 18241.80
Range [ ( max - min ) / 2 * 100% ] 6.93%
Standard Deviation 2629.1378
5th Percentile 127280.63
95th Percentile 135934.25
( 95th Percentile - 5th Percentile ) 8653.63
Mean Distribution
Standard Deviation 11.7588
95.00% Confidence Intervall ( 131530.90 - 131576.99 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1534
0.1 Scale Factor Error with Delta=300 59007
0.05 Scale Factor Error with Delta=300 236031
0.01 Scale Factor Error with Delta=300 5900792
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131553.94
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46713200.22
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_di_fdcl Healing Per Second
Count 49992
Mean 6128.61
Minimum 0.00
Maximum 31925.11
Spread ( max - min ) 31925.11
Range [ ( max - min ) / 2 * 100% ] 260.46%
Standard Deviation 3528.8628
5th Percentile 1648.76
95th Percentile 12761.18
( 95th Percentile - 5th Percentile ) 11112.43
Mean Distribution
Standard Deviation 15.7828
95.00% Confidence Intervall ( 6097.67 - 6159.54 )
Normalized 95.00% Confidence Intervall ( 99.50% - 100.50% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12736
0.1% Error 1273626
0.1 Scale Factor Error with Delta=300 106304
0.05 Scale Factor Error with Delta=300 425219
0.01 Scale Factor Error with Delta=300 10630488
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 6128.61
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2243070.14
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl Healing taken Per Second
Count 49992
Mean 7449.70
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 281.77
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.71 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.53 shadow_word_death,if=active_enemies<=5
F 49.76 mind_blast,if=active_enemies<=6&cooldown_react
G 35.19 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 39.05 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 16.18 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.80 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 8.98 halo,if=talent.halo.enabled
M 12.38 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.92 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 21.02 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 36.41 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 38.85 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTRQFRTFMRRQQQQFTGGHHTFTJRTRTFDFTHFGGHLRFDFJRTHQFGTGHRQFMTQFHJRTFGGHLJFJMRFHTFGFGHMRTJFHRTRTFRGHGLRQFHHJMJFRTRHTFGGRHRTFMTHQFRTGGHLFTBJHRQFMRTGHGFFRTHJFMRTQQQHFGFGJLRRTFHDFHRHTGFGQQFMRRFRHRHTQFRTGGFLMRTHHFTRRTFGGJRHFDFHRFTRTGFGLHDEEHFRRTEDEFGGFHHJEDEFRT9TRQQPEEFDFGGHEEHFLDFREERBFGD

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb : 129201 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
129200.7 129200.7 21.91 / 0.02% 4106 / 3.2% 25.1 6365.4 6365.4 33.27 / 0.52% 5912 / 92.9% 1.3 4774.1 4749.6 Mana 0.66% 39.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.66 0.00 3.88 3.08 1.69 2.00 1.91
Normalized 1.00 0.00 0.83 0.66 0.36 0.43 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste > Mastery > Crit
Pawn string
  • ( Pawn: v1: "priest_90_di_mb": Intellect=4.66, SpellDamage=3.88, HitRating=3.08, CritRating=1.69, HasteRating=2.00, MasteryRating=1.91 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_mb": Intellect=4.66, SpellDamage=3.88, HitRating=0.00, CritRating=1.69, HasteRating=2.00, MasteryRating=1.91 )

Charts

http://6.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:344894|243601|219944|185121|99888|97735|50446&chds=0,689787&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++344894++devouring_plague,9482C9,0,0,15|t++243601++halo,9482C9,1,0,15|t++219944++shadow_word_pain,9482C9,2,0,15|t++185121++vampiric_touch,9482C9,3,0,15|t++99888++shadow_word_death,9482C9,4,0,15|t++97735++mind_blast,9482C9,5,0,15|t++50446++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,14,12,8,8,6,6,5,5,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|devouring_plague_tick|mindbender: melee|devouring_plague|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.66,3.88,3.08,2.00,1.91,1.69|4.63,3.85,3.05,1.97,1.88,1.66|4.70,3.91,3.11,2.03,1.94,1.72&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.66++Int,FFFFFF,0,0,15,0.1,e|t++++3.88++SP,FFFFFF,0,1,15,0.1,e|t++++3.08++Hit,FFFFFF,0,2,15,0.1,e|t++++2.00++Haste,FFFFFF,0,3,15,0.1,e|t++++1.91++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.69++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.608&chtt=Scale Factors|priest_90_di_mb%20Damage%20Per%20Second&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:35568777667676655210zxvutrrqqponmllkklmnmmmmmmllkjiiiijjkllkkkllmmmlmmmmmllkkjjjiihhggffffffffffgggffgfffeefffffgghhijjklmnooooononnnnmmllkkjihgfeefffffffgggggggfffgghghggffffffggghhijjjiijiijkkkkkkjjjiiihhhhhiiiiiiihhhggggggggffeeeeddefgghijjkllmnnopppqqqppoomllkjjihggfedddcbbbbbbccccccdddefffgijklmnoopopqqrrrqqpppoonmmllkklmmlmmmmnopqqrrsttuuvvvvuttuuttsssrrqqpo&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6216,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=129201|max=207837&chxp=1,1,62,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,40,72,88,80,128,192,272,416,712,528,808,968,1272,1512,1600,1856,2408,2216,2392,2600,2576,2424,2448,2720,2504,2480,2112,1800,1656,1600,1408,1120,1120,1032,624,536,424,312,240,224,72,136,104,48,56,16,0,8,16&chds=0,2720&chbh=5&chxt=x&chxl=0:|min=121511|avg=129201|max=138190&chxp=0,1,46,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:42.4,14.9,12.1,11.3,5.8,3.9,2.9,1.9,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 155.2s|mind_blast 54.7s|vampiric_touch 44.1s|shadow_word_pain 41.4s|devouring_plague 21.4s|shadow_word_death 14.4s|halo 10.7s|mindbender 7.0s|waiting 2.4s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb 129201
devouring_plague 7125 (20130) 5.5% (15.6%) 18.0 21.16sec 408180 344894 118992 246608 144483 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.05 18.05 0.00 0.00 1.1835 0.0000 2607932.11 2607932.11 0.00 344893.62 344893.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.44 80.02% 118991.76 107519 143944 118991.57 111630 128321 1718743 1718743 0.00
crit 3.61 19.98% 246607.82 221488 296525 242075.24 0 296525 889190 889190 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3103 2.4% 47.2 7.72sec 24077 0 19841 41145 24104 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.17 47.12 0.00 0.00 0.0000 0.0000 1135772.05 1135772.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.69 79.99% 19840.60 17856 23904 19841.08 18528 21103 747762 747762 0.00
crit 9.43 20.01% 41145.17 36784 49242 41147.58 0 47032 388010 388010 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9901 7.7% 18.0 21.16sec 200772 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150.6 19807 41068 24067 20.0% 0.0% 30.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.05 18.05 150.57 150.57 0.0000 0.7458 3623913.45 3623913.45 0.00 32269.65 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.4 79.96% 19806.94 17856 38509 19807.50 18910 20948 2384761 2384761 0.00
crit 30.2 20.04% 41068.02 36784 79328 41064.86 38511 44995 1239152 1239152 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7117) 0.0% (5.5%) 9.0 42.78sec 289456 243601 0 0 0 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1882 0.0000 0.00 0.00 0.00 243601.07 243601.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.19 79.89% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.81 20.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7117 5.5% 9.0 42.78sec 289456 0 119226 247588 144726 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 18.00 0.00 0.00 0.0000 0.0000 2604826.27 2604826.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.42 80.13% 119226.36 109581 139821 119225.11 111314 126757 1719540 1719540 0.00
crit 3.58 19.87% 247588.11 225736 288030 243035.94 0 288030 885286 885286 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 6365 100.0% 9.0 42.78sec 258885 0 23237 28936 24563 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 94.85 0.00 0.00 0.0000 0.0000 2329720.90 18905792.92 87.68 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.77 76.73% 23236.92 -0 184948 23188.30 0 105753 1691059 11604710 85.46
crit 22.07 23.27% 28936.23 0 380994 28897.07 0 189121 638662 7301083 91.27
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14607 11.3% 46.4 7.90sec 115332 97735 95042 197011 115332 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.36 46.36 0.00 0.00 1.1801 0.0000 5346225.84 5346225.84 0.00 97735.43 97735.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.13 80.10% 95041.64 86183 115909 95042.20 91199 99090 3528992 3528992 0.00
crit 9.22 19.90% 197010.88 177536 238773 196991.57 0 231532 1817234 1817234 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16299 (21398) 12.6% (16.6%) 91.7 3.87sec 85393 50446 0 0 0 0.0% 0.0% 0.0% 0.0% 194.2 25272 52410 30714 20.1% 0.0% 38.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.71 91.71 194.23 194.23 1.6927 0.7333 5965432.01 5965432.01 0.00 50446.10 50446.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 155.3 79.95% 25272.03 22887 30640 25272.31 24585 25935 3924243 3924243 0.00
crit 38.9 20.05% 52409.92 47146 63119 52409.06 49627 55712 2041189 2041189 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5099 3.9% 60.8 5.74sec 30669 0 25271 52380 30672 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.85 60.84 0.00 0.00 0.0000 0.0000 1866123.50 1866123.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.72 80.07% 25270.73 22887 30640 25270.15 24102 26585 1231128 1231128 0.00
crit 12.12 19.93% 52379.66 47146 63119 52384.56 47618 57980 634995 634995 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 5.8 60.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.81 5.81 0.00 0.00 1.1959 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3935 3.0% 12.2 4.86sec 117615 99888 96546 200361 117616 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.24 12.24 0.00 0.00 1.1775 0.0000 1440182.83 1440182.83 0.00 99887.84 99887.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.76 79.71% 96545.92 83662 112752 96541.24 87081 105142 942267 942267 0.00
crit 2.49 20.29% 200361.19 172343 232270 188002.89 0 232270 497916 497916 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18944 (24860) 14.7% (19.2%) 35.1 10.48sec 259386 219944 0 0 0 0.0% 0.0% 0.0% 0.0% 356.0 14757 30527 19474 29.9% 0.0% 196.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.08 35.08 356.03 356.03 1.1794 2.0149 6933414.23 6933414.23 0.00 11992.08 219943.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 249.5 70.09% 14756.77 13422 17966 14756.80 14327 15241 3682226 3682226 0.00
crit 106.5 29.91% 30527.37 27649 37009 30526.50 29364 31611 3251188 3251188 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5917 4.6% 111.4 3.25sec 19443 0 14752 30537 19468 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.38 111.23 0.00 0.00 0.0000 0.0000 2165444.48 2165444.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.00 70.12% 14751.76 13422 17966 14751.66 14265 15304 1150599 1150599 0.00
crit 33.23 29.88% 30537.50 27649 37009 30536.90 28878 32544 1014845 1014845 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5601 4.3% 94.8 3.83sec 21621 0 18409 37045 22125 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.82 92.66 0.00 0.00 0.0000 0.0000 2050072.53 2050072.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.18 80.06% 18408.91 16669 22484 18408.89 17734 18972 1365633 1365633 0.00
crit 18.48 19.94% 37045.46 33338 44968 37046.68 34207 40846 684440 684440 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17004 (22327) 13.2% (17.3%) 37.5 9.60sec 218204 185121 0 0 0 0.0% 0.0% 0.0% 0.0% 309.5 16560 34330 20108 20.0% 0.0% 188.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.45 37.45 309.50 309.50 1.1787 2.2260 6223286.58 6223286.58 0.00 11147.06 185121.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 247.7 80.03% 16559.92 15001 20366 16560.27 16106 17010 4101937 4101937 0.00
crit 61.8 19.97% 34330.03 30902 41955 34328.69 32658 36135 2121350 2121350 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5324 4.1% 96.9 3.68sec 20108 0 16584 34383 20133 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.90 96.78 0.00 0.00 0.0000 0.0000 1948519.44 1948519.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.49 80.06% 16584.45 15001 20366 16584.37 16021 17218 1285065 1285065 0.00
crit 19.30 19.94% 34383.14 30902 41955 34379.58 31445 37961 663454 663454 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37084 / 9225
melee 37084 7.1% 81.4 4.26sec 41456 39541 38659 77973 41455 20.2% 7.4% 24.0% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.44 81.44 0.00 0.00 1.0484 0.0000 3376325.33 3376325.33 0.00 39540.52 39540.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.42 45.95% 38658.96 30516 46982 38657.42 36706 40985 1446693 1446693 0.00
crit 16.49 20.24% 77973.46 61032 93964 77988.67 70365 86457 1285650 1285650 0.00
glance 19.54 24.00% 29065.37 22887 35237 29064.17 26407 31825 568024 568024 0.00
block 1.96 2.41% 38706.86 30516 46982 33292.00 0 46982 75958 75958 0.00
parry 6.03 7.40% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.8 19.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.81 18.81 0.00 0.00 1.1895 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.70%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 21.4 2.0 16.4sec 14.9sec 10.31% 44.32%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.31%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.8sec 107.8sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.77%
jade_serpent_potion 1.0 0.0 336.1sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.4 36.4sec 20.3sec 43.80% 44.14%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.80%

    Trigger Attempt Success

    • trigger_pct:1.60%
light_of_the_cosmos 8.0 0.0 47.7sec 47.7sec 43.55% 43.55%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.55%

    Trigger Attempt Success

    • trigger_pct:14.45%
shadow_word_death_reset_cooldown 6.2 0.0 10.2sec 10.2sec 9.88% 49.41%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.88%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 0.9 0.0 203.1sec 203.1sec 3.51% 3.64%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.51%

Trigger Attempt Success

  • trigger_pct:85.89%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.8 0.0 20.0sec 20.0sec 85.36% 84.07%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.17% 2.17%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.17%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb
devouring_plague Shadow Orb 18.1 54.2 3.0 3.0 136058.8
halo Mana 9.0 364461.1 40500.0 40500.0 7.1
mind_blast Mana 46.4 212136.5 4576.3 4576.3 25.2
mind_flay Mana 91.7 275136.0 3000.0 3000.0 28.5
shadow_word_death Mana 12.2 95511.9 7800.0 7800.2 15.1
shadow_word_pain Mana 35.1 463034.9 13200.0 13200.0 19.7
vampiric_touch Mana 37.5 337052.2 9000.0 9000.0 24.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 75.42 170855.37 (9.83%) 2265.53 159534.33 48.29%
Shadow Orbs from Mind Blast Shadow Orb 46.36 46.36 (88.21%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.20 6.20 (11.79%) 1.00 0.00 0.00%
Devouring Plague Health Health 197.69 1937650.81 (81.22%) 9801.28 807643.11 29.42%
Vampiric Touch Mana Mana 406.27 1286216.36 (73.99%) 3165.88 861090.52 40.10%
mp5_regen Mana 1463.00 281270.98 (16.18%) 192.26 157629.02 35.91%
vampiric_embrace Health 61.58 447936.77 (18.78%) 7274.10 335413.92 42.82%
pet - mindbender
vampiric_embrace Health 13.07 89459.15 (100.00%) 6847.09 76914.62 46.23%
Resource RPS-Gain RPS-Loss
Health 14204.82 14867.22
Mana 4749.57 4774.13
Shadow Orb 0.14 0.15
Combat End Resource Mean Min Max
Health 220442.41 -101143.19 462887.00
Mana 291008.69 234600.00 300000.00
Shadow Orb 1.40 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 36.1%
shadowfiend-Mana Cap 36.1%
lightwell-Mana Cap 36.1%

Procs

Count Interval
Shadowy Recall Extra Tick 316.0 1.2sec
Shadowy Apparition Procced 94.8 3.8sec
Divine Insight Mind Blast CD Reset 41.2 14.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_di_mb Damage Per Second
Count 49992
Mean 129200.74
Minimum 121511.19
Maximum 138189.83
Spread ( max - min ) 16678.64
Range [ ( max - min ) / 2 * 100% ] 6.45%
Standard Deviation 2499.1748
5th Percentile 125151.82
95th Percentile 133364.32
( 95th Percentile - 5th Percentile ) 8212.50
Mean Distribution
Standard Deviation 11.1775
95.00% Confidence Intervall ( 129178.83 - 129222.65 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1437
0.1 Scale Factor Error with Delta=300 53318
0.05 Scale Factor Error with Delta=300 213273
0.01 Scale Factor Error with Delta=300 5331837
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 129200.74
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43911145.33
Distribution Chart

DTPS

Sample Data priest_90_di_mb Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_di_mb Healing Per Second
Count 49992
Mean 6365.36
Minimum 0.00
Maximum 30476.72
Spread ( max - min ) 30476.72
Range [ ( max - min ) / 2 * 100% ] 239.40%
Standard Deviation 3795.2131
5th Percentile 1619.33
95th Percentile 13443.26
( 95th Percentile - 5th Percentile ) 11823.94
Mean Distribution
Standard Deviation 16.9741
95.00% Confidence Intervall ( 6332.09 - 6398.63 )
Normalized 95.00% Confidence Intervall ( 99.48% - 100.52% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13655
0.1% Error 1365598
0.1 Scale Factor Error with Delta=300 122957
0.05 Scale Factor Error with Delta=300 491831
0.01 Scale Factor Error with Delta=300 12295777
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 6365.36
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2329720.90
Distribution Chart

HTPS

Sample Data priest_90_di_mb Healing taken Per Second
Count 49992
Mean 7686.66
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 238.86
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 5.81 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 5.64 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.25 shadow_word_death,if=active_enemies<=5
F 47.57 mind_blast,if=active_enemies<=6&cooldown_react
G 35.08 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 38.91 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.86 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 12.41 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.11 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.45 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 50.77 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFTFDFGFGHHTFMTQFHGHGLTFTTAFHGGHMTQFTFTHTFGHGLMQFTHQFTHTGQQGFDFTTHFAHFMTGLFGTTFHTHFMTGTFGTHTHFTGLFGHMTHTAFTGFGFHMHFTFTGHLGHQFMTTFTHGTFGHTATFTFKMHQQQQQQFGHGLTQFTQQFDFHTGHTFGTFMTHTHFTGLGTAFEDEHTHFTEEGTGFDPEEHTFH9EDEFGLTGFPEDEFHHTPEEFMGTAE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi : 132094 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
132094.4 132094.4 24.03 / 0.02% 4518 / 3.4% 24.2 12454.0 12454.0 61.32 / 0.49% 11314 / 90.8% 2.4 5289.4 5274.7 Mana 0.57% 41.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.67 0.00 3.96 3.34 1.74 1.70 1.75
Normalized 1.00 0.00 0.85 0.72 0.37 0.36 0.38
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.04 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery = Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_di_swi": Intellect=4.67, SpellDamage=3.96, HitRating=3.34, CritRating=1.74, HasteRating=1.70, MasteryRating=1.75 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_swi": Intellect=4.67, SpellDamage=3.96, HitRating=0.00, CritRating=1.74, HasteRating=1.70, MasteryRating=1.75 )

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:341717|244325|191528|185532|166999|99990|97813|50569&chds=0,683434&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++341717++devouring_plague,9482C9,0,0,15|t++244325++halo,9482C9,1,0,15|t++191528++shadow_word_pain,9482C9,2,0,15|t++185532++vampiric_touch,9482C9,3,0,15|t++166999++shadow_word_insanity,9482C9,4,0,15|t++99990++shadow_word_death,9482C9,5,0,15|t++97813++mind_blast,9482C9,6,0,15|t++50569++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,13,11,11,11,8,6,6,4,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|shadow_word_insanity|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.67,3.96,3.34,1.75,1.74,1.70|4.64,3.93,3.31,1.72,1.70,1.67|4.70,4.00,3.38,1.79,1.77,1.73&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.67++Int,FFFFFF,0,0,15,0.1,e|t++++3.96++SP,FFFFFF,0,1,15,0.1,e|t++++3.34++Hit,FFFFFF,0,2,15,0.1,e|t++++1.75++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.74++Crit,FFFFFF,0,4,15,0.1,e|t++++1.70++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.613&chtt=Scale Factors|priest_90_di_swi%20Damage%20Per%20Second&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:687665555765643331zyxwuuttsssronnmnmmnnoonnnnnnmlkjjjjjjkkjihhhhhhhghggggggggghhhhhgghhggggggghhhhhhghhhhgghhhhhiiiiijjkllllllkkkkkjjjiiiiiihggffffgggghhhhhhhiijiiiiiiiiihghhiiijjjkklkkkkkkkklmmlkkkjjjjiiijjjkkkkkkkkkkjjjjiiiiiihhhhhhgghhhiiiiijjjjkkkkkllllllkkjjjjiiihhgggffeeddddeeeefffggghhiijkllmmmmnnmmmmmmllllkkkkkkkkkkkmmmnnoooqqrrssttuuuvvvvvttsttttsssssrrrr&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6241,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=132094|max=211656&chxp=1,1,62,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,24,16,16,16,48,80,200,200,392,520,656,760,1144,1152,1392,1824,2112,2360,2704,2640,3088,2872,2808,3176,2792,2664,2368,2336,1888,1600,1288,1096,816,824,504,408,352,216,192,88,112,56,40,16,48,32,48&chds=0,3176&chbh=5&chxt=x&chxl=0:|min=121696|avg=132094|max=142205&chxp=0,1,51,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.1,14.8,12.2,12.2,8.1,5.8,4.0,2.9,0.7,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 128.4s|mind_blast 54.0s|vampiric_touch 44.8s|shadow_word_pain 44.6s|shadow_word_insanity 29.7s|devouring_plague 21.2s|shadow_word_death 14.7s|halo 10.6s|shadowfiend 2.5s|waiting 2.1s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi 132094
devouring_plague 7060 (19839) 5.3% (15.0%) 17.9 21.27sec 404573 341717 118685 245974 143965 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 0.00 0.00 1.1840 0.0000 2583823.01 2583823.01 0.00 341716.93 341716.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.38 80.14% 118685.34 107519 143944 118683.41 111496 126734 1707104 1707104 0.00
crit 3.56 19.86% 245974.10 221488 296525 240948.85 0 296525 876719 876719 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3054 2.3% 46.4 7.84sec 24081 0 19825 41144 24110 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.41 46.36 0.00 0.00 0.0000 0.0000 1117662.43 1117662.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.04 79.90% 19825.29 17856 23904 19825.82 18549 21252 734340 734340 0.00
crit 9.32 20.10% 41143.56 36784 49242 41138.55 36784 47032 383323 383323 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9726 7.4% 17.9 21.27sec 198335 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.4 19747 40943 23988 20.0% 0.0% 30.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 148.39 148.39 0.0000 0.7481 3559657.52 3559657.52 0.00 32064.08 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.7 79.99% 19747.48 17856 34356 19746.33 18811 21211 2344174 2344174 0.00
crit 29.7 20.01% 40942.90 36784 70773 40937.11 38335 44392 1215483 1215483 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7095) 0.0% (5.4%) 9.0 42.51sec 289733 244325 0 0 0 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.96 8.96 0.00 0.00 1.1859 0.0000 0.00 0.00 0.00 244325.22 244325.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.13 79.59% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.83 20.41% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7095 5.4% 9.0 42.51sec 289733 0 119174 247286 144866 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.96 17.93 0.00 0.00 0.0000 0.0000 2596932.75 2596932.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.33 79.95% 119173.57 109581 139821 119158.69 109581 126455 1707902 1707902 0.00
crit 3.60 20.05% 247285.92 225736 288030 242911.98 0 288030 889031 889031 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 12454 100.0% 9.0 42.51sec 508543 0 43134 61426 47366 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.96 96.23 0.00 0.00 0.0000 0.0000 4558167.81 19135051.77 76.18 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.97 76.87% 43133.76 -0 184948 43099.15 0 112730 3190665 11779805 72.97
crit 22.26 23.13% 61426.41 0 380994 61402.32 0 220620 1367503 7355247 81.44
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14434 10.9% 45.8 8.00sec 115381 97813 94996 196986 115381 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.78 45.78 0.00 0.00 1.1796 0.0000 5282673.72 5282673.72 0.00 97812.80 97812.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.63 80.01% 94995.57 86183 115909 94995.32 91420 99506 3479976 3479976 0.00
crit 9.15 19.99% 196986.09 177536 238773 197023.45 177536 223431 1802698 1802698 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13504 (17744) 10.2% (13.4%) 75.9 4.67sec 85525 50569 0 0 0 0.0% 0.0% 0.0% 0.0% 160.5 25325 52520 30789 20.1% 0.0% 32.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.93 75.93 160.52 160.52 1.6913 0.7313 4942361.11 4942361.11 0.00 50569.27 50569.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.3 79.91% 25325.02 22887 30640 25325.14 24568 26130 3248432 3248432 0.00
crit 32.3 20.09% 52519.71 47146 63119 52518.37 49789 56389 1693929 1693929 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4240 3.2% 50.4 6.87sec 30798 0 25330 52553 30810 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.39 50.37 0.00 0.00 0.0000 0.0000 1551997.19 1551997.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.23 79.87% 25330.09 22887 30640 25329.72 24125 27120 1019076 1019076 0.00
crit 10.14 20.13% 52552.87 47146 63119 52567.44 47146 59238 532921 532921 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4023 3.0% 12.5 4.90sec 117854 99990 96455 200116 117851 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.49 12.49 0.00 0.00 1.1787 0.0000 1472451.23 1472451.23 0.00 99989.90 99989.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.91 79.36% 96454.83 83662 112752 96467.89 85566 105681 956323 956323 0.00
crit 2.58 20.64% 200115.89 172343 232270 189208.31 0 232270 516128 516128 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 13530 10.2% 25.1 13.37sec 197331 166999 162775 336932 197330 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.10 25.10 0.00 0.00 1.1816 0.0000 4952036.17 4952036.17 0.00 166999.50 166999.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.12 80.16% 162774.71 148247 199962 162785.54 154193 171001 3274318 3274318 0.00
crit 4.98 19.84% 336931.88 305389 411923 335768.86 0 411923 1677718 1677718 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 17787 (23350) 13.5% (17.7%) 37.9 9.71sec 225765 191528 0 0 0 0.0% 0.0% 0.0% 0.0% 334.5 14742 30489 19461 30.0% 0.0% 180.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.85 37.85 334.51 334.51 1.1788 1.9717 6509911.78 6509911.78 0.00 12136.41 191527.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 234.3 70.03% 14742.36 13422 17966 14742.40 14386 15175 3453558 3453558 0.00
crit 100.2 29.97% 30488.74 27649 37009 30488.33 29546 31651 3056354 3056354 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5564 4.2% 104.6 3.46sec 19458 0 14754 30546 19490 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.65 104.48 0.00 0.00 0.0000 0.0000 2036242.79 2036242.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.15 70.01% 14753.76 13422 17966 14753.83 14171 15289 1079195 1079195 0.00
crit 31.33 29.99% 30545.55 27649 37009 30547.99 28998 32347 957048 957048 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2259 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5469 4.1% 92.4 3.92sec 21656 0 18407 37040 22135 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.43 90.43 0.00 0.00 0.0000 0.0000 2001642.87 2001642.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.34 79.99% 18406.52 16669 22484 18406.56 17803 19011 1331509 1331509 0.00
crit 18.09 20.01% 37039.67 33338 44968 37039.54 33796 40620 670134 670134 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17291 (22697) 13.1% (17.2%) 38.0 9.45sec 218377 185532 0 0 0 0.0% 0.0% 0.0% 0.0% 315.3 16545 34306 20073 19.9% 0.0% 191.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.04 38.04 315.27 315.27 1.1771 2.2188 6328472.60 6328472.60 0.00 11161.44 185531.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 252.6 80.14% 16545.38 15001 20366 16545.47 16088 17025 4180038 4180038 0.00
crit 62.6 19.86% 34305.75 30902 41955 34305.25 32701 36202 2148434 2148434 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5406 4.1% 98.5 3.62sec 20096 0 16575 34388 20116 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.46 98.37 0.00 0.00 0.0000 0.0000 1978705.74 1978705.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.81 80.12% 16574.87 15001 20366 16574.83 15919 17142 1306333 1306333 0.00
crit 19.55 19.88% 34387.89 30902 41955 34389.75 31952 37255 672373 672373 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51374 / 3913
melee 51374 3.0% 26.9 14.64sec 53224 54115 49330 99976 53224 20.5% 7.3% 24.0% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.90 26.90 0.00 0.00 0.9835 0.0000 1431986.88 1431986.88 0.00 54114.84 54114.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.31 45.77% 49329.97 38145 58728 49328.55 43287 56479 607487 607487 0.00
crit 5.53 20.54% 99975.75 76291 117456 99700.22 0 117456 552485 552485 0.00
glance 6.47 24.05% 37182.25 28609 44046 37141.24 0 44046 240568 240568 0.00
block 0.63 2.35% 49800.72 38145 58728 23511.92 0 58728 31447 31447 0.00
parry 1.96 7.29% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1883 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.61%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 20.2 1.8 17.3sec 15.9sec 9.96% 42.48%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.96%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.6sec 107.6sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.69%
jade_serpent_potion 1.0 0.0 336.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.3 36.2sec 20.4sec 43.75% 44.10%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.75%

    Trigger Attempt Success

    • trigger_pct:1.63%
light_of_the_cosmos 8.0 0.0 47.9sec 47.9sec 43.48% 43.48%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.48%

    Trigger Attempt Success

    • trigger_pct:14.46%
shadow_word_death_reset_cooldown 6.3 0.0 10.2sec 10.2sec 9.91% 49.21%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.91%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 0.9 0.0 195.4sec 195.4sec 3.49% 3.60%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.49%

Trigger Attempt Success

  • trigger_pct:85.93%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.57% 80.51%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi
devouring_plague Shadow Orb 17.9 53.8 3.0 3.0 134857.6
halo Mana 9.0 363009.6 40500.0 40500.0 7.2
mind_blast Mana 45.8 217408.3 4748.5 4748.5 24.3
mind_flay Mana 75.9 227805.6 3000.0 3000.0 28.5
shadow_word_death Mana 12.5 97455.1 7800.0 7800.3 15.1
shadow_word_insanity Mana 25.1 188212.8 7500.0 7500.0 26.3
shadow_word_pain Mana 37.9 499673.9 13200.0 13200.0 17.1
vampiric_touch Mana 38.0 342364.3 9000.0 9000.0 24.3
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.94 110207.47 (5.71%) 4418.45 114275.57 50.91%
Shadow Orbs from Mind Blast Shadow Orb 45.78 45.78 (87.82%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.35 6.35 (12.18%) 1.00 0.00 0.00%
Devouring Plague Health Health 194.75 1917292.18 (81.40%) 9844.92 787117.34 29.10%
Vampiric Touch Mana Mana 413.63 1504471.10 (77.93%) 3637.22 682222.18 31.20%
mp5_regen Mana 1463.00 315874.61 (16.36%) 215.91 123025.39 28.03%
vampiric_embrace Health 58.68 437984.41 (18.60%) 7464.46 418841.31 48.88%
pet - shadowfiend
vampiric_embrace Health 0.12 1112.60 (100.00%) 9089.88 799.52 41.81%
Resource RPS-Gain RPS-Loss
Health 14206.44 14867.22
Mana 5274.74 5289.43
Shadow Orb 0.14 0.15
Combat End Resource Mean Min Max
Health 221042.44 -106963.87 462887.00
Mana 294622.76 247800.00 300000.00
Shadow Orb 1.29 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 28.3%
shadowfiend-Mana Cap 28.3%
lightwell-Mana Cap 28.3%

Procs

Count Interval
Shadowy Recall Extra Tick 299.6 1.2sec
Shadowy Apparition Procced 92.4 3.9sec
Divine Insight Mind Blast CD Reset 38.7 15.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_di_swi Damage Per Second
Count 49992
Mean 132094.42
Minimum 121695.74
Maximum 142205.43
Spread ( max - min ) 20509.69
Range [ ( max - min ) / 2 * 100% ] 7.76%
Standard Deviation 2740.9702
5th Percentile 127627.05
95th Percentile 136662.18
( 95th Percentile - 5th Percentile ) 9035.13
Mean Distribution
Standard Deviation 12.2590
95.00% Confidence Intervall ( 132070.39 - 132118.45 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1654
0.1 Scale Factor Error with Delta=300 64134
0.05 Scale Factor Error with Delta=300 256538
0.01 Scale Factor Error with Delta=300 6413458
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 132094.42
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46914570.93
Distribution Chart

DTPS

Sample Data priest_90_di_swi Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_di_swi Healing Per Second
Count 49992
Mean 12454.01
Minimum 0.00
Maximum 32030.37
Spread ( max - min ) 32030.37
Range [ ( max - min ) / 2 * 100% ] 128.59%
Standard Deviation 6995.7194
5th Percentile 3183.83
95th Percentile 25810.89
( 95th Percentile - 5th Percentile ) 22627.06
Mean Distribution
Standard Deviation 31.2883
95.00% Confidence Intervall ( 12392.69 - 12515.33 )
Normalized 95.00% Confidence Intervall ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12121
0.1% Error 1212111
0.1 Scale Factor Error with Delta=300 417780
0.05 Scale Factor Error with Delta=300 1671123
0.01 Scale Factor Error with Delta=300 41778075
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 12454.01
Distribution Chart

Heal

Sample Data
Count 49992
Mean 4558167.81
Distribution Chart

HTPS

Sample Data priest_90_di_swi Healing taken Per Second
Count 49992
Mean 7771.05
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 253.53
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.45 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.49 shadow_word_death,if=active_enemies<=5
F 46.97 mind_blast,if=active_enemies<=6&cooldown_react
G 37.85 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 39.60 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.10 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.86 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 8.96 halo,if=talent.halo.enabled
M 11.50 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.02 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.91 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 43.81 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTQFTFMTQFTIGIGHFHTQFMTFFIGHGHTQQQFLMTQFTHGHGTFTFDFHHGIGTFTLTQFHHIGIGDFTFHHIGIGTQFMTLTFHHHGIFGTFMTHHTIFGGTFTFLHHMFTFBFGGMTFHHTFTFGGMTFHHLTQFTIGGTTFHHMTQFTFIGIGTHFHKMTLTFIGIGFHHHFMTFIGIGHHQFTQQQFMTLTIFGIEEGHHFMTEETFIGTEDEFGHHT9QQQFEDEIGLFTEEGHHFMTEEGBQFT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl : 131071 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131071.1 131071.1 20.89 / 0.02% 3905 / 3.0% 26.5 8749.5 8749.5 42.73 / 0.49% 7898 / 90.3% 1.8 4804.3 4800.5 Mana 0.47% 44.3 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.78 0.00 3.95 3.20 1.66 1.62 1.80
Normalized 1.00 0.00 0.83 0.67 0.35 0.34 0.38
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=4.78, SpellDamage=3.95, HitRating=3.20, CritRating=1.66, HasteRating=1.62, MasteryRating=1.80 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=4.78, SpellDamage=3.95, HitRating=0.00, CritRating=1.66, HasteRating=1.62, MasteryRating=1.80 )

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:349713|252061|230803|194932|100855|99518|83499|52866&chds=0,699425&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++349713++devouring_plague,9482C9,0,0,15|t++252061++halo,9482C9,1,0,15|t++230803++shadow_word_pain,9482C9,2,0,15|t++194932++vampiric_touch,9482C9,3,0,15|t++100855++shadow_word_death,9482C9,4,0,15|t++99518++mind_blast,9482C9,5,0,15|t++83499++mind_spike,4A79D3,6,0,15|t++52866++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,14,12,10,9,7,6,5,5,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.78,3.95,3.20,1.80,1.66,1.62|4.75,3.92,3.17,1.77,1.63,1.59|4.81,3.98,3.23,1.83,1.69,1.65&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.78++Int,FFFFFF,0,0,15,0.1,e|t++++3.95++SP,FFFFFF,0,1,15,0.1,e|t++++3.20++Hit,FFFFFF,0,2,15,0.1,e|t++++1.80++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.66++Crit,FFFFFF,0,4,15,0.1,e|t++++1.62++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.746&chtt=Scale Factors|priest_90_pi_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6765443322210zyzzvvutsppoonmmlkjiiihhhiiihhhhiihgggggggghhfedccccbbabbcccccccccdcdddcbbbaabbbbbcccccccccccccdddddcccccddeeffggghhhhhhhhhhhhhfeddccddddddeeeedddddddddeedddcabbbccddeffggggfffffgggfeeddcccbabbcdeefffffeeeeddddddcccbbaabbbbcddeeeefffgghiiiiiiiiihhhhhhhhggfeddcbbaZZZZYZZZZZZaaabbcdddffggghhhhhhhhihhggffffffffffffgghhhiiijkkllmmnnoooppppoooppppppppoonnn&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5469,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=131071|max=239674&chxp=1,1,55,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,24,16,40,80,80,152,152,208,328,456,704,808,848,1376,1400,1728,1920,2208,2352,2536,2832,2648,2760,2832,2712,2736,2552,2352,1928,1736,1656,1280,976,928,664,496,472,360,176,160,128,40,32,24,16,0,32,16&chds=0,2832&chbh=5&chxt=x&chxl=0:|min=122588|avg=131071|max=139750&chxp=0,1,49,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.8,17.9,12.6,12.1,11.2,5.0,4.0,2.8,0.7,0.5&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 109.1s|mind_spike 65.5s|mind_blast 46.0s|vampiric_touch 44.3s|shadow_word_pain 40.9s|devouring_plague 18.4s|shadow_word_death 14.7s|halo 10.4s|shadowfiend 2.4s|waiting 1.7s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl 131071
devouring_plague 6208 (17609) 4.7% (13.4%) 15.8 23.97sec 406832 349713 118154 244926 143432 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 0.00 0.00 1.1633 0.0000 2272185.21 2272185.21 0.00 349712.51 349712.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.68 80.06% 118154.39 107519 143944 118147.89 110979 126043 1498531 1498531 0.00
crit 3.16 19.94% 244926.10 221488 296525 238732.07 0 296525 773654 773654 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2727 2.1% 41.6 8.78sec 24001 0 19753 40974 24025 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.59 41.55 0.00 0.00 0.0000 0.0000 998245.75 998245.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.18 79.87% 19752.92 17856 23904 19753.55 18632 21061 655490 655490 0.00
crit 8.37 20.13% 40973.96 36784 49242 40976.75 36784 49242 342756 342756 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8673 6.6% 15.8 23.97sec 200385 0 0 0 0 0.0% 0.0% 0.0% 0.0% 133.2 19630 40672 23832 20.0% 0.0% 26.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 133.20 133.20 0.0000 0.7358 3174420.80 3174420.80 0.00 32390.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.6 80.03% 19629.89 17856 23904 19628.76 18762 20657 2092640 2092640 0.00
crit 26.6 19.97% 40672.31 36784 49242 40669.39 38118 43681 1081781 1081781 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7144) 0.0% (5.5%) 9.0 42.83sec 290576 252061 0 0 0 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1529 0.0000 0.00 0.00 0.00 252060.83 252060.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.19 79.91% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.81 20.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7144 5.5% 9.0 42.83sec 290576 0 119499 248033 145291 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 18.00 0.00 0.00 0.0000 0.0000 2614627.00 2614627.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.39 79.94% 119499.44 109581 139821 119492.61 111464 127807 1719032 1719032 0.00
crit 3.61 20.06% 248033.21 225736 288030 243908.92 0 288030 895595 895595 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 8750 100.0% 9.0 42.83sec 355889 0 31737 40161 33697 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.03 0.00 0.00 0.0000 0.0000 3202319.14 18986379.08 83.13 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.92 76.73% 31736.95 -0 184948 31640.85 0 116690 2314270 11654922 80.20
crit 22.11 23.27% 40161.04 -0 380994 40204.82 0 196779 888049 7331457 87.88
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12499 9.5% 39.6 9.27sec 115489 99518 95164 197151 115489 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.61 39.61 0.00 0.00 1.1605 0.0000 4574759.37 4574759.37 0.00 99518.36 99518.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.72 80.07% 95164.47 86183 115909 95165.34 91891 98969 3018388 3018388 0.00
crit 7.89 19.93% 197150.51 177536 238773 197055.41 0 225607 1556372 1556372 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 12013 (15764) 9.2% (12.0%) 67.8 5.18sec 85066 52866 0 0 0 0.0% 0.0% 0.0% 0.0% 141.7 25493 52913 31021 20.2% 0.0% 26.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.83 67.83 141.73 141.73 1.6091 0.6927 4396606.19 4396606.19 0.00 52866.28 52866.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.2 79.84% 25492.77 22887 30640 25492.54 24560 26507 2884686 2884686 0.00
crit 28.6 20.16% 52912.84 47146 63119 52910.64 49533 57734 1511920 1511920 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3752 2.9% 44.3 7.74sec 31021 0 25492 52909 31025 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.26 44.26 0.00 0.00 0.0000 0.0000 1373061.23 1373061.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.33 79.82% 25492.29 22887 30640 25492.81 24033 26935 900548 900548 0.00
crit 8.93 20.18% 52908.94 47146 63119 52898.49 47146 61402 472514 472514 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 14939 11.4% 56.6 6.19sec 96610 83499 79593 164930 96610 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.60 56.60 0.00 0.00 1.1570 0.0000 5467836.79 5467836.79 0.00 83498.82 83498.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.31 80.06% 79593.38 72412 97688 79595.81 76268 84130 3606489 3606489 0.00
crit 11.29 19.94% 164930.36 149169 201238 164937.18 149169 187734 1861348 1861348 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.0 121.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 4061 3.1% 12.6 4.84sec 117777 100855 96362 200261 117777 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.62 12.62 0.00 0.00 1.1678 0.0000 1486396.51 1486396.51 0.00 100854.70 100854.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.02 79.39% 96362.38 83662 112752 96369.80 84951 106072 965477 965477 0.00
crit 2.60 20.61% 200261.30 172343 232270 188984.83 0 232270 520920 520920 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19669 (25818) 15.0% (19.7%) 35.5 10.43sec 265912 230803 0 0 0 0.0% 0.0% 0.0% 0.0% 369.0 14773 30561 19507 30.0% 0.0% 196.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.54 35.54 369.05 369.05 1.1521 1.9502 7198976.34 7198976.34 0.00 12422.31 230803.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 258.4 70.02% 14773.05 13422 17966 14773.10 14358 15190 3817209 3817209 0.00
crit 110.7 29.98% 30561.04 27649 37009 30560.75 29401 31703 3381767 3381767 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6148 4.7% 115.5 3.14sec 19482 0 14771 30583 19505 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.51 115.37 0.00 0.00 0.0000 0.0000 2250337.45 2250337.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.84 70.06% 14771.34 13422 17966 14771.22 14263 15332 1194059 1194059 0.00
crit 34.54 29.94% 30582.64 27649 37009 30582.79 29091 32545 1056279 1056279 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2152 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5705 4.4% 96.6 3.76sec 21626 0 18423 37091 22140 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.55 94.31 0.00 0.00 0.0000 0.0000 2088058.48 2088058.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.54 80.09% 18422.69 16669 22484 18422.25 17786 19081 1391562 1391562 0.00
crit 18.78 19.91% 37091.33 33338 44968 37090.59 34025 40010 696496 696496 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17970 (23587) 13.7% (18.0%) 38.3 9.36sec 225203 194932 0 0 0 0.0% 0.0% 0.0% 0.0% 326.3 16601 34425 20154 19.9% 0.0% 191.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 326.33 326.33 1.1553 2.1500 6576929.81 6576929.81 0.00 11573.43 194932.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 261.3 80.06% 16600.52 15001 20366 16600.38 16082 17032 4337176 4337176 0.00
crit 65.1 19.94% 34424.84 30902 41955 34423.78 32893 36043 2239754 2239754 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5617 4.3% 102.1 3.51sec 20140 0 16611 34450 20166 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.08 101.94 0.00 0.00 0.0000 0.0000 2055831.97 2055831.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.63 80.07% 16611.20 15001 20366 16611.06 15962 17242 1355950 1355950 0.00
crit 20.32 19.93% 34449.98 30902 41955 34452.15 31742 37926 699882 699882 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51873 / 3945
melee 51873 3.0% 26.9 14.63sec 53632 54689 49579 100402 53630 20.8% 7.2% 23.9% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.92 26.92 0.00 0.00 0.9807 0.0000 1443734.43 1443734.43 0.00 54688.98 54688.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.33 45.79% 49578.97 38145 58728 49574.65 43979 57061 611101 611101 0.00
crit 5.59 20.77% 100401.98 76291 117456 100247.08 0 117456 561440 561440 0.00
glance 6.43 23.90% 37308.84 28609 44046 37283.76 0 44046 240081 240081 0.00
block 0.62 2.32% 49877.69 38145 58728 23018.17 0 58728 31113 31113 0.00
parry 1.94 7.22% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1461 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.19%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.7sec 107.7sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.64%
glyph_mind_spike 31.4 25.2 11.3sec 6.2sec 51.94% 76.58%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.68%
  • glyph_mind_spike_2:20.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 336.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.2 7.6 36.0sec 20.0sec 44.49% 45.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.49%

    Trigger Attempt Success

    • trigger_pct:1.62%
light_of_the_cosmos 8.0 0.0 47.9sec 47.9sec 43.54% 43.54%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.54%

    Trigger Attempt Success

    • trigger_pct:14.61%
power_infusion 4.0 0.0 121.1sec 121.2sec 17.16% 19.48%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.4 0.0 10.1sec 10.1sec 9.97% 49.29%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.97%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 37.0 27.3 9.6sec 5.5sec 45.66% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:34.29%
  • surge_of_darkness_2:11.37%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
vampiric_embrace 1.0 0.0 186.2sec 186.2sec 3.93% 4.03%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.93%

Trigger Attempt Success

  • trigger_pct:95.94%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.55% 80.21%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl
devouring_plague Shadow Orb 15.8 47.5 3.0 3.0 135608.9
halo Mana 9.0 340956.9 37892.2 37892.2 7.7
mind_blast Mana 39.6 343784.4 8678.8 8678.8 13.3
mind_flay Mana 67.8 192871.1 2843.6 2843.6 29.9
shadow_word_death Mana 12.6 97312.8 7710.5 7710.7 15.3
shadow_word_pain Mana 35.5 449675.6 12654.3 12654.3 21.0
vampiric_touch Mana 38.3 333762.9 8706.9 8706.9 25.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.98 101718.67 (5.79%) 4072.66 123065.33 54.75%
Shadow Orbs from Mind Blast Shadow Orb 39.61 39.61 (86.09%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.40 6.40 (13.91%) 1.00 0.00 0.00%
Devouring Plague Health Health 174.75 1725543.76 (77.79%) 9874.23 701171.34 28.89%
Vampiric Touch Mana Mana 428.27 1367726.39 (77.85%) 3193.59 896080.81 39.58%
mp5_regen Mana 1463.00 287531.43 (16.37%) 196.54 151368.57 34.49%
vampiric_embrace Health 67.21 492579.29 (22.21%) 7328.71 422299.80 46.16%
pet - shadowfiend
vampiric_embrace Health 0.03 174.95 (100.00%) 6142.85 163.44 48.30%
Resource RPS-Gain RPS-Loss
Health 14191.23 14867.22
Mana 4800.48 4804.27
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 215490.64 -101143.19 462887.00
Mana 298612.51 261240.00 300000.00
Shadow Orb 1.49 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 34.6%
shadowfiend-Mana Cap 34.6%
lightwell-Mana Cap 34.6%

Procs

Count Interval
Shadowy Recall Extra Tick 303.1 1.2sec
Shadowy Apparition Procced 96.6 3.8sec
FDCL Mind Spike proc 64.3 5.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl Damage Per Second
Count 49992
Mean 131071.06
Minimum 122587.73
Maximum 139750.22
Spread ( max - min ) 17162.49
Range [ ( max - min ) / 2 * 100% ] 6.55%
Standard Deviation 2383.5605
5th Percentile 127177.76
95th Percentile 134988.33
( 95th Percentile - 5th Percentile ) 7810.57
Mean Distribution
Standard Deviation 10.6605
95.00% Confidence Intervall ( 131050.16 - 131091.95 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1270
0.1 Scale Factor Error with Delta=300 48499
0.05 Scale Factor Error with Delta=300 193997
0.01 Scale Factor Error with Delta=300 4849936
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131071.06
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46528272.90
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl Healing Per Second
Count 49992
Mean 8749.51
Minimum 0.00
Maximum 30900.94
Spread ( max - min ) 30900.94
Range [ ( max - min ) / 2 * 100% ] 176.59%
Standard Deviation 4874.4605
5th Percentile 2352.76
95th Percentile 18148.55
( 95th Percentile - 5th Percentile ) 15795.79
Mean Distribution
Standard Deviation 21.8010
95.00% Confidence Intervall ( 8706.78 - 8792.24 )
Normalized 95.00% Confidence Intervall ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11922
0.1% Error 1192290
0.1 Scale Factor Error with Delta=300 202832
0.05 Scale Factor Error with Delta=300 811328
0.01 Scale Factor Error with Delta=300 20283214
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 8749.51
Distribution Chart

Heal

Sample Data
Count 49992
Mean 3202319.14
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl Healing taken Per Second
Count 49992
Mean 8130.72
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 270.48
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.00 power_infusion,if=talent.power_infusion.enabled
D 3.94 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.62 shadow_word_death,if=active_enemies<=5
F 40.39 mind_blast,if=active_enemies<=6&cooldown_react
G 35.54 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 40.50 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 16.26 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.96 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.90 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.11 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.46 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 40.34 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 43.48 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGGHHLTFRTJRTFHGGHMTFTFHTHTGGJFLJMRRHFHHTGFGTRFHHMTQFGGRTLTFHHRTFMTGGTFRHHTCQFTJRGGFLJHHHMRFRTQFTGGHHJFMRTRTQFJRRGGFHHLRTBFMJRTFGGHHRTFRTRTFMHGHGJFJLRTQFTRTHHGFGMRTCTFTHHRFRGTGJLJFMRTHHFHTGJGFRTTHHFKMTGFGLJEEHHFJMREETFGGJPEDEFHHJRT9PEEFMTRGGEEFHHLRTEDEFTTBCGE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb : 128531 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
128531.4 128531.4 18.89 / 0.01% 3493 / 2.7% 23.8 8933.9 8933.9 43.13 / 0.48% 7903 / 88.5% 1.8 5010.9 4990.5 Mana 0.31% 36.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.72 0.00 3.91 3.00 1.79 1.40 1.95
Normalized 1.00 0.00 0.83 0.64 0.38 0.30 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=4.72, SpellDamage=3.91, HitRating=3.00, CritRating=1.79, HasteRating=1.40, MasteryRating=1.95 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=4.72, SpellDamage=3.91, HitRating=0.00, CritRating=1.79, HasteRating=1.40, MasteryRating=1.95 )

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:353968|251945|231290|194942|100314|99438|53207&chds=0,707935&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++353968++devouring_plague,9482C9,0,0,15|t++251945++halo,9482C9,1,0,15|t++231290++shadow_word_pain,9482C9,2,0,15|t++194942++vampiric_touch,9482C9,3,0,15|t++100314++shadow_word_death,9482C9,4,0,15|t++99438++mind_blast,9482C9,5,0,15|t++53207++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,16,15,10,8,7,6,5,5,5,5,5,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|vampiric_touch|mind_blast|mindbender: melee|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|mind_flay_mastery|devouring_plague|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_mb Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.72,3.91,3.00,1.95,1.79,1.40|4.69,3.88,2.97,1.92,1.76,1.38|4.75,3.94,3.03,1.97,1.81,1.43&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.72++Int,FFFFFF,0,0,15,0.1,e|t++++3.91++SP,FFFFFF,0,1,15,0.1,e|t++++3.00++Hit,FFFFFF,0,2,15,0.1,e|t++++1.95++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.79++Crit,FFFFFF,0,4,15,0.1,e|t++++1.40++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.672&chtt=Scale Factors|priest_90_pi_mb%20Damage%20Per%20Second&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:57687766555443233zzyxwtsqponnmkjjiihgffihhghhhhggffffggghijigfgfffeeegfgggggffffeeedddccccbbbbbaabbbababbbbccccdddefgghhhijkkjjjjjkkkllkkjjjihfeedeeeddddccccbbbbbbbcdddddcbbbbccccccddeeedeeeefggghgggffffeeeefeeeeededdccbccccccbbaaaaababcddefghiijklnnooppppponnmlkjiihgedcbaaZZYYYYXYZYZZZZaabcccddeghiijjklkkllmlllkkkkjjiiihhgghihhiiiikklmmmnooopppqqqpoooonnmmmmlkkkk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5631,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=128531|max=228258&chxp=1,1,56,100&chtt=priest_90_pi_mb DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,0,8,24,0,48,80,136,184,272,344,528,688,904,1296,1456,1728,2336,2512,2664,3096,3008,3104,2920,3024,3200,2992,2632,2232,2040,1600,1392,976,776,592,272,400,160,128,80,32,24,32,24,0,16,8,0,8&chds=0,3200&chbh=5&chxt=x&chxl=0:|min=119978|avg=128531|max=137664&chxp=0,1,48,100&chtt=priest_90_pi_mb DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.1,12.1,11.5,11.2,4.7,4.0,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 172.5s|vampiric_touch 44.3s|mind_blast 42.1s|shadow_word_pain 40.9s|devouring_plague 17.1s|shadow_word_death 14.5s|halo 10.4s|mindbender 6.7s|waiting 1.1s&chtt=priest_90_pi_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb 128531
devouring_plague 5805 (16529) 4.5% (12.9%) 14.8 26.02sec 409910 353968 118480 245707 143970 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.76 14.76 0.00 0.00 1.1581 0.0000 2124781.62 2124781.62 0.00 353967.66 353967.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.80 79.97% 118480.45 107519 143944 118463.15 110484 128888 1398276 1398276 0.00
crit 2.96 20.03% 245706.53 221488 296525 235963.12 0 296525 726506 726506 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2570 2.0% 39.1 9.35sec 24056 0 19817 41088 24080 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.09 39.06 0.00 0.00 0.0000 0.0000 940461.45 940461.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.23 79.96% 19816.78 17856 23904 19816.20 18662 21427 618857 618857 0.00
crit 7.83 20.04% 41088.32 36784 49242 41077.44 0 49242 321604 321604 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8154 6.3% 14.8 26.02sec 202217 0 0 0 0 0.0% 0.0% 0.0% 0.0% 124.8 19693 40810 23917 20.0% 0.0% 25.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.76 14.76 124.78 124.78 0.0000 0.7324 2984418.19 2984418.19 0.00 32658.35 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.8 80.00% 19693.49 17856 23904 19692.26 18854 20702 1965810 1965810 0.00
crit 25.0 20.00% 40809.54 36784 49242 40802.98 38030 44605 1018608 1018608 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7142) 0.0% (5.6%) 9.0 42.62sec 290437 251945 0 0 0 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1528 0.0000 0.00 0.00 0.00 251945.26 251945.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.19 79.88% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.81 20.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7142 5.6% 9.0 42.62sec 290437 0 119722 248463 145216 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 18.00 0.00 0.00 0.0000 0.0000 2613932.04 2613932.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.44 80.20% 119721.83 109581 139821 119720.26 110921 127738 1728220 1728220 0.00
crit 3.56 19.80% 248463.42 225736 288030 243945.82 0 288030 885712 885712 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 8934 100.0% 9.0 42.62sec 363313 0 31438 43557 34262 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 95.43 0.00 0.00 0.0000 0.0000 3269819.18 19101941.59 82.88 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.19 76.70% 31438.01 -0 184948 31413.10 0 117739 2301177 11714416 80.38
crit 22.24 23.30% 43557.45 -0 380994 43405.22 0 218369 968642 7387525 86.95
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11448 8.9% 36.3 10.09sec 115329 99438 95041 196908 115330 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.33 36.33 0.00 0.00 1.1598 0.0000 4189841.08 4189841.08 0.00 99438.50 99438.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.09 80.08% 95040.52 86183 115909 95039.03 91483 98587 2765074 2765074 0.00
crit 7.24 19.92% 196907.99 177536 238773 196922.64 177536 238773 1424767 1424767 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 19097 (25073) 14.9% (19.5%) 104.4 3.41sec 87898 53207 0 0 0 0.0% 0.0% 0.0% 0.0% 226.4 25393 52696 30868 20.1% 0.0% 43.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.40 104.40 226.43 226.43 1.6520 0.7023 6989657.36 6989657.36 0.00 53207.37 53207.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.0 79.95% 25392.85 22887 30640 25393.01 24791 25971 4596729 4596729 0.00
crit 45.4 20.05% 52695.80 47146 63119 52695.53 49599 55728 2392929 2392929 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5975 4.6% 70.9 4.97sec 30853 0 25397 52655 30863 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.88 70.86 0.00 0.00 0.0000 0.0000 2186964.11 2186964.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.65 79.95% 25397.49 22887 30640 25397.61 24194 26487 1438777 1438777 0.00
crit 14.21 20.05% 52655.13 47146 63119 52653.65 48042 59021 748187 748187 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 5.8 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.82 5.82 0.00 0.00 1.1548 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 3.9 121.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.92 3.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3963 3.1% 12.3 4.84sec 117488 100314 96420 200170 117486 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.35 12.35 0.00 0.00 1.1713 0.0000 1450546.68 1450546.68 0.00 100314.43 100314.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.84 79.69% 96420.16 83662 112752 96418.80 87195 105335 948700 948700 0.00
crit 2.51 20.31% 200169.68 172343 232270 188197.25 0 232270 501846 501846 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19680 (25831) 15.3% (20.1%) 35.5 10.44sec 266627 231290 0 0 0 0.0% 0.0% 0.0% 0.0% 369.2 14777 30570 19509 30.0% 0.0% 196.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.46 35.46 369.22 369.22 1.1528 1.9495 7202956.30 7202956.30 0.00 12428.56 231290.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 258.6 70.04% 14777.49 13422 17966 14777.69 14333 15248 3821633 3821633 0.00
crit 110.6 29.96% 30569.77 27649 37009 30569.13 29383 31891 3381323 3381323 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6151 4.8% 115.5 3.14sec 19489 0 14774 30586 19513 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.52 115.37 0.00 0.00 0.0000 0.0000 2251263.22 2251263.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.79 70.03% 14773.56 13422 17966 14773.64 14252 15328 1193543 1193543 0.00
crit 34.58 29.97% 30585.65 27649 37009 30586.24 28918 32581 1057720 1057720 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5718 4.4% 96.6 3.76sec 21661 0 18432 37093 22174 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.61 94.38 0.00 0.00 0.0000 0.0000 2092639.22 2092639.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.45 79.95% 18432.09 16669 22484 18432.09 17773 18976 1390758 1390758 0.00
crit 18.92 20.05% 37093.34 33338 44968 37096.28 34285 40122 701881 701881 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17978 (23607) 14.0% (18.4%) 38.4 9.38sec 225035 194942 0 0 0 0.0% 0.0% 0.0% 0.0% 326.2 16611 34448 20173 20.0% 0.0% 191.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.39 38.39 326.18 326.18 1.1544 2.1455 6580051.53 6580051.53 0.00 11611.24 194941.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 261.0 80.03% 16610.86 15001 20366 16610.89 16168 17052 4336006 4336006 0.00
crit 65.1 19.97% 34447.87 30902 41955 34446.56 32887 36198 2244046 2244046 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5629 4.4% 102.2 3.50sec 20157 0 16612 34457 20178 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.21 102.10 0.00 0.00 0.0000 0.0000 2060149.32 2060149.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.69 80.02% 16611.93 15001 20366 16611.96 16031 17267 1357089 1357089 0.00
crit 20.40 19.98% 34456.53 30902 41955 34457.41 31964 38201 703061 703061 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37041 / 9221
melee 37041 7.2% 81.4 4.25sec 41435 39532 38690 78102 41435 20.1% 7.4% 24.1% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.45 81.45 0.00 0.00 1.0481 0.0000 3374843.75 3374843.75 0.00 39531.96 39531.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.43 45.96% 38689.77 30516 46982 38688.46 36586 41167 1448328 1448328 0.00
crit 16.40 20.13% 78102.32 61032 93964 78105.21 70396 86513 1280737 1280737 0.00
glance 19.62 24.09% 29084.57 22887 35237 29081.84 26500 32172 570779 570779 0.00
block 1.94 2.38% 38713.98 30516 46982 33293.54 0 46982 74999 74999 0.00
parry 6.05 7.43% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.8 20.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.82 18.82 0.00 0.00 1.1350 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.43%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.8sec 107.8sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:16.04%
jade_serpent_potion 1.0 0.0 336.1sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.2 7.7 36.0sec 19.8sec 44.64% 45.21%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.64%

    Trigger Attempt Success

    • trigger_pct:1.61%
light_of_the_cosmos 8.0 0.0 47.7sec 47.7sec 43.61% 43.61%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.61%

    Trigger Attempt Success

    • trigger_pct:14.42%
power_infusion 3.9 0.0 121.1sec 121.1sec 17.12% 19.73%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.3 0.0 10.2sec 10.2sec 9.90% 49.27%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.90%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 1.0 0.0 0.0sec 0.0sec 3.96% 4.17%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.96%

Trigger Attempt Success

  • trigger_pct:96.78%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.8 0.0 20.0sec 20.0sec 85.43% 83.85%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.17% 2.17%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.17%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb
devouring_plague Shadow Orb 14.8 44.3 3.0 3.0 136636.2
halo Mana 9.0 340391.8 37821.3 37821.3 7.7
mind_blast Mana 36.3 315941.5 8696.6 8696.6 13.3
mind_flay Mana 104.4 298900.7 2863.0 2863.0 30.7
shadow_word_death Mana 12.3 95667.9 7748.5 7748.7 15.2
shadow_word_pain Mana 35.5 449376.6 12673.2 12673.3 21.0
vampiric_touch Mana 38.4 333707.0 8691.4 8691.4 25.9
Resource Gains Type Count Total Average Overflow
mindbender Mana 75.39 175719.32 (9.62%) 2330.68 154578.56 46.80%
Shadow Orbs from Mind Blast Shadow Orb 36.33 36.33 (85.29%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.27 6.27 (14.71%) 1.00 0.00 0.00%
Devouring Plague Health Health 163.84 1626160.15 (77.11%) 9925.43 648990.93 28.53%
Vampiric Touch Mana Mana 428.28 1364265.48 (74.69%) 3185.48 899093.88 39.72%
mp5_regen Mana 1463.00 286556.19 (15.69%) 195.87 152343.81 34.71%
vampiric_embrace Health 72.71 482749.72 (22.89%) 6639.55 390918.82 44.74%
pet - mindbender
vampiric_embrace Health 20.14 135307.58 (100.00%) 6719.52 106900.13 44.14%
Resource RPS-Gain RPS-Loss
Health 14181.24 14867.22
Mana 4990.55 5010.89
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 211834.69 -98897.95 462887.00
Mana 292556.23 251760.95 300000.00
Shadow Orb 1.32 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 34.9%
shadowfiend-Mana Cap 34.9%
lightwell-Mana Cap 34.9%

Procs

Count Interval
Shadowy Recall Extra Tick 327.4 1.1sec
Shadowy Apparition Procced 96.6 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_pi_mb Damage Per Second
Count 49992
Mean 128531.44
Minimum 119978.04
Maximum 137664.02
Spread ( max - min ) 17685.98
Range [ ( max - min ) / 2 * 100% ] 6.88%
Standard Deviation 2154.9154
5th Percentile 125041.67
95th Percentile 132028.18
( 95th Percentile - 5th Percentile ) 6986.51
Mean Distribution
Standard Deviation 9.6378
95.00% Confidence Intervall ( 128512.55 - 128550.33 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1079
0.1 Scale Factor Error with Delta=300 39640
0.05 Scale Factor Error with Delta=300 158563
0.01 Scale Factor Error with Delta=300 3964095
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 128531.44
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43667662.13
Distribution Chart

DTPS

Sample Data priest_90_pi_mb Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_pi_mb Healing Per Second
Count 49992
Mean 8933.93
Minimum 0.00
Maximum 32072.76
Spread ( max - min ) 32072.76
Range [ ( max - min ) / 2 * 100% ] 179.50%
Standard Deviation 4919.7894
5th Percentile 2327.06
95th Percentile 18133.12
( 95th Percentile - 5th Percentile ) 15806.06
Mean Distribution
Standard Deviation 22.0037
95.00% Confidence Intervall ( 8890.81 - 8977.06 )
Normalized 95.00% Confidence Intervall ( 99.52% - 100.48% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11649
0.1% Error 1164940
0.1 Scale Factor Error with Delta=300 206622
0.05 Scale Factor Error with Delta=300 826488
0.01 Scale Factor Error with Delta=300 20662206
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 8933.93
Distribution Chart

Heal

Sample Data
Count 49992
Mean 3269819.18
Distribution Chart

HTPS

Sample Data priest_90_pi_mb Healing taken Per Second
Count 49992
Mean 8419.08
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 221.74
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 5.82 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 3.92 power_infusion,if=talent.power_infusion.enabled
D 3.66 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.35 shadow_word_death,if=active_enemies<=5
F 38.03 mind_blast,if=active_enemies<=6&cooldown_react
G 35.46 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 40.05 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.97 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.10 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.27 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 5.71 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 53.40 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGGHHLTFTFHGGHMTFTFHTGGHTTFLMTHFHAGGHTQFTFHMTGGHQFTLTFHTHGGFMTHFTCTAHTGFGTLTHFHMHTFGGTHTFHTFGGMHLTFHTTATFTGGHTHFMTQFTGGHLFHTFTHTGGFHMTCTAFTHTGFGHLTFMHTTFGGHTQFTHTFKMHGGLTQFTHAEETFMHTEEGGFTHTEDETFHT9TEELGFGHPEDEQFHTEEQFGCGHTA

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi : 131516 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131516.1 131516.1 21.31 / 0.02% 3983 / 3.0% 23.1 11938.8 11938.8 58.67 / 0.49% 11079 / 92.8% 2.2 5510.9 5505.1 Mana 0.33% 39.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.66 0.00 3.94 3.24 1.66 1.33 1.71
Normalized 1.00 0.00 0.85 0.70 0.36 0.28 0.37
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=4.66, SpellDamage=3.94, HitRating=3.24, CritRating=1.66, HasteRating=1.33, MasteryRating=1.71 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=4.66, SpellDamage=3.94, HitRating=0.00, CritRating=1.66, HasteRating=1.33, MasteryRating=1.71 )

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:347702|250841|202046|193669|168440|100900|99526|53760&chds=0,695403&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++347702++devouring_plague,9482C9,0,0,15|t++250841++halo,9482C9,1,0,15|t++202046++shadow_word_pain,9482C9,2,0,15|t++193669++vampiric_touch,9482C9,3,0,15|t++168440++shadow_word_insanity,9482C9,4,0,15|t++100900++shadow_word_death,9482C9,5,0,15|t++99526++mind_blast,9482C9,6,0,15|t++53760++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,14,13,11,9,6,6,5,5,4,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|shadow_word_insanity|mind_blast|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|mind_flay_mastery|shadow_word_death|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_pi_swi Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.66,3.94,3.24,1.71,1.66,1.33|4.63,3.91,3.21,1.68,1.63,1.29|4.69,3.97,3.27,1.74,1.69,1.36&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.66++Int,FFFFFF,0,0,15,0.1,e|t++++3.94++SP,FFFFFF,0,1,15,0.1,e|t++++3.24++Hit,FFFFFF,0,2,15,0.1,e|t++++1.71++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.66++Crit,FFFFFF,0,4,15,0.1,e|t++++1.33++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.599&chtt=Scale Factors|priest_90_pi_swi%20Damage%20Per%20Second&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6865443323211zyzzvvutrppoommlljiiihhgggihhgghhhgfffffffffggfccbbaZZZaaZZZZZabbcccddddddddedddddccddccdcccccdeeddeeefggfggggggggggfffffgggggffeedddeffffeddedddccdccdddeeedcbcdeefffffffggfggfffghhhggfffeeeefffffffffffeeeddccdddddddcccdddddddeeffgggghhiijjjjjjjjjjijihhgfeedccbaZZYYYYZaZaaaabccdddeefghhhiiiihhhhhhggfffffffgggfgghhhhijiijklmmmnnnooooooonnmnonnnmmmmllll&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5502,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=131516|max=239027&chxp=1,1,55,100&chtt=priest_90_pi_swi DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,0,24,8,24,24,56,112,176,256,272,368,560,744,1032,1328,1512,1840,1784,2136,2728,2472,2904,2896,2912,3208,2912,2728,2600,1992,1688,1712,1360,1368,1128,880,720,424,320,256,176,144,56,64,8,32,8,24&chds=0,3208&chbh=5&chxt=x&chxl=0:|min=121825|avg=131516|max=140043&chxp=0,1,53,100&chtt=priest_90_pi_swi DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:39.0,12.3,11.9,11.5,8.3,4.7,4.0,2.8,0.7,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 142.6s|vampiric_touch 45.0s|shadow_word_pain 43.7s|mind_blast 42.2s|shadow_word_insanity 30.5s|devouring_plague 17.3s|shadow_word_death 14.6s|halo 10.4s|shadowfiend 2.4s|waiting 1.2s&chtt=priest_90_pi_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi 131516
devouring_plague 5818 (16431) 4.4% (12.5%) 14.8 25.83sec 405255 347702 118199 244888 143483 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 14.84 0.00 0.00 1.1656 0.0000 2129209.93 2129209.93 0.00 347701.54 347701.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.88 80.04% 118198.92 107519 143944 118189.50 111091 125128 1403989 1403989 0.00
crit 2.96 19.96% 244888.08 221488 296525 235471.74 0 296525 725221 725221 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2548 1.9% 38.7 9.45sec 24083 0 19826 41142 24109 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.73 38.68 0.00 0.00 0.0000 0.0000 932604.08 932604.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.91 79.91% 19826.36 17856 23904 19826.02 18545 21247 612837 612837 0.00
crit 7.77 20.09% 41142.18 36784 49242 41128.40 0 49242 319767 319767 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8066 6.1% 14.8 25.83sec 198929 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.9 19635 40680 23824 19.9% 0.0% 25.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 14.84 123.91 123.91 0.0000 0.7402 2952031.85 2952031.85 0.00 32187.01 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.2 80.10% 19635.18 17856 23904 19633.35 18796 20517 1948709 1948709 0.00
crit 24.7 19.90% 40680.34 36784 49242 40677.15 37754 44567 1003323 1003323 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7111) 0.0% (5.4%) 9.0 42.61sec 289836 250841 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.1555 0.0000 0.00 0.00 0.00 250840.95 250840.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.18 80.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.80 19.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7111 5.4% 9.0 42.61sec 289836 0 119231 247230 144919 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 17.96 0.00 0.00 0.0000 0.0000 2602725.68 2602725.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.36 79.93% 119231.26 109581 139821 119228.08 110347 127754 1711645 1711645 0.00
crit 3.60 20.07% 247229.94 225736 288030 243052.51 0 288030 891080 891080 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 11939 100.0% 9.0 42.61sec 486592 0 41313 58264 45217 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.98 96.66 0.00 0.00 0.0000 0.0000 4369591.21 19209732.67 77.25 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.40 76.97% 41313.38 -0 184948 41218.81 0 116125 3073015 11852237 74.15
crit 22.26 23.03% 58263.89 0 380994 58326.37 0 229968 1296576 7357496 82.38
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11483 8.7% 36.4 10.07sec 115380 99526 95021 197031 115379 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.43 36.43 0.00 0.00 1.1593 0.0000 4202778.63 4202778.63 0.00 99525.87 99525.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.16 80.04% 95020.76 86183 115909 95017.80 91372 98542 2770409 2770409 0.00
crit 7.27 19.96% 197030.64 177536 238773 197032.47 0 227911 1432370 1432370 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15955 (20953) 12.1% (15.9%) 87.8 4.06sec 87372 53760 0 0 0 0.0% 0.0% 0.0% 0.0% 188.3 25509 52948 31012 20.1% 0.0% 35.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.77 87.77 188.29 188.29 1.6252 0.6933 5839356.18 5839356.18 0.00 53760.36 53760.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 150.5 79.94% 25509.33 22887 30640 25509.53 24819 26216 3839791 3839791 0.00
crit 37.8 20.06% 52948.12 47146 63119 52950.27 49888 56500 1999565 1999565 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4998 3.8% 59.0 5.92sec 31022 0 25519 52963 31045 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.97 58.92 0.00 0.00 0.0000 0.0000 1829290.42 1829290.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.06 79.86% 25519.31 22887 30640 25519.94 24148 27047 1200904 1200904 0.00
crit 11.86 20.14% 52963.21 47146 63119 52970.92 47146 63119 628387 628387 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.0 121.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 4036 3.1% 12.5 4.86sec 117833 100900 96421 200549 117833 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.54 12.54 0.00 0.00 1.1679 0.0000 1477069.63 1477069.63 0.00 100899.63 100899.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.96 79.44% 96420.73 83662 112752 96428.97 87466 104649 960115 960115 0.00
crit 2.58 20.56% 200548.56 172343 232270 190030.78 0 232270 516955 516955 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 14050 10.7% 26.3 12.24sec 195770 168440 161720 334914 195768 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.27 26.27 0.00 0.00 1.1623 0.0000 5142463.91 5142463.91 0.00 168439.70 168439.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.10 80.34% 161720.28 148247 199962 161709.05 153970 170863 3412895 3412895 0.00
crit 5.16 19.66% 334914.28 305389 411923 333229.34 0 411923 1729569 1729569 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18390 (24144) 14.0% (18.4%) 37.9 9.66sec 232863 202046 0 0 0 0.0% 0.0% 0.0% 0.0% 345.7 14747 30508 19471 30.0% 0.0% 180.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.95 37.95 345.68 345.68 1.1525 1.9127 6730615.71 6730615.71 0.00 12535.79 202046.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 242.1 70.03% 14747.27 13422 17966 14747.32 14355 15162 3570072 3570072 0.00
crit 103.6 29.97% 30508.22 27649 37009 30507.78 29495 31514 3160544 3160544 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5754 4.4% 108.0 3.35sec 19503 0 14787 30613 19525 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.99 107.86 0.00 0.00 0.0000 0.0000 2106073.65 2106073.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.57 70.06% 14787.36 13422 17966 14787.30 14195 15424 1117505 1117505 0.00
crit 32.29 29.94% 30613.50 27649 37009 30613.34 28839 32604 988568 988568 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2137 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5569 4.2% 94.0 3.86sec 21691 0 18439 37113 22160 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.96 91.97 0.00 0.00 0.0000 0.0000 2038088.53 2038088.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.64 80.07% 18439.16 16669 22484 18439.18 17893 19037 1357920 1357920 0.00
crit 18.33 19.93% 37113.05 33338 44968 37117.10 34357 41114 680169 680169 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 18121 (23788) 13.8% (18.1%) 39.0 9.34sec 223476 193669 0 0 0 0.0% 0.0% 0.0% 0.0% 328.6 16617 34474 20182 20.0% 0.0% 193.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.96 38.96 328.61 328.61 1.1539 2.1496 6632180.40 6632180.40 0.00 11587.73 193669.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 263.0 80.03% 16617.05 15001 20366 16617.00 16176 17075 4370279 4370279 0.00
crit 65.6 19.97% 34474.35 30902 41955 34473.52 32867 36097 2261901 2261901 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5667 4.3% 102.9 3.47sec 20165 0 16615 34463 20180 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.86 102.79 0.00 0.00 0.0000 0.0000 2074216.50 2074216.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.26 80.03% 16614.97 15001 20366 16615.13 15950 17358 1366701 1366701 0.00
crit 20.53 19.97% 34463.48 30902 41955 34461.17 31656 38494 707516 707516 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51832 / 3951
melee 51832 3.0% 27.0 14.60sec 53616 54664 49565 100410 53616 20.8% 7.3% 23.8% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.97 26.97 0.00 0.00 0.9808 0.0000 1446196.43 1446196.43 0.00 54664.21 54664.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.36 45.81% 49564.61 38145 58728 49560.81 43558 55625 612443 612443 0.00
crit 5.60 20.77% 100410.06 76291 117456 100251.42 0 117456 562497 562497 0.00
glance 6.43 23.84% 37332.86 28609 44046 37340.40 28609 44046 240116 240116 0.00
block 0.62 2.31% 49936.23 38145 58728 23273.49 0 58728 31141 31141 0.00
parry 1.96 7.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1453 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.42%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.7sec 107.7sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.59%
jade_serpent_potion 1.0 0.0 336.1sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.2 7.8 36.0sec 19.7sec 44.79% 45.40%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.79%

    Trigger Attempt Success

    • trigger_pct:1.66%
light_of_the_cosmos 8.0 0.0 47.9sec 47.9sec 43.55% 43.55%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.55%

    Trigger Attempt Success

    • trigger_pct:14.51%
power_infusion 4.0 0.0 121.0sec 121.2sec 17.20% 19.44%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.3 0.0 10.2sec 10.2sec 9.94% 49.38%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.94%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
vampiric_embrace 1.0 0.0 0.0sec 0.0sec 3.88% 3.99%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.88%

Trigger Attempt Success

  • trigger_pct:95.20%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.58% 80.26%

Buff details

  • buff initial source:priest_90_pi_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi
devouring_plague Shadow Orb 14.8 44.5 3.0 3.0 135084.8
halo Mana 9.0 341928.9 38076.7 38076.7 7.6
mind_blast Mana 36.4 316773.5 8696.5 8696.4 13.3
mind_flay Mana 87.8 249966.5 2847.9 2848.0 30.7
shadow_word_death Mana 12.5 96670.3 7711.6 7711.9 15.3
shadow_word_insanity Mana 26.3 190767.4 7262.7 7262.4 27.0
shadow_word_pain Mana 37.9 482804.0 12722.8 12722.8 18.3
vampiric_touch Mana 39.0 338072.5 8677.6 8677.6 25.8
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 25.01 110800.06 (5.50%) 4429.56 114323.78 50.78%
Shadow Orbs from Mind Blast Shadow Orb 36.43 36.43 (85.16%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.35 6.35 (14.84%) 1.00 0.00 0.00%
Devouring Plague Health Health 162.59 1613320.35 (77.19%) 9922.42 644551.34 28.55%
Vampiric Touch Mana Mana 431.40 1582561.72 (78.54%) 3668.45 697465.64 30.59%
mp5_regen Mana 1463.00 321519.07 (15.96%) 219.77 117380.93 26.74%
vampiric_embrace Health 66.79 476728.88 (22.81%) 7137.74 451815.39 48.66%
pet - shadowfiend
vampiric_embrace Health 0.04 416.00 (100.00%) 10878.63 168.41 28.82%
Resource RPS-Gain RPS-Loss
Health 14186.45 14867.22
Mana 5505.14 5510.88
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 213727.16 -142803.02 462887.00
Mana 297898.00 260700.00 300000.00
Shadow Orb 1.25 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 27.0%
shadowfiend-Mana Cap 27.0%
lightwell-Mana Cap 27.0%

Procs

Count Interval
Shadowy Recall Extra Tick 308.3 1.2sec
Shadowy Apparition Procced 94.0 3.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_pi_swi Damage Per Second
Count 49992
Mean 131516.12
Minimum 121825.15
Maximum 140043.31
Spread ( max - min ) 18218.16
Range [ ( max - min ) / 2 * 100% ] 6.93%
Standard Deviation 2430.5034
5th Percentile 127608.42
95th Percentile 135574.74
( 95th Percentile - 5th Percentile ) 7966.31
Mean Distribution
Standard Deviation 10.8704
95.00% Confidence Intervall ( 131494.82 - 131537.43 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1311
0.1 Scale Factor Error with Delta=300 50428
0.05 Scale Factor Error with Delta=300 201714
0.01 Scale Factor Error with Delta=300 5042850
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131516.12
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46688705.08
Distribution Chart

DTPS

Sample Data priest_90_pi_swi Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_pi_swi Healing Per Second
Count 49992
Mean 11938.77
Minimum 0.00
Maximum 34920.02
Spread ( max - min ) 34920.02
Range [ ( max - min ) / 2 * 100% ] 146.25%
Standard Deviation 6693.5219
5th Percentile 3228.70
95th Percentile 25386.21
( 95th Percentile - 5th Percentile ) 22157.51
Mean Distribution
Standard Deviation 29.9367
95.00% Confidence Intervall ( 11880.10 - 11997.45 )
Normalized 95.00% Confidence Intervall ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12074
0.1% Error 1207497
0.1 Scale Factor Error with Delta=300 382466
0.05 Scale Factor Error with Delta=300 1529864
0.01 Scale Factor Error with Delta=300 38246618
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 11938.77
Distribution Chart

Heal

Sample Data
Count 49992
Mean 4369591.21
Distribution Chart

HTPS

Sample Data priest_90_pi_swi Healing taken Per Second
Count 49992
Mean 8475.71
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 243.49
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.00 power_infusion,if=talent.power_infusion.enabled
D 4.31 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.54 shadow_word_death,if=active_enemies<=5
F 38.03 mind_blast,if=active_enemies<=6&cooldown_react
G 37.95 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 41.26 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 26.27 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.95 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 8.98 halo,if=talent.halo.enabled
M 10.53 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.12 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.33 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 48.23 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGGHHLTFTFHIGGHMTQFTFHTIGGHHFLMTHQFTIGGFHTHFTIGIGFHMLTTHQFTIGIGFHTHFTIGICGFHMTLTFHTIGTHGFTHTFMTHGTIFGTHTLFTHIGTBFGMTHTFHIGTIFGHTFHIGLMTIFGTHTTFHIGTICFGHKMTFHIGTLTFHIGTHFTIGTFHIGMTTHFTIGTFHIGLEDEFHIGTEEFHIGMTEEFHIGT9TEDEFHIGLTEEFGHMTHEEFBCGT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl : 131641 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131640.6 131640.6 22.04 / 0.02% 4115 / 3.1% 25.6 7267.9 7267.9 38.13 / 0.52% 6861 / 94.4% 1.5 4983.2 4968.7 Mana 0.46% 43.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.16 0.00 3.97 3.16 1.10 1.24 1.48
Normalized 1.00 0.00 0.95 0.76 0.26 0.30 0.35
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Haste > Crit
Pawn string
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=4.16, SpellDamage=3.97, HitRating=3.16, CritRating=1.10, HasteRating=1.24, MasteryRating=1.48 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=4.16, SpellDamage=3.97, HitRating=0.00, CritRating=1.10, HasteRating=1.24, MasteryRating=1.48 )

Charts

http://1.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:354658|253681|224192|191154|114959|100706|84197|50712&chds=0,709315&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++354658++devouring_plague,9482C9,0,0,15|t++253681++halo,9482C9,1,0,15|t++224192++shadow_word_pain,9482C9,2,0,15|t++191154++vampiric_touch,9482C9,3,0,15|t++114959++shadow_word_death,9482C9,4,0,15|t++100706++mind_blast,9482C9,5,0,15|t++84197++mind_spike,4A79D3,6,0,15|t++50712++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,14,12,10,9,7,6,5,5,5,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.16,3.97,3.16,1.48,1.24,1.10|4.13,3.94,3.13,1.44,1.21,1.07|4.20,4.00,3.20,1.51,1.27,1.13&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.16++Int,FFFFFF,0,0,15,0.1,e|t++++3.97++SP,FFFFFF,0,1,15,0.1,e|t++++3.16++Hit,FFFFFF,0,2,15,0.1,e|t++++1.48++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.24++Haste,FFFFFF,0,4,15,0.1,e|t++++1.10++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.006&chtt=Scale Factors|priest_90_tof_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:58654332223231112zyxvurrrqqqqpomlkkiijkklklllmmlkkjjkkkklljhgggggfeeeffggggfffghgghgffeeddeeeeeffgggfgggffffgghggffffffgghhhhhiiiiiiiiiiihhhgfeddcdeeeeffgggggghhggggghgggfeeffgghhijjlkkkjjjjjjkkjihhggffeeeefghhiiijjiiihhhhgggggffeeeeeeefffgggggghhhhiijjiiiiiiihhhhhhhhhgffeedccbbbbbbcccddeffgijjkmmnooppqqpqrrrrqqpooooooooooooqqqqrrrstvwwxxyyzz0011110001100zzzzzyyyy&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6145,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=131641|max=214209&chxp=1,1,61,100&chtt=priest_90_tof_fdcl DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,32,8,24,48,88,96,208,200,288,296,504,536,784,976,1272,1440,1808,1808,2096,2168,2272,2912,2904,2832,2936,2448,2624,2400,2136,1952,1568,1480,1264,1240,880,928,640,464,416,256,248,144,128,64,56,32,48,32&chds=0,2936&chbh=5&chxt=x&chxl=0:|min=122669|avg=131641|max=139979&chxp=0,1,52,100&chtt=priest_90_tof_fdcl DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.4,17.7,12.7,12.2,11.4,5.1,4.1,2.9,0.7,0.5&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 107.6s|mind_spike 64.8s|mind_blast 46.6s|vampiric_touch 44.7s|shadow_word_pain 41.9s|devouring_plague 18.8s|shadow_word_death 14.9s|halo 10.7s|shadowfiend 2.5s|waiting 1.7s&chtt=priest_90_tof_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl 131641
devouring_plague 6507 (18249) 4.9% (13.9%) 15.8 24.31sec 422371 354658 123981 257025 150589 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 15.81 0.00 0.00 1.1909 0.0000 2381380.22 2381380.22 0.00 354657.64 354657.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.65 80.00% 123980.57 107519 165536 123968.28 113516 135749 1568468 1568468 0.00
crit 3.16 20.00% 257024.84 221488 341004 249597.35 0 341004 812912 812912 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2804 2.1% 40.9 8.93sec 25109 0 20664 42892 25130 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.87 40.84 0.00 0.00 0.0000 0.0000 1026265.18 1026265.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.63 79.91% 20663.66 17856 27490 20662.55 19264 22412 674285 674285 0.00
crit 8.21 20.09% 42891.77 36784 56629 42877.06 0 53728 351980 351980 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8939 6.8% 15.8 24.31sec 206885 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.8 20594 42695 25018 20.0% 0.0% 26.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 15.81 130.77 130.77 0.0000 0.7542 3271621.96 3271621.96 0.00 33170.32 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.6 79.98% 20594.29 17856 27490 20593.35 19700 21569 2154008 2154008 0.00
crit 26.2 20.02% 42694.64 36784 56629 42686.47 38899 46981 1117614 1117614 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7391) 0.0% (5.6%) 9.0 42.65sec 300652 253681 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1852 0.0000 0.00 0.00 0.00 253680.99 253680.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 80.17% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.78 19.83% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7391 5.6% 9.0 42.65sec 300652 0 123590 257232 150323 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 17.99 0.00 0.00 0.0000 0.0000 2705000.44 2705000.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.39 79.99% 123589.82 109581 160794 123581.02 113214 134195 1779013 1779013 0.00
crit 3.60 20.01% 257232.47 225736 331235 252386.05 0 331235 925988 925988 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 7268 100.0% 9.0 42.65sec 295656 0 26291 34387 28171 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 94.42 0.00 0.00 0.0000 0.0000 2660055.77 19440650.19 86.32 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.50 76.78% 26291.45 -0 212691 26225.48 0 109501 1906127 11940495 84.08
crit 21.92 23.22% 34387.37 0 438143 34431.44 0 202357 753928 7500155 89.96
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12833 9.7% 39.5 9.29sec 119053 100706 97958 203169 119053 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.45 39.45 0.00 0.00 1.1822 0.0000 4697015.33 4697015.33 0.00 100705.72 100705.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.54 79.95% 97958.30 86183 133296 97958.39 93815 102330 3089861 3089861 0.00
crit 7.91 20.05% 203169.15 177536 274589 203276.93 177536 274589 1607154 1607154 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 11350 (14902) 8.6% (11.3%) 65.1 5.38sec 83750 50712 0 0 0 0.0% 0.0% 0.0% 0.0% 132.9 25718 53346 31248 20.0% 0.0% 26.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.12 65.12 132.94 132.94 1.6515 0.7284 4153966.31 4153966.31 0.00 50711.68 50711.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.3 79.98% 25717.98 22887 35236 25717.59 24707 26836 2734538 2734538 0.00
crit 26.6 20.02% 53346.12 47146 72586 53342.83 49243 58539 1419429 1419429 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3552 2.7% 41.6 8.19sec 31250 0 25734 53331 31251 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.60 41.60 0.00 0.00 0.0000 0.0000 1300125.92 1300125.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.29 80.01% 25734.26 22887 35236 25732.91 23715 27615 856585 856585 0.00
crit 8.32 19.99% 53331.37 47146 72586 53306.24 0 65181 443541 443541 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 14903 11.3% 55.0 6.37sec 99224 84197 81703 169395 99224 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.97 54.97 0.00 0.00 1.1785 0.0000 5454591.84 5454591.84 0.00 84196.59 84196.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.99 80.02% 81702.59 72412 112341 81704.53 76988 86326 3594034 3594034 0.00
crit 10.98 19.98% 169395.19 149169 231423 169389.39 149169 199825 1860558 1860558 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4668 3.5% 12.6 4.86sec 135491 114959 110913 230687 135494 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.61 12.61 0.00 0.00 1.1786 0.0000 1708632.54 1708632.54 0.00 114958.79 114958.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.02 79.48% 110912.82 83662 129665 110922.04 100392 121983 1111672 1111672 0.00
crit 2.59 20.52% 230687.46 172343 267111 219217.28 0 267111 596960 596960 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19531 (25660) 14.8% (19.5%) 35.5 10.42sec 264490 224192 0 0 0 0.0% 0.0% 0.0% 0.0% 357.6 15149 31353 19992 29.9% 0.0% 196.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.51 35.51 357.57 357.57 1.1798 2.0107 7148452.57 7148452.57 0.00 12343.44 224191.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.51 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 250.7 70.12% 15148.93 13422 20660 15149.24 14639 15672 3798058 3798058 0.00
crit 106.9 29.88% 31352.93 27649 42560 31351.55 30001 32862 3350395 3350395 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6129 4.7% 111.9 3.23sec 20041 0 15196 31487 20070 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.93 111.77 0.00 0.00 0.0000 0.0000 2243165.19 2243165.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.33 70.08% 15195.91 13422 20660 15195.81 14444 15944 1190259 1190259 0.00
crit 33.44 29.92% 31487.08 27649 42560 31485.58 29392 34012 1052906 1052906 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2261 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5776 4.4% 95.1 3.81sec 22229 0 18927 38131 22754 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.09 92.90 0.00 0.00 0.0000 0.0000 2113866.73 2113866.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.38 80.07% 18926.53 16669 25856 18926.17 18233 19603 1407843 1407843 0.00
crit 18.52 19.93% 38130.97 33338 51713 38131.29 34539 42377 706023 706023 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17754 (23341) 13.5% (17.7%) 38.0 9.42sec 224844 191154 0 0 0 0.0% 0.0% 0.0% 0.0% 315.6 16963 35181 20590 19.9% 0.0% 191.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.99 37.99 315.60 315.60 1.1763 2.2194 6498066.75 6498066.75 0.00 11464.89 191154.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 252.8 80.09% 16962.50 15001 23421 16962.52 16470 17709 4287573 4287573 0.00
crit 62.8 19.91% 35181.27 30902 48248 35181.38 33450 37449 2210494 2210494 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5587 4.2% 98.8 3.61sec 20700 0 17084 35454 20725 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.78 98.66 0.00 0.00 0.0000 0.0000 2044801.01 2044801.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.11 80.18% 17083.85 15001 23421 17083.64 16238 18012 1351450 1351450 0.00
crit 19.56 19.82% 35453.97 30902 48248 35457.56 32133 39704 693351 693351 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51515 / 3917
melee 51515 3.0% 26.9 14.66sec 53347 54262 49361 99859 53347 20.6% 7.1% 24.1% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.87 26.87 0.00 0.00 0.9832 0.0000 1433494.34 1433494.34 0.00 54262.03 54262.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.34 45.91% 49360.52 38145 58728 49353.61 43951 55437 608975 608975 0.00
crit 5.53 20.59% 99859.01 76291 117456 99660.09 0 117456 552416 552416 0.00
glance 6.47 24.08% 37191.54 28609 44046 37159.05 0 44046 240664 240664 0.00
block 0.63 2.36% 49511.51 38145 58728 23424.97 0 58728 31439 31439 0.00
parry 1.90 7.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1883 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.37%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.7sec 107.7sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.78%
glyph_mind_spike 31.1 23.9 11.4sec 6.4sec 51.51% 76.08%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.93%
  • glyph_mind_spike_2:19.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 336.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.4 36.3sec 20.3sec 43.83% 44.10%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.83%

    Trigger Attempt Success

    • trigger_pct:1.64%
light_of_the_cosmos 8.0 0.0 48.0sec 48.0sec 43.46% 43.46%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.46%

    Trigger Attempt Success

    • trigger_pct:14.58%
shadow_word_death_reset_cooldown 6.4 0.0 10.2sec 10.2sec 9.95% 49.16%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.95%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 36.3 25.8 9.8sec 5.7sec 44.87% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.90%
  • surge_of_darkness_2:10.97%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.1 124.1 25.0sec 0.6sec 20.26% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:20.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 1.0 0.0 196.4sec 196.4sec 3.93% 4.07%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.93%

Trigger Attempt Success

  • trigger_pct:95.86%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.55% 80.48%

Buff details

  • buff initial source:priest_90_tof_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl
devouring_plague Shadow Orb 15.8 47.4 3.0 3.0 140790.2
halo Mana 9.0 364383.4 40500.0 40500.0 7.4
mind_blast Mana 39.5 355076.6 9000.0 9000.0 13.2
mind_flay Mana 65.1 195369.6 3000.0 3000.0 27.9
shadow_word_death Mana 12.6 98366.1 7800.0 7800.2 17.4
shadow_word_pain Mana 35.5 468709.8 13200.0 13200.0 20.0
vampiric_touch Mana 38.0 341952.5 9000.0 9000.0 25.0
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.97 110259.22 (6.06%) 4414.80 114514.70 50.95%
Shadow Orbs from Mind Blast Shadow Orb 39.45 39.45 (86.02%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.41 6.41 (13.98%) 1.00 0.00 0.00%
Devouring Plague Health Health 171.61 1693140.31 (76.59%) 9866.37 689901.95 28.95%
Vampiric Touch Mana Mana 414.26 1408017.07 (77.43%) 3398.85 781570.13 35.69%
mp5_regen Mana 1463.00 300254.40 (16.51%) 205.23 138645.60 31.59%
vampiric_embrace Health 65.63 517418.54 (23.41%) 7883.92 462757.63 47.21%
pet - shadowfiend
vampiric_embrace Health 0.03 209.62 (100.00%) 7278.40 201.39 49.00%
Resource RPS-Gain RPS-Loss
Health 14197.64 14867.22
Mana 4968.66 4983.22
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 217818.72 -120850.49 462887.00
Mana 294672.01 250500.00 300000.00
Shadow Orb 1.43 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 31.8%
shadowfiend-Mana Cap 31.8%
lightwell-Mana Cap 31.8%

Procs

Count Interval
Shadowy Recall Extra Tick 292.9 1.2sec
Shadowy Apparition Procced 95.1 3.8sec
FDCL Mind Spike proc 62.1 5.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl Damage Per Second
Count 49992
Mean 131640.56
Minimum 122668.67
Maximum 139978.74
Spread ( max - min ) 17310.07
Range [ ( max - min ) / 2 * 100% ] 6.57%
Standard Deviation 2514.4770
5th Percentile 127601.17
95th Percentile 135831.69
( 95th Percentile - 5th Percentile ) 8230.52
Mean Distribution
Standard Deviation 11.2460
95.00% Confidence Intervall ( 131618.52 - 131662.61 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1401
0.1 Scale Factor Error with Delta=300 53973
0.05 Scale Factor Error with Delta=300 215893
0.01 Scale Factor Error with Delta=300 5397330
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131640.56
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46746951.98
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl Healing Per Second
Count 49992
Mean 7267.91
Minimum 0.00
Maximum 30604.37
Spread ( max - min ) 30604.37
Range [ ( max - min ) / 2 * 100% ] 210.54%
Standard Deviation 4350.1834
5th Percentile 1655.85
95th Percentile 15378.40
( 95th Percentile - 5th Percentile ) 13722.55
Mean Distribution
Standard Deviation 19.4562
95.00% Confidence Intervall ( 7229.78 - 7306.05 )
Normalized 95.00% Confidence Intervall ( 99.48% - 100.52% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13762
0.1% Error 1376233
0.1 Scale Factor Error with Delta=300 161546
0.05 Scale Factor Error with Delta=300 646187
0.01 Scale Factor Error with Delta=300 16154696
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 7267.91
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2660055.77
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl Healing taken Per Second
Count 49992
Mean 8157.96
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 262.98
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.93 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.61 shadow_word_death,if=active_enemies<=5
F 40.23 mind_blast,if=active_enemies<=6&cooldown_react
G 35.51 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 39.54 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 15.60 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.96 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.89 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.12 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.78 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 39.37 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 42.46 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFTQFMGGHHTFTRFTHGGHFHLMRRRTFHRTGGFHJRTFHJMRTJFGGHJLQFRTHRTQFMRHGGJFRTHHQFRTRTRHJFGGLMHJFJRTHFTGGRFHMRTRTFHTJRTFGGHLTFBHMRTFTGGHRTFHTRTRQFMRRGGHFLTHRTRFRTTHFGGHJMRQFTRTFHJRTGGFHLMRTQFTHJRTFGGHRTFRTHJRQFKMRTHGGFJLEEHTFMRPEEHJFGGRPEDEHFTRT9TEEFHJGGDEEFHLTEDEFBHGG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb : 128314 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
128313.7 128313.7 20.43 / 0.02% 3846 / 3.0% 23.1 7608.1 7608.1 40.49 / 0.53% 7509 / 98.7% 1.5 5160.8 5135.2 Mana 0.37% 35.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.11 0.00 3.84 2.61 1.13 1.41 1.56
Normalized 1.00 0.00 0.93 0.63 0.27 0.34 0.38
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Haste > Crit
Pawn string
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=4.11, SpellDamage=3.84, HitRating=2.61, CritRating=1.13, HasteRating=1.41, MasteryRating=1.56 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=4.11, SpellDamage=3.84, HitRating=0.00, CritRating=1.13, HasteRating=1.41, MasteryRating=1.56 )

Charts

http://8.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:358074|254048|225484|190291|115415|100477|51597&chds=0,716149&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++358074++devouring_plague,9482C9,0,0,15|t++254048++halo,9482C9,1,0,15|t++225484++shadow_word_pain,9482C9,2,0,15|t++190291++vampiric_touch,9482C9,3,0,15|t++115415++shadow_word_death,9482C9,4,0,15|t++100477++mind_blast,9482C9,5,0,15|t++51597++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,15,15,10,8,7,6,5,5,5,5,5,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|vampiric_touch|mind_blast|mindbender: melee|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|shadowy_apparition|mind_flay_mastery|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_tof_mb Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.11,3.84,2.61,1.56,1.41,1.13|4.08,3.81,2.58,1.53,1.38,1.10|4.14,3.87,2.64,1.59,1.43,1.15&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.11++Int,FFFFFF,0,0,15,0.1,e|t++++3.84++SP,FFFFFF,0,1,15,0.1,e|t++++2.61++Hit,FFFFFF,0,2,15,0.1,e|t++++1.56++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.41++Haste,FFFFFF,0,4,15,0.1,e|t++++1.13++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.938&chtt=Scale Factors|priest_90_tof_mb%20Damage%20Per%20Second&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:36678665536564555200zyvutrrqqqqmmkkihhkmlllllmmlkjjiijjjlmnkjjjjjjjiiiijjjiiiiiihjiihhgggfggggggggffdeddccdddefffghijjjlmnooooonmnmmlllkjjiihfeddddefffgggggggggggggghggggfeeeefffgghijjiiiiiiijkkkkjjjiiihgggghhiiijjjiihhgggfggffeddcccccdefghjjkkllmnoqqqqqqqpponmkkjiihggfedddccbbbbbbccccccdeeghhijlnopqrstutuvwxxxvuuuutsrrqqppprsrrssssuvwxxyz00111222200z0zyxwwvvvutts&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6331,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=128314|max=202680&chxp=1,1,63,100&chtt=priest_90_tof_mb DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,16,40,40,80,128,176,296,248,376,448,824,904,1256,1256,1408,1816,2064,2384,2440,2504,2784,2448,2816,2680,2624,2704,2384,1944,1840,1760,1336,1288,1088,760,688,592,368,304,280,200,96,136,48,64,0,16,8,8&chds=0,2816&chbh=5&chxt=x&chxl=0:|min=120396|avg=128314|max=136622&chxp=0,1,49,100&chtt=priest_90_tof_mb DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.8,12.2,11.5,11.4,4.7,3.9,2.9,1.9,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 171.1s|vampiric_touch 44.6s|mind_blast 42.1s|shadow_word_pain 41.7s|devouring_plague 17.1s|shadow_word_death 14.4s|halo 10.7s|mindbender 7.0s|waiting 1.4s&chtt=priest_90_tof_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb 128314
devouring_plague 5945 (16775) 4.6% (13.1%) 14.5 26.84sec 424849 358074 124157 257062 150574 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.45 14.45 0.00 0.00 1.1865 0.0000 2175949.54 2175949.54 0.00 358074.37 358074.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.58 80.12% 124157.43 107519 165536 124135.27 112071 134074 1437604 1437604 0.00
crit 2.87 19.88% 257061.78 221488 341004 246222.85 0 341004 738345 738345 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2598 2.0% 37.7 9.64sec 25209 0 20710 42934 25230 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.73 37.70 0.00 0.00 0.0000 0.0000 951042.74 951042.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.03 79.66% 20709.88 17856 27490 20707.52 19136 22575 621899 621899 0.00
crit 7.67 20.34% 42934.45 36784 56629 42921.15 0 55503 329144 329144 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8231 6.4% 14.5 26.84sec 208465 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.3 20626 42744 25049 20.0% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.45 14.45 120.27 120.27 0.0000 0.7492 3012550.88 3012550.88 0.00 33432.30 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.2 80.00% 20625.86 17856 27490 20624.27 19637 21827 1984534 1984534 0.00
crit 24.1 20.00% 42743.60 36784 56629 42736.19 39186 47620 1028016 1028016 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7408) 0.0% (5.8%) 9.0 42.45sec 301244 254048 0 0 0 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1859 0.0000 0.00 0.00 0.00 254047.58 254047.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.17 79.69% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.83 20.31% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7408 5.8% 9.0 42.45sec 301244 0 123872 257533 150622 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 18.00 0.00 0.00 0.0000 0.0000 2711195.78 2711195.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.40 79.99% 123872.25 109581 160794 123863.71 114408 134527 1783478 1783478 0.00
crit 3.60 20.01% 257532.75 225736 331235 253310.26 0 331235 927718 927718 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 7608 100.0% 9.0 42.45sec 309397 0 26883 38008 29474 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 94.47 0.00 0.00 0.0000 0.0000 2784575.12 19500278.32 85.72 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.47 76.71% 26882.94 0 212691 26848.18 0 106418 1948302 11959281 83.74
crit 22.00 23.29% 38007.76 -0 438143 37818.99 0 187790 836273 7540998 89.01
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11565 9.0% 35.6 10.27sec 118747 100477 97683 202683 118747 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.65 35.65 0.00 0.00 1.1819 0.0000 4232897.00 4232897.00 0.00 100477.05 100477.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.50 79.94% 97682.65 86183 133296 97678.73 93287 102596 2783496 2783496 0.00
crit 7.15 20.06% 202682.86 177536 274589 202685.97 177536 262097 1449401 1449401 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18378 (24126) 14.3% (18.8%) 99.8 3.56sec 88476 51597 0 0 0 0.0% 0.0% 0.0% 0.0% 215.1 25743 53394 31267 20.0% 0.0% 43.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.80 99.80 215.13 215.13 1.7148 0.7350 6726483.82 6726483.82 0.00 51596.61 51596.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.2 80.02% 25742.56 22887 35236 25742.47 24936 26577 4431626 4431626 0.00
crit 43.0 19.98% 53393.62 47146 72586 53393.70 50289 56861 2294858 2294858 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5748 4.5% 67.2 5.22sec 31297 0 25747 53410 31299 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.22 67.21 0.00 0.00 0.0000 0.0000 2103656.07 2103656.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.72 79.93% 25747.26 22887 35236 25747.78 24450 27492 1383202 1383202 0.00
crit 13.49 20.07% 53409.72 47146 72586 53413.53 47146 60485 720454 720454 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 5.8 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.82 5.82 0.00 0.00 1.1960 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4553 3.5% 12.3 4.84sec 135847 115415 111066 230933 135847 20.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.27 12.27 0.00 0.00 1.1770 0.0000 1666244.98 1666244.98 0.00 115414.90 115414.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.73 79.33% 111065.90 95083 129665 111054.82 100274 120775 1080659 1080659 0.00
crit 2.54 20.67% 230933.12 195872 267111 217987.06 0 267111 585586 585586 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19565 (25701) 15.2% (20.0%) 35.4 10.43sec 265677 225484 0 0 0 0.0% 0.0% 0.0% 0.0% 357.7 15159 31383 20017 29.9% 0.0% 196.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.41 35.41 357.74 357.74 1.1783 2.0092 7160824.27 7160824.27 0.00 12369.22 225483.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 250.6 70.06% 15159.48 13422 20660 15159.68 14643 15627 3799447 3799447 0.00
crit 107.1 29.94% 31383.25 27649 42560 31381.81 29897 32770 3361377 3361377 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6136 4.8% 112.0 3.23sec 20060 0 15206 31486 20082 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.96 111.84 0.00 0.00 0.0000 0.0000 2245914.72 2245914.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.35 70.05% 15205.75 13422 20660 15206.10 14527 16093 1191310 1191310 0.00
crit 33.49 29.95% 31486.46 27649 42560 31487.72 29388 34575 1054605 1054605 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5770 4.5% 95.0 3.82sec 22220 0 18935 38140 22749 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.04 92.83 0.00 0.00 0.0000 0.0000 2111907.28 2111907.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.40 80.14% 18935.02 16669 25856 18934.59 18170 19582 1408722 1408722 0.00
crit 18.44 19.86% 38140.18 33338 51713 38140.78 34307 43443 703185 703185 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17652 (23207) 13.8% (18.1%) 37.9 9.49sec 224123 190291 0 0 0 0.0% 0.0% 0.0% 0.0% 313.6 16966 35200 20602 19.9% 0.0% 190.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.90 37.90 313.60 313.60 1.1778 2.2240 6460644.92 6460644.92 0.00 11445.77 190291.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 251.1 80.06% 16966.46 15001 23421 16966.75 16450 17511 4259964 4259964 0.00
crit 62.5 19.94% 35200.35 30902 48248 35199.30 33257 37661 2200681 2200681 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5555 4.3% 98.0 3.64sec 20747 0 17094 35484 20771 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.99 97.88 0.00 0.00 0.0000 0.0000 2032994.27 2032994.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.31 80.01% 17094.43 15001 23421 17095.19 16297 17897 1338621 1338621 0.00
crit 19.57 19.99% 35484.05 30902 48248 35482.26 32282 40669 694373 694373 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37062 / 9209
melee 37062 7.2% 81.3 4.25sec 41465 39559 38640 77955 41465 20.3% 7.4% 24.0% 2.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.29 81.29 0.00 0.00 1.0482 0.0000 3370495.79 3370495.79 0.00 39559.35 39559.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.30 45.88% 38640.23 30516 46982 38638.32 36016 40890 1441159 1441159 0.00
crit 16.51 20.31% 77954.62 61032 93964 77953.48 70176 89515 1287225 1287225 0.00
glance 19.51 24.00% 29071.44 22887 35237 29068.91 26169 31573 567222 567222 0.00
block 1.94 2.38% 38682.69 30516 46982 33297.31 0 46982 74889 74889 0.00
parry 6.03 7.42% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.8 20.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.82 18.82 0.00 0.00 1.1892 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.63%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.8sec 107.8sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.94%
jade_serpent_potion 1.0 0.0 336.1sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.1 7.4 36.4sec 20.3sec 43.70% 44.04%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.70%

    Trigger Attempt Success

    • trigger_pct:1.62%
light_of_the_cosmos 8.0 0.0 47.8sec 47.8sec 43.54% 43.54%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.54%

    Trigger Attempt Success

    • trigger_pct:14.35%
shadow_word_death_reset_cooldown 6.2 0.0 10.2sec 10.2sec 9.88% 49.25%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.88%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
twist_of_fate 1.2 124.4 29.7sec 0.6sec 20.44% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:20.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.9 0.0 195.4sec 195.4sec 3.89% 4.10%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.89%

Trigger Attempt Success

  • trigger_pct:94.94%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.8 0.0 20.0sec 20.0sec 85.42% 84.14%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.20% 2.20%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.20%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb
devouring_plague Shadow Orb 14.5 43.4 3.0 3.0 141617.1
halo Mana 9.0 364500.0 40500.0 40500.0 7.4
mind_blast Mana 35.6 320814.7 9000.0 8999.9 13.2
mind_flay Mana 99.8 299407.7 3000.0 3000.0 29.5
shadow_word_death Mana 12.3 95674.2 7800.0 7800.2 17.4
shadow_word_pain Mana 35.4 467368.7 13200.0 13200.0 20.1
vampiric_touch Mana 37.9 341075.5 9000.0 9000.0 24.9
Resource Gains Type Count Total Average Overflow
mindbender Mana 75.26 183067.02 (9.74%) 2432.58 146627.34 44.47%
Shadow Orbs from Mind Blast Shadow Orb 35.65 35.65 (85.12%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.23 6.23 (14.88%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.96 1532530.50 (74.60%) 9702.03 660996.19 30.13%
Vampiric Touch Mana Mana 411.47 1398271.39 (74.40%) 3398.21 776944.61 35.72%
mp5_regen Mana 1463.00 298139.53 (15.86%) 203.79 140760.47 32.07%
vampiric_embrace Health 68.82 521754.72 (25.40%) 7581.09 388370.91 42.67%
pet - mindbender
vampiric_embrace Health 17.51 106828.28 (100.00%) 6100.46 108217.42 50.32%
Resource RPS-Gain RPS-Loss
Health 14141.52 14867.22
Mana 5135.19 5160.77
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health 197302.69 -142803.02 462887.00
Mana 290637.23 248400.00 300000.00
Shadow Orb 1.52 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 32.3%
shadowfiend-Mana Cap 32.3%
lightwell-Mana Cap 32.3%

Procs

Count Interval
Shadowy Recall Extra Tick 314.6 1.2sec
Shadowy Apparition Procced 95.0 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_tof_mb Damage Per Second
Count 49992
Mean 128313.67
Minimum 120396.32
Maximum 136621.73
Spread ( max - min ) 16225.42
Range [ ( max - min ) / 2 * 100% ] 6.32%
Standard Deviation 2330.7871
5th Percentile 124539.51
95th Percentile 132232.41
( 95th Percentile - 5th Percentile ) 7692.90
Mean Distribution
Standard Deviation 10.4244
95.00% Confidence Intervall ( 128293.24 - 128334.10 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1267
0.1 Scale Factor Error with Delta=300 46375
0.05 Scale Factor Error with Delta=300 185502
0.01 Scale Factor Error with Delta=300 4637552
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 128313.67
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43592306.28
Distribution Chart

DTPS

Sample Data priest_90_tof_mb Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_tof_mb Healing Per Second
Count 49992
Mean 7608.13
Minimum 0.00
Maximum 29896.69
Spread ( max - min ) 29896.69
Range [ ( max - min ) / 2 * 100% ] 196.48%
Standard Deviation 4618.9655
5th Percentile 1782.04
95th Percentile 16799.81
( 95th Percentile - 5th Percentile ) 15017.78
Mean Distribution
Standard Deviation 20.6583
95.00% Confidence Intervall ( 7567.64 - 7648.62 )
Normalized 95.00% Confidence Intervall ( 99.47% - 100.53% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14158
0.1% Error 1415891
0.1 Scale Factor Error with Delta=300 182126
0.05 Scale Factor Error with Delta=300 728505
0.01 Scale Factor Error with Delta=300 18212648
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 7608.13
Distribution Chart

Heal

Sample Data
Count 49992
Mean 2784575.12
Distribution Chart

HTPS

Sample Data priest_90_tof_mb Healing taken Per Second
Count 49992
Mean 8528.68
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 215.92
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 5.82 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.44 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.27 shadow_word_death,if=active_enemies<=5
F 38.03 mind_blast,if=active_enemies<=6&cooldown_react
G 35.41 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 39.25 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.95 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.00 halo,if=talent.halo.enabled
M 11.01 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.30 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.93 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.52 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFTQFMGGHHTQFTFTHGGHHFLMTFHTAGGHFTFHTHGGFMTLTFHTHTGFGTFHMTAHTFGGTLTFHTHTFTGGTFHMTHTFTGGTHFLTHTTAFMTGGHFTHTFTGGFHHLMTQFTTTFGGHHTQFMATFTGGHHLQFTFTGGHFHKMTTFTHGFGHLTAEDEFTHHEEFGGHMTEEFTH9TEDEFGGHLTEEFHTPEDEFGAG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi : 131657 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131656.6 131656.6 21.99 / 0.02% 4128 / 3.1% 22.6 10197.7 10197.7 49.09 / 0.48% 9129 / 89.5% 1.8 5645.5 5628.4 Mana 0.29% 37.8 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.01 0.00 3.93 2.95 0.86 1.50 1.30
Normalized 1.00 0.00 0.98 0.74 0.22 0.37 0.33
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste > Mastery > Crit
Pawn string
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=4.01, SpellDamage=3.93, HitRating=2.95, CritRating=0.86, HasteRating=1.50, MasteryRating=1.30 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=4.01, SpellDamage=3.93, HitRating=0.00, CritRating=0.86, HasteRating=1.50, MasteryRating=1.30 )

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:351812|252289|197899|191947|172197|114864|100524|51968&chds=0,703623&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++351812++devouring_plague,9482C9,0,0,15|t++252289++halo,9482C9,1,0,15|t++197899++shadow_word_pain,9482C9,2,0,15|t++191947++vampiric_touch,9482C9,3,0,15|t++172197++shadow_word_insanity,9482C9,4,0,15|t++114864++shadow_word_death,9482C9,5,0,15|t++100524++mind_blast,9482C9,6,0,15|t++51968++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,14,12,10,9,7,6,5,5,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|shadow_word_insanity|mind_blast|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_tof_swi Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.01,3.93,2.95,1.50,1.30,0.86|3.98,3.90,2.92,1.47,1.27,0.83|4.04,3.96,2.98,1.53,1.33,0.89&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.01++Int,FFFFFF,0,0,15,0.1,e|t++++3.93++SP,FFFFFF,0,1,15,0.1,e|t++++2.95++Hit,FFFFFF,0,2,15,0.1,e|t++++1.50++Haste,FFFFFF,0,3,15,0.1,e|t++++1.30++Mastery,FFFFFF,0,4,15,0.1,e|t++++0.86++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.819&chtt=Scale Factors|priest_90_tof_swi%20Damage%20Per%20Second&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:58655433243220z00xwwwvttsrrqqronnmnmkljnnllllmmlkljijjijjkjkgffeedcbccbcccdeeefgfihhhhhghghhhggffghgghfggggghhihiiijjkjiiijihhhhgggffffgghhhhhgeeffgghhhhggggggggfgghhhiihgfggijjjjjjjkjiijjijjkmmllkkjjjjjiijkkkkkkjjjiiihhhggghhhhhhhhhhhghhghhhghiiiiiiiijjjjkkllkkkkkjjjihhggfedccbbabcddeeffghijklmnoppqqrssqrrrrrqqppppppppppppprrrsstttvwxxxyyzz0000000zzyzzzyyxxxxxxxx&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6267,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=131657|max=210078&chxp=1,1,63,100&chtt=priest_90_tof_swi DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,0,0,32,8,56,104,144,176,240,440,576,744,904,1040,1480,1824,1840,2256,2424,2704,2552,3200,2936,2856,2912,2768,2424,2368,1992,1904,1824,1176,1024,880,712,440,280,216,128,152,56,40,80,32,0,16,0,0,8&chds=0,3200&chbh=5&chxt=x&chxl=0:|min=122598|avg=131657|max=141632&chxp=0,1,48,100&chtt=priest_90_tof_swi DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:39.0,12.2,12.2,11.8,7.7,4.9,4.0,2.9,0.7,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 142.9s|vampiric_touch 44.8s|shadow_word_pain 44.6s|mind_blast 43.1s|shadow_word_insanity 28.3s|devouring_plague 17.8s|shadow_word_death 14.7s|halo 10.6s|shadowfiend 2.5s|waiting 1.1s&chtt=priest_90_tof_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi 131657
devouring_plague 6134 (17076) 4.7% (13.0%) 14.9 25.75sec 419495 351812 123911 256882 150675 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 14.90 0.00 0.00 1.1924 0.0000 2244898.64 2244898.64 0.00 351811.74 351811.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.90 79.87% 123910.86 107519 165536 123891.33 113895 135355 1474506 1474506 0.00
crit 3.00 20.13% 256882.31 221488 341004 247159.19 0 341004 770393 770393 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2621 2.0% 38.1 9.59sec 25174 0 20720 42987 25203 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.11 38.06 0.00 0.00 0.0000 0.0000 959283.87 959283.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.40 79.87% 20719.65 17856 27490 20718.94 19225 22610 629867 629867 0.00
crit 7.66 20.13% 42987.45 36784 56629 42955.95 0 56629 329417 329417 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8322 6.3% 14.9 25.75sec 204431 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122.1 20549 42644 24953 19.9% 0.0% 25.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 14.90 122.06 122.06 0.0000 0.7596 3045753.03 3045753.03 0.00 32851.06 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.7 80.07% 20548.89 17856 27490 20546.82 19592 21708 2008303 2008303 0.00
crit 24.3 19.93% 42644.19 36784 56629 42638.64 38532 47723 1037450 1037450 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7333) 0.0% (5.6%) 9.0 42.74sec 298864 252289 0 0 0 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.1846 0.0000 0.00 0.00 0.00 252288.67 252288.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.17 79.87% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.81 20.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7333 5.6% 9.0 42.74sec 298864 0 122973 255254 149437 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 17.96 0.00 0.00 0.0000 0.0000 2683846.86 2683846.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.37 80.00% 122972.91 109581 160794 122956.28 110653 134242 1766844 1766844 0.00
crit 3.59 20.00% 255254.42 225736 331235 250395.81 0 331235 917002 917002 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 10198 100.0% 9.0 42.74sec 415624 0 35104 49011 38321 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.98 97.40 0.00 0.00 0.0000 0.0000 3732364.48 19930267.00 81.27 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.87 76.87% 35104.27 0 212691 34954.79 0 117316 2628235 12267955 78.68
crit 22.53 23.13% 49010.67 0 438143 48931.79 0 222729 1104130 7662312 85.67
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11846 9.0% 36.5 10.04sec 118738 100524 97744 202825 118737 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.51 36.51 0.00 0.00 1.1812 0.0000 4335581.54 4335581.54 0.00 100523.57 100523.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.22 80.02% 97744.17 86183 133296 97742.75 92927 102588 2855953 2855953 0.00
crit 7.30 19.98% 202825.12 177536 274589 202813.73 0 253202 1479628 1479628 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15455 (20291) 11.7% (15.4%) 84.3 4.23sec 88048 51968 0 0 0 0.0% 0.0% 0.0% 0.0% 180.3 25803 53536 31375 20.1% 0.0% 36.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.35 84.35 180.29 180.29 1.6943 0.7312 5656571.79 5656571.79 0.00 51968.44 51968.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.1 79.91% 25803.36 22887 35236 25802.90 25066 26556 3717520 3717520 0.00
crit 36.2 20.09% 53536.39 47146 72586 53537.27 50457 57458 1939052 1939052 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4836 3.7% 56.5 6.17sec 31349 0 25807 53528 31364 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.46 56.43 0.00 0.00 0.0000 0.0000 1769978.60 1769978.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.12 79.95% 25806.69 22887 35236 25806.94 24343 27603 1164389 1164389 0.00
crit 11.31 20.05% 53527.59 47146 72586 53518.69 47146 62899 605590 605590 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4625 3.5% 12.5 4.88sec 135380 114864 110983 230531 135380 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.50 12.50 0.00 0.00 1.1787 0.0000 1692870.62 1692870.62 0.00 114864.34 114864.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.95 79.59% 110982.83 83662 129665 110987.75 101108 121900 1104581 1104581 0.00
crit 2.55 20.41% 230530.87 172343 267111 218009.59 0 267111 588290 588290 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 13325 10.1% 24.0 14.09sec 203018 172197 167082 346457 203017 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.02 24.02 0.00 0.00 1.1790 0.0000 4877130.89 4877130.89 0.00 172196.83 172196.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.21 79.97% 167081.61 148247 229957 167025.74 155496 180555 3209727 3209727 0.00
crit 4.81 20.03% 346457.25 305389 473711 344631.86 0 473711 1667404 1667404 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18374 (24140) 14.0% (18.3%) 37.9 9.72sec 233152 197899 0 0 0 0.0% 0.0% 0.0% 0.0% 336.0 15165 31389 20018 29.9% 0.0% 180.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.89 37.89 335.95 335.95 1.1781 1.9706 6725048.58 6725048.58 0.00 12502.75 197898.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.5 70.09% 15164.91 13422 20660 15165.10 14541 15650 3570715 3570715 0.00
crit 100.5 29.91% 31389.08 27649 42560 31388.24 30010 32991 3154333 3154333 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5765 4.4% 105.2 3.44sec 20068 0 15219 31516 20104 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.15 104.96 0.00 0.00 0.0000 0.0000 2110142.16 2110142.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.50 70.03% 15219.46 13422 20660 15219.33 14376 16265 1118626 1118626 0.00
crit 31.46 29.97% 31515.62 27649 42560 31515.50 29519 34049 991517 991517 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2257 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5626 4.3% 92.4 3.92sec 22280 0 18943 38167 22770 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.42 90.44 0.00 0.00 0.0000 0.0000 2059248.08 2059248.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.43 80.09% 18942.93 16669 25856 18942.42 18253 19683 1372119 1372119 0.00
crit 18.00 19.91% 38166.74 33338 51713 38166.34 34708 42661 687129 687129 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17852 (23477) 13.6% (17.8%) 38.1 9.39sec 225477 191947 0 0 0 0.0% 0.0% 0.0% 0.0% 317.6 16942 35164 20570 19.9% 0.0% 192.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.11 38.11 317.64 317.64 1.1747 2.2142 6533937.01 6533937.01 0.00 11485.98 191946.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 254.4 80.09% 16942.05 15001 23421 16941.96 16386 17479 4310088 4310088 0.00
crit 63.2 19.91% 35164.40 30902 48248 35160.66 33318 37312 2223849 2223849 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5625 4.3% 99.4 3.59sec 20711 0 17087 35458 20732 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.40 99.31 0.00 0.00 0.0000 0.0000 2058761.61 2058761.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.61 80.16% 17087.25 15001 23421 17087.28 16315 17889 1360235 1360235 0.00
crit 19.70 19.84% 35458.48 30902 48248 35456.22 31942 39652 698527 698527 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 51432 / 3916
melee 51432 3.0% 26.9 14.65sec 53306 54203 49390 99917 53306 20.7% 7.3% 24.0% 2.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.89 26.89 0.00 0.00 0.9835 0.0000 1433280.56 1433280.56 0.00 54202.65 54202.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.30 45.76% 49389.95 38145 58728 49378.85 42886 55334 607624 607624 0.00
crit 5.55 20.65% 99916.75 76291 117456 99834.13 0 117456 554838 554838 0.00
glance 6.45 23.99% 37149.45 28609 44046 37133.99 0 44046 239590 239590 0.00
block 0.63 2.33% 49770.81 38145 58728 23153.39 0 58728 31229 31229 0.00
parry 1.96 7.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.1882 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.67%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.0 0.0 107.6sec 107.6sec 21.86% 21.86%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:21.86%

    Trigger Attempt Success

    • trigger_pct:15.75%
jade_serpent_potion 1.0 0.0 336.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 10.2 7.4 36.1sec 20.2sec 43.98% 44.29%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.98%

    Trigger Attempt Success

    • trigger_pct:1.67%
light_of_the_cosmos 8.0 0.0 47.9sec 47.9sec 43.49% 43.49%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.49%

    Trigger Attempt Success

    • trigger_pct:14.48%
shadow_word_death_reset_cooldown 6.3 0.0 10.2sec 10.2sec 9.93% 49.34%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.93%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
twist_of_fate 1.2 125.5 27.1sec 0.6sec 20.54% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:20.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.9 0.0 0.0sec 0.0sec 3.80% 3.89%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:3.80%

Trigger Attempt Success

  • trigger_pct:93.49%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.57% 80.47%

Buff details

  • buff initial source:priest_90_tof_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi
devouring_plague Shadow Orb 14.9 44.7 3.0 3.0 139831.6
halo Mana 9.0 363696.5 40500.0 40500.0 7.4
mind_blast Mana 36.5 328623.8 9000.0 9000.0 13.2
mind_flay Mana 84.3 253038.2 3000.0 3000.0 29.3
shadow_word_death Mana 12.5 97538.7 7800.0 7800.2 17.4
shadow_word_insanity Mana 24.0 180175.2 7500.0 7500.0 27.1
shadow_word_pain Mana 37.9 500208.2 13200.0 13200.0 17.7
vampiric_touch Mana 38.1 342982.1 9000.0 9000.0 25.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 24.93 120242.06 (5.84%) 4822.80 104145.94 46.41%
Shadow Orbs from Mind Blast Shadow Orb 36.51 36.51 (85.21%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.34 6.34 (14.79%) 1.00 0.00 0.00%
Devouring Plague Health Health 160.12 1616333.09 (76.13%) 10094.32 607233.12 27.31%
Vampiric Touch Mana Mana 416.95 1607536.56 (78.04%) 3855.46 596249.52 27.06%
mp5_regen Mana 1463.00 332219.81 (16.13%) 227.08 106680.19 24.31%
vampiric_embrace Health 63.10 506684.30 (23.87%) 8029.41 493591.06 49.35%
pet - shadowfiend
vampiric_embrace Health 0.08 1050.42 (100.00%) 12822.52 502.56 32.36%
Resource RPS-Gain RPS-Loss
Health 14186.48 14867.22
Mana 5628.41 5645.53
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 213731.55 -156689.63 462887.00
Mana 293737.30 244800.00 300000.00
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.5%
shadowfiend-Mana Cap 24.5%
lightwell-Mana Cap 24.5%

Procs

Count Interval
Shadowy Recall Extra Tick 298.8 1.2sec
Shadowy Apparition Procced 92.4 3.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data priest_90_tof_swi Damage Per Second
Count 49992
Mean 131656.65
Minimum 122597.98
Maximum 141632.44
Spread ( max - min ) 19034.46
Range [ ( max - min ) / 2 * 100% ] 7.23%
Standard Deviation 2508.9855
5th Percentile 127532.56
95th Percentile 135788.63
( 95th Percentile - 5th Percentile ) 8256.08
Mean Distribution
Standard Deviation 11.2214
95.00% Confidence Intervall ( 131634.66 - 131678.64 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1395
0.1 Scale Factor Error with Delta=300 53737
0.05 Scale Factor Error with Delta=300 214951
0.01 Scale Factor Error with Delta=300 5373781
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131656.65
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46753053.29
Distribution Chart

DTPS

Sample Data priest_90_tof_swi Damage Taken Per Second
Count 49992
Mean 14867.22
Distribution Chart

HPS

Sample Data priest_90_tof_swi Healing Per Second
Count 49992
Mean 10197.72
Minimum 0.00
Maximum 32487.09
Spread ( max - min ) 32487.09
Range [ ( max - min ) / 2 * 100% ] 159.29%
Standard Deviation 5600.2147
5th Percentile 3053.89
95th Percentile 21310.89
( 95th Percentile - 5th Percentile ) 18257.01
Mean Distribution
Standard Deviation 25.0469
95.00% Confidence Intervall ( 10148.63 - 10246.81 )
Normalized 95.00% Confidence Intervall ( 99.52% - 100.48% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11585
0.1% Error 1158509
0.1 Scale Factor Error with Delta=300 267727
0.05 Scale Factor Error with Delta=300 1070910
0.01 Scale Factor Error with Delta=300 26772752
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 10197.72
Distribution Chart

Heal

Sample Data
Count 49992
Mean 3732364.48
Distribution Chart

HTPS

Sample Data priest_90_tof_swi Healing taken Per Second
Count 49992
Mean 8385.90
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 230.64
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.65 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 12.50 shadow_word_death,if=active_enemies<=5
F 37.90 mind_blast,if=active_enemies<=6&cooldown_react
G 37.89 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 39.00 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 24.02 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.93 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 8.98 halo,if=talent.halo.enabled
M 10.24 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.09 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.15 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 44.27 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 0.00 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFTIFGGHHMTFTFIGHGHTTFLMTFGHHGTFTFIGHHIGDFTLTFHGHIGTQFMTQFTHHGIGTFTLTFHHTIGGFMTFHHIGIGTFTLTFHHGBGDFTFHHIGIGTFMTHFHIGIGLTFTTTHFHIGIGMTFTHHFIGIGTFLMTHHFHGIGTFTTHHFIGIGMTQFTLEEHHQFIGDEEGQFTEDEHFHIG9TIEEFGKMTEEFHHGLTEDEFBGT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 366 - 366 ( 366.0 )

Performance:

Total Events Processed: 1167044664
Max Event Queue: 202
Sim Seconds: 18300000
CPU Seconds: 2396.3400
Speed Up: 7637

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 366.00
95th Percentile 366.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 366.00 - 366.00 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl priest_90_di_fdcl devouring_plague 2944 2750784 7516 3.13 118769 246408 19.1 19.1 19.8% 0.0% 0.0% 0.0% 19.94sec 2750784 366.00sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_mastery 124467 1194473 3264 8.12 19812 41090 49.6 49.6 20.2% 0.0% 0.0% 0.0% 7.33sec 1194473 366.00sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_tick ticks -2944 3803334 10392 25.96 19777 40986 19.1 158.3 20.0% 0.0% 0.0% 0.0% 19.94sec 3803334 366.00sec
priest_90_di_fdcl priest_90_di_fdcl halo 120644 0 0 1.47 0 0 9.0 9.0 19.8% 0.0% 0.0% 0.0% 42.96sec 0 366.00sec
priest_90_di_fdcl priest_90_di_fdcl halo_damage 120696 2606872 7123 2.94 119214 247588 9.0 18.0 20.2% 0.0% 0.0% 0.0% 42.96sec 2606872 366.00sec
priest_90_di_fdcl priest_90_di_fdcl halo_heal 120696 2243070 6129 15.61 22528 27003 9.0 95.2 23.1% 0.0% 0.0% 0.0% 42.96sec 18946995 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_blast 8092 5681776 15524 8.08 95052 196949 49.3 49.3 19.8% 0.0% 0.0% 0.0% 7.43sec 5681776 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay ticks -15407 3634491 9930 19.36 25334 52549 58.2 118.1 20.0% 0.0% 0.0% 0.0% 5.96sec 3634491 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay_mastery 124468 1134934 3101 6.04 25327 52559 36.9 36.9 20.0% 0.0% 0.0% 0.0% 9.11sec 1134934 366.00sec
priest_90_di_fdcl priest_90_di_fdcl mind_spike 73510 5077737 13874 8.62 79611 164933 52.6 52.6 19.9% 0.0% 0.0% 0.0% 6.63sec 5077737 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_death 32379 1474474 4029 2.05 96452 200446 12.5 12.5 20.4% 0.0% 0.0% 0.0% 4.89sec 1474474 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain ticks -589 6937233 18954 58.42 14753 30516 35.2 356.4 29.9% 0.0% 0.0% 0.0% 10.47sec 6937233 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain_mastery 124464 2165422 5916 18.23 14750 30518 111.4 111.2 29.9% 0.0% 0.0% 0.0% 3.25sec 2165422 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.06sec 0 366.00sec
priest_90_di_fdcl priest_90_di_fdcl shadowy_apparition 87532 2048741 5598 15.19 18399 37043 94.8 92.7 19.9% 0.0% 0.0% 0.0% 3.83sec 2048741 366.00sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_embrace 15286 0 0 0.13 0 0 0.8 0.8 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch ticks -34914 6247371 17069 50.96 16561 34326 37.5 310.8 19.9% 0.0% 0.0% 0.0% 9.55sec 6247371 366.00sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch_mastery 124465 1955559 5343 15.92 16585 34386 97.2 97.1 19.9% 0.0% 0.0% 0.0% 3.67sec 1955559 366.00sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend melee 0 1435543 51539 57.96 49367 99960 26.9 26.9 20.6% 7.1% 24.0% 2.3% 14.64sec 1435543 27.85sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend shadowcrawl 63619 0 0 10.77 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.54sec 0 27.85sec
priest_90_di_mb priest_90_di_mb devouring_plague 2944 2607932 7125 2.96 118992 246608 18.0 18.0 20.0% 0.0% 0.0% 0.0% 21.16sec 2607932 366.00sec
priest_90_di_mb priest_90_di_mb devouring_plague_mastery 124467 1135772 3103 7.72 19841 41145 47.2 47.1 20.0% 0.0% 0.0% 0.0% 7.72sec 1135772 366.00sec
priest_90_di_mb priest_90_di_mb devouring_plague_tick ticks -2944 3623913 9901 24.68 19807 41068 18.0 150.6 20.0% 0.0% 0.0% 0.0% 21.16sec 3623913 366.00sec
priest_90_di_mb priest_90_di_mb halo 120644 0 0 1.48 0 0 9.0 9.0 20.1% 0.0% 0.0% 0.0% 42.78sec 0 366.00sec
priest_90_di_mb priest_90_di_mb halo_damage 120696 2604826 7117 2.95 119226 247588 9.0 18.0 19.9% 0.0% 0.0% 0.0% 42.78sec 2604826 366.00sec
priest_90_di_mb priest_90_di_mb halo_heal 120696 2329721 6365 15.55 23237 28936 9.0 94.8 23.3% 0.0% 0.0% 0.0% 42.78sec 18905793 366.00sec
priest_90_di_mb priest_90_di_mb mind_blast 8092 5346226 14607 7.60 95042 197011 46.4 46.4 19.9% 0.0% 0.0% 0.0% 7.90sec 5346226 366.00sec
priest_90_di_mb priest_90_di_mb mind_flay ticks -15407 5965432 16299 31.84 25272 52410 91.7 194.2 20.1% 0.0% 0.0% 0.0% 3.87sec 5965432 366.00sec
priest_90_di_mb priest_90_di_mb mind_flay_mastery 124468 1866123 5099 9.97 25271 52380 60.8 60.8 19.9% 0.0% 0.0% 0.0% 5.74sec 1866123 366.00sec
priest_90_di_mb priest_90_di_mb mindbender 123040 0 0 0.95 0 0 5.8 5.8 0.0% 0.0% 0.0% 0.0% 60.84sec 0 366.00sec
priest_90_di_mb priest_90_di_mb shadow_word_death 32379 1440183 3935 2.01 96546 200361 12.2 12.2 20.3% 0.0% 0.0% 0.0% 4.86sec 1440183 366.00sec
priest_90_di_mb priest_90_di_mb shadow_word_pain ticks -589 6933414 18944 58.37 14757 30527 35.1 356.0 29.9% 0.0% 0.0% 0.0% 10.48sec 6933414 366.00sec
priest_90_di_mb priest_90_di_mb shadow_word_pain_mastery 124464 2165444 5917 18.23 14752 30537 111.4 111.2 29.9% 0.0% 0.0% 0.0% 3.25sec 2165444 366.00sec
priest_90_di_mb priest_90_di_mb shadowy_apparition 87532 2050073 5601 15.19 18409 37045 94.8 92.7 19.9% 0.0% 0.0% 0.0% 3.83sec 2050073 366.00sec
priest_90_di_mb priest_90_di_mb vampiric_embrace 15286 0 0 0.14 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% 203.07sec 0 366.00sec
priest_90_di_mb priest_90_di_mb vampiric_touch ticks -34914 6223287 17004 50.74 16560 34330 37.5 309.5 20.0% 0.0% 0.0% 0.0% 9.60sec 6223287 366.00sec
priest_90_di_mb priest_90_di_mb vampiric_touch_mastery 124465 1948519 5324 15.87 16584 34383 96.9 96.8 19.9% 0.0% 0.0% 0.0% 3.68sec 1948519 366.00sec
priest_90_di_mb priest_90_di_mb_mindbender melee 0 3376325 37084 53.67 38659 77973 81.4 81.4 20.2% 7.4% 24.0% 2.4% 4.26sec 3376325 91.04sec
priest_90_di_mb priest_90_di_mb_mindbender shadowcrawl 63619 0 0 12.40 0 0 18.8 18.8 0.0% 0.0% 0.0% 0.0% 19.99sec 0 91.04sec
priest_90_di_swi priest_90_di_swi devouring_plague 2944 2583823 7060 2.94 118685 245974 17.9 17.9 19.9% 0.0% 0.0% 0.0% 21.27sec 2583823 366.00sec
priest_90_di_swi priest_90_di_swi devouring_plague_mastery 124467 1117662 3054 7.60 19825 41144 46.4 46.4 20.1% 0.0% 0.0% 0.0% 7.84sec 1117662 366.00sec
priest_90_di_swi priest_90_di_swi devouring_plague_tick ticks -2944 3559658 9726 24.33 19747 40943 17.9 148.4 20.0% 0.0% 0.0% 0.0% 21.27sec 3559658 366.00sec
priest_90_di_swi priest_90_di_swi halo 120644 0 0 1.47 0 0 9.0 9.0 20.4% 0.0% 0.0% 0.0% 42.51sec 0 366.00sec
priest_90_di_swi priest_90_di_swi halo_damage 120696 2596933 7095 2.94 119174 247286 9.0 17.9 20.1% 0.0% 0.0% 0.0% 42.51sec 2596933 366.00sec
priest_90_di_swi priest_90_di_swi halo_heal 120696 4558168 12454 15.78 43134 61426 9.0 96.2 23.1% 0.0% 0.0% 0.0% 42.51sec 19135052 366.00sec
priest_90_di_swi priest_90_di_swi mind_blast 8092 5282674 14434 7.51 94996 196986 45.8 45.8 20.0% 0.0% 0.0% 0.0% 8.00sec 5282674 366.00sec
priest_90_di_swi priest_90_di_swi mind_flay ticks -15407 4942361 13504 26.32 25325 52520 75.9 160.5 20.1% 0.0% 0.0% 0.0% 4.67sec 4942361 366.00sec
priest_90_di_swi priest_90_di_swi mind_flay_mastery 124468 1551997 4240 8.26 25330 52553 50.4 50.4 20.1% 0.0% 0.0% 0.0% 6.87sec 1551997 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_death 32379 1472451 4023 2.05 96455 200116 12.5 12.5 20.6% 0.0% 0.0% 0.0% 4.90sec 1472451 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_insanity 129249 4952036 13530 4.11 162775 336932 25.1 25.1 19.8% 0.0% 0.0% 0.0% 13.37sec 4952036 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_pain ticks -589 6509912 17787 54.84 14742 30489 37.9 334.5 30.0% 0.0% 0.0% 0.0% 9.71sec 6509912 366.00sec
priest_90_di_swi priest_90_di_swi shadow_word_pain_mastery 124464 2036243 5564 17.13 14754 30546 104.6 104.5 30.0% 0.0% 0.0% 0.0% 3.46sec 2036243 366.00sec
priest_90_di_swi priest_90_di_swi shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.07sec 0 366.00sec
priest_90_di_swi priest_90_di_swi shadowy_apparition 87532 2001643 5469 14.82 18407 37040 92.4 90.4 20.0% 0.0% 0.0% 0.0% 3.92sec 2001643 366.00sec
priest_90_di_swi priest_90_di_swi vampiric_embrace 15286 0 0 0.14 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% 195.38sec 0 366.00sec
priest_90_di_swi priest_90_di_swi vampiric_touch ticks -34914 6328473 17291 51.68 16545 34306 38.0 315.3 19.9% 0.0% 0.0% 0.0% 9.45sec 6328473 366.00sec
priest_90_di_swi priest_90_di_swi vampiric_touch_mastery 124465 1978706 5406 16.13 16575 34388 98.5 98.4 19.9% 0.0% 0.0% 0.0% 3.62sec 1978706 366.00sec
priest_90_di_swi priest_90_di_swi_shadowfiend melee 0 1431987 51373 57.91 49330 99976 26.9 26.9 20.5% 7.3% 24.0% 2.3% 14.64sec 1431987 27.87sec
priest_90_di_swi priest_90_di_swi_shadowfiend shadowcrawl 63619 0 0 10.76 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.54sec 0 27.87sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague 2944 2272185 6208 2.60 118154 244926 15.8 15.8 19.9% 0.0% 0.0% 0.0% 23.97sec 2272185 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_mastery 124467 998246 2727 6.81 19753 40974 41.6 41.5 20.1% 0.0% 0.0% 0.0% 8.78sec 998246 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_tick ticks -2944 3174421 8673 21.84 19630 40672 15.8 133.2 20.0% 0.0% 0.0% 0.0% 23.97sec 3174421 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl halo 120644 0 0 1.48 0 0 9.0 9.0 20.1% 0.0% 0.0% 0.0% 42.83sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_damage 120696 2614627 7144 2.95 119499 248033 9.0 18.0 20.1% 0.0% 0.0% 0.0% 42.83sec 2614627 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_heal 120696 3202319 8750 15.58 31737 40161 9.0 95.0 23.3% 0.0% 0.0% 0.0% 42.83sec 18986379 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_blast 8092 4574759 12499 6.49 95164 197151 39.6 39.6 19.9% 0.0% 0.0% 0.0% 9.27sec 4574759 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay ticks -15407 4396606 12013 23.23 25493 52913 67.8 141.7 20.2% 0.0% 0.0% 0.0% 5.18sec 4396606 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay_mastery 124468 1373061 3752 7.26 25492 52909 44.3 44.3 20.2% 0.0% 0.0% 0.0% 7.74sec 1373061 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_spike 73510 5467837 14939 9.28 79593 164930 56.6 56.6 19.9% 0.0% 0.0% 0.0% 6.19sec 5467837 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl power_infusion 10060 0 0 0.66 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 121.16sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_death 32379 1486397 4061 2.07 96362 200261 12.6 12.6 20.6% 0.0% 0.0% 0.0% 4.84sec 1486397 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain ticks -589 7198976 19669 60.50 14773 30561 35.5 369.0 30.0% 0.0% 0.0% 0.0% 10.43sec 7198976 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain_mastery 124464 2250337 6148 18.91 14771 30583 115.5 115.4 29.9% 0.0% 0.0% 0.0% 3.14sec 2250337 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.04sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowy_apparition 87532 2088058 5705 15.46 18423 37091 96.6 94.3 19.9% 0.0% 0.0% 0.0% 3.76sec 2088058 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 186.16sec 0 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch ticks -34914 6576930 17970 53.50 16601 34425 38.3 326.3 19.9% 0.0% 0.0% 0.0% 9.36sec 6576930 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch_mastery 124465 2055832 5617 16.71 16611 34450 102.1 101.9 19.9% 0.0% 0.0% 0.0% 3.51sec 2055832 366.00sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend melee 0 1443734 51873 58.03 49579 100402 26.9 26.9 20.8% 7.2% 23.9% 2.3% 14.63sec 1443734 27.83sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend shadowcrawl 63619 0 0 10.78 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.55sec 0 27.83sec
priest_90_pi_mb priest_90_pi_mb devouring_plague 2944 2124782 5805 2.42 118480 245707 14.8 14.8 20.0% 0.0% 0.0% 0.0% 26.02sec 2124782 366.00sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_mastery 124467 940461 2570 6.40 19817 41088 39.1 39.1 20.0% 0.0% 0.0% 0.0% 9.35sec 940461 366.00sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_tick ticks -2944 2984418 8154 20.46 19693 40810 14.8 124.8 20.0% 0.0% 0.0% 0.0% 26.02sec 2984418 366.00sec
priest_90_pi_mb priest_90_pi_mb halo 120644 0 0 1.48 0 0 9.0 9.0 20.1% 0.0% 0.0% 0.0% 42.62sec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb halo_damage 120696 2613932 7142 2.95 119722 248463 9.0 18.0 19.8% 0.0% 0.0% 0.0% 42.62sec 2613932 366.00sec
priest_90_pi_mb priest_90_pi_mb halo_heal 120696 3269819 8934 15.64 31438 43557 9.0 95.4 23.3% 0.0% 0.0% 0.0% 42.62sec 19101942 366.00sec
priest_90_pi_mb priest_90_pi_mb mind_blast 8092 4189841 11448 5.96 95041 196908 36.3 36.3 19.9% 0.0% 0.0% 0.0% 10.09sec 4189841 366.00sec
priest_90_pi_mb priest_90_pi_mb mind_flay ticks -15407 6989657 19097 37.12 25393 52696 104.4 226.4 20.1% 0.0% 0.0% 0.0% 3.41sec 6989657 366.00sec
priest_90_pi_mb priest_90_pi_mb mind_flay_mastery 124468 2186964 5975 11.62 25397 52655 70.9 70.9 20.1% 0.0% 0.0% 0.0% 4.97sec 2186964 366.00sec
priest_90_pi_mb priest_90_pi_mb mindbender 123040 0 0 0.95 0 0 5.8 5.8 0.0% 0.0% 0.0% 0.0% 60.85sec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb power_infusion 10060 0 0 0.64 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 121.05sec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb shadow_word_death 32379 1450547 3963 2.02 96420 200170 12.3 12.3 20.3% 0.0% 0.0% 0.0% 4.84sec 1450547 366.00sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain ticks -589 7202956 19680 60.53 14777 30570 35.5 369.2 30.0% 0.0% 0.0% 0.0% 10.44sec 7202956 366.00sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain_mastery 124464 2251263 6151 18.91 14774 30586 115.5 115.4 30.0% 0.0% 0.0% 0.0% 3.14sec 2251263 366.00sec
priest_90_pi_mb priest_90_pi_mb shadowy_apparition 87532 2092639 5718 15.47 18432 37093 96.6 94.4 20.0% 0.0% 0.0% 0.0% 3.76sec 2092639 366.00sec
priest_90_pi_mb priest_90_pi_mb vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch ticks -34914 6580052 17978 53.47 16611 34448 38.4 326.2 20.0% 0.0% 0.0% 0.0% 9.38sec 6580052 366.00sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch_mastery 124465 2060149 5629 16.74 16612 34457 102.2 102.1 20.0% 0.0% 0.0% 0.0% 3.50sec 2060149 366.00sec
priest_90_pi_mb priest_90_pi_mb_mindbender melee 0 3374844 37041 53.64 38690 78102 81.4 81.4 20.1% 7.4% 24.1% 2.4% 4.25sec 3374844 91.11sec
priest_90_pi_mb priest_90_pi_mb_mindbender shadowcrawl 63619 0 0 12.40 0 0 18.8 18.8 0.0% 0.0% 0.0% 0.0% 20.00sec 0 91.11sec
priest_90_pi_swi priest_90_pi_swi devouring_plague 2944 2129210 5818 2.43 118199 244888 14.8 14.8 20.0% 0.0% 0.0% 0.0% 25.83sec 2129210 366.00sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_mastery 124467 932604 2548 6.34 19826 41142 38.7 38.7 20.1% 0.0% 0.0% 0.0% 9.45sec 932604 366.00sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_tick ticks -2944 2952032 8066 20.31 19635 40680 14.8 123.9 19.9% 0.0% 0.0% 0.0% 25.83sec 2952032 366.00sec
priest_90_pi_swi priest_90_pi_swi halo 120644 0 0 1.47 0 0 9.0 9.0 20.0% 0.0% 0.0% 0.0% 42.61sec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi halo_damage 120696 2602726 7111 2.94 119231 247230 9.0 18.0 20.1% 0.0% 0.0% 0.0% 42.61sec 2602726 366.00sec
priest_90_pi_swi priest_90_pi_swi halo_heal 120696 4369591 11939 15.85 41313 58264 9.0 96.7 23.0% 0.0% 0.0% 0.0% 42.61sec 19209733 366.00sec
priest_90_pi_swi priest_90_pi_swi mind_blast 8092 4202779 11483 5.97 95021 197031 36.4 36.4 20.0% 0.0% 0.0% 0.0% 10.07sec 4202779 366.00sec
priest_90_pi_swi priest_90_pi_swi mind_flay ticks -15407 5839356 15955 30.87 25509 52948 87.8 188.3 20.1% 0.0% 0.0% 0.0% 4.06sec 5839356 366.00sec
priest_90_pi_swi priest_90_pi_swi mind_flay_mastery 124468 1829290 4998 9.66 25519 52963 59.0 58.9 20.1% 0.0% 0.0% 0.0% 5.92sec 1829290 366.00sec
priest_90_pi_swi priest_90_pi_swi power_infusion 10060 0 0 0.66 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 121.19sec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_death 32379 1477070 4036 2.05 96421 200549 12.5 12.5 20.6% 0.0% 0.0% 0.0% 4.86sec 1477070 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_insanity 129249 5142464 14050 4.31 161720 334914 26.3 26.3 19.7% 0.0% 0.0% 0.0% 12.24sec 5142464 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain ticks -589 6730616 18390 56.67 14747 30508 37.9 345.7 30.0% 0.0% 0.0% 0.0% 9.66sec 6730616 366.00sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain_mastery 124464 2106074 5754 17.68 14787 30613 108.0 107.9 29.9% 0.0% 0.0% 0.0% 3.35sec 2106074 366.00sec
priest_90_pi_swi priest_90_pi_swi shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.06sec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi shadowy_apparition 87532 2038089 5569 15.08 18439 37113 94.0 92.0 19.9% 0.0% 0.0% 0.0% 3.86sec 2038089 366.00sec
priest_90_pi_swi priest_90_pi_swi vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch ticks -34914 6632180 18121 53.87 16617 34474 39.0 328.6 20.0% 0.0% 0.0% 0.0% 9.34sec 6632180 366.00sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch_mastery 124465 2074217 5667 16.85 16615 34463 102.9 102.8 20.0% 0.0% 0.0% 0.0% 3.47sec 2074217 366.00sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend melee 0 1446196 51834 58.01 49565 100410 27.0 27.0 20.8% 7.3% 23.8% 2.3% 14.60sec 1446196 27.90sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend shadowcrawl 63619 0 0 10.75 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.53sec 0 27.90sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague 2944 2381380 6507 2.59 123981 257025 15.8 15.8 20.0% 0.0% 0.0% 0.0% 24.31sec 2381380 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_mastery 124467 1026265 2804 6.69 20664 42892 40.9 40.8 20.1% 0.0% 0.0% 0.0% 8.93sec 1026265 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_tick ticks -2944 3271622 8939 21.44 20594 42695 15.8 130.8 20.0% 0.0% 0.0% 0.0% 24.31sec 3271622 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl halo 120644 0 0 1.47 0 0 9.0 9.0 19.8% 0.0% 0.0% 0.0% 42.65sec 0 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_damage 120696 2705000 7391 2.95 123590 257232 9.0 18.0 20.0% 0.0% 0.0% 0.0% 42.65sec 2705000 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_heal 120696 2660056 7268 15.48 26291 34387 9.0 94.4 23.2% 0.0% 0.0% 0.0% 42.65sec 19440650 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_blast 8092 4697015 12833 6.47 97958 203169 39.5 39.5 20.1% 0.0% 0.0% 0.0% 9.29sec 4697015 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay ticks -15407 4153966 11350 21.79 25718 53346 65.1 132.9 20.0% 0.0% 0.0% 0.0% 5.38sec 4153966 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay_mastery 124468 1300126 3552 6.82 25734 53331 41.6 41.6 20.0% 0.0% 0.0% 0.0% 8.19sec 1300126 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_spike 73510 5454592 14903 9.01 81703 169395 55.0 55.0 20.0% 0.0% 0.0% 0.0% 6.37sec 5454592 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_death 32379 1708633 4668 2.07 110913 230687 12.6 12.6 20.5% 0.0% 0.0% 0.0% 4.86sec 1708633 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain ticks -589 7148453 19531 58.62 15149 31353 35.5 357.6 29.9% 0.0% 0.0% 0.0% 10.42sec 7148453 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain_mastery 124464 2243165 6129 18.32 15196 31487 111.9 111.8 29.9% 0.0% 0.0% 0.0% 3.23sec 2243165 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.06sec 0 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowy_apparition 87532 2113867 5776 15.23 18927 38131 95.1 92.9 19.9% 0.0% 0.0% 0.0% 3.81sec 2113867 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_embrace 15286 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 196.41sec 0 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch ticks -34914 6498067 17754 51.74 16963 35181 38.0 315.6 19.9% 0.0% 0.0% 0.0% 9.42sec 6498067 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch_mastery 124465 2044801 5587 16.17 17084 35454 98.8 98.7 19.8% 0.0% 0.0% 0.0% 3.61sec 2044801 366.00sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend melee 0 1433494 51518 57.94 49361 99859 26.9 26.9 20.6% 7.1% 24.1% 2.4% 14.66sec 1433494 27.83sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend shadowcrawl 63619 0 0 10.78 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.55sec 0 27.83sec
priest_90_tof_mb priest_90_tof_mb devouring_plague 2944 2175950 5945 2.37 124157 257062 14.5 14.5 19.9% 0.0% 0.0% 0.0% 26.84sec 2175950 366.00sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_mastery 124467 951043 2598 6.18 20710 42934 37.7 37.7 20.3% 0.0% 0.0% 0.0% 9.64sec 951043 366.00sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_tick ticks -2944 3012551 8231 19.72 20626 42744 14.5 120.3 20.0% 0.0% 0.0% 0.0% 26.84sec 3012551 366.00sec
priest_90_tof_mb priest_90_tof_mb halo 120644 0 0 1.48 0 0 9.0 9.0 20.3% 0.0% 0.0% 0.0% 42.45sec 0 366.00sec
priest_90_tof_mb priest_90_tof_mb halo_damage 120696 2711196 7408 2.95 123872 257533 9.0 18.0 20.0% 0.0% 0.0% 0.0% 42.45sec 2711196 366.00sec
priest_90_tof_mb priest_90_tof_mb halo_heal 120696 2784575 7608 15.49 26883 38008 9.0 94.5 23.3% 0.0% 0.0% 0.0% 42.45sec 19500278 366.00sec
priest_90_tof_mb priest_90_tof_mb mind_blast 8092 4232897 11565 5.84 97683 202683 35.6 35.6 20.1% 0.0% 0.0% 0.0% 10.27sec 4232897 366.00sec
priest_90_tof_mb priest_90_tof_mb mind_flay ticks -15407 6726484 18378 35.27 25743 53394 99.8 215.1 20.0% 0.0% 0.0% 0.0% 3.56sec 6726484 366.00sec
priest_90_tof_mb priest_90_tof_mb mind_flay_mastery 124468 2103656 5748 11.02 25747 53410 67.2 67.2 20.1% 0.0% 0.0% 0.0% 5.22sec 2103656 366.00sec
priest_90_tof_mb priest_90_tof_mb mindbender 123040 0 0 0.95 0 0 5.8 5.8 0.0% 0.0% 0.0% 0.0% 60.85sec 0 366.00sec
priest_90_tof_mb priest_90_tof_mb shadow_word_death 32379 1666245 4553 2.01 111066 230933 12.3 12.3 20.7% 0.0% 0.0% 0.0% 4.84sec 1666245 366.00sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain ticks -589 7160824 19565 58.65 15159 31383 35.4 357.7 29.9% 0.0% 0.0% 0.0% 10.43sec 7160824 366.00sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain_mastery 124464 2245915 6136 18.33 15206 31486 112.0 111.8 29.9% 0.0% 0.0% 0.0% 3.23sec 2245915 366.00sec
priest_90_tof_mb priest_90_tof_mb shadowy_apparition 87532 2111907 5770 15.22 18935 38140 95.0 92.8 19.9% 0.0% 0.0% 0.0% 3.82sec 2111907 366.00sec
priest_90_tof_mb priest_90_tof_mb vampiric_embrace 15286 0 0 0.16 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% 195.36sec 0 366.00sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch ticks -34914 6460645 17652 51.41 16966 35200 37.9 313.6 19.9% 0.0% 0.0% 0.0% 9.49sec 6460645 366.00sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch_mastery 124465 2032994 5555 16.05 17094 35484 98.0 97.9 20.0% 0.0% 0.0% 0.0% 3.64sec 2032994 366.00sec
priest_90_tof_mb priest_90_tof_mb_mindbender melee 0 3370496 37062 53.63 38640 77955 81.3 81.3 20.3% 7.4% 24.0% 2.4% 4.25sec 3370496 90.94sec
priest_90_tof_mb priest_90_tof_mb_mindbender shadowcrawl 63619 0 0 12.42 0 0 18.8 18.8 0.0% 0.0% 0.0% 0.0% 20.00sec 0 90.94sec
priest_90_tof_swi priest_90_tof_swi devouring_plague 2944 2244899 6134 2.44 123911 256882 14.9 14.9 20.1% 0.0% 0.0% 0.0% 25.75sec 2244899 366.00sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_mastery 124467 959284 2621 6.24 20720 42987 38.1 38.1 20.1% 0.0% 0.0% 0.0% 9.59sec 959284 366.00sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_tick ticks -2944 3045753 8322 20.01 20549 42644 14.9 122.1 19.9% 0.0% 0.0% 0.0% 25.75sec 3045753 366.00sec
priest_90_tof_swi priest_90_tof_swi halo 120644 0 0 1.47 0 0 9.0 9.0 20.1% 0.0% 0.0% 0.0% 42.74sec 0 366.00sec
priest_90_tof_swi priest_90_tof_swi halo_damage 120696 2683847 7333 2.94 122973 255254 9.0 18.0 20.0% 0.0% 0.0% 0.0% 42.74sec 2683847 366.00sec
priest_90_tof_swi priest_90_tof_swi halo_heal 120696 3732364 10198 15.97 35104 49011 9.0 97.4 23.1% 0.0% 0.0% 0.0% 42.74sec 19930267 366.00sec
priest_90_tof_swi priest_90_tof_swi mind_blast 8092 4335582 11846 5.99 97744 202825 36.5 36.5 20.0% 0.0% 0.0% 0.0% 10.04sec 4335582 366.00sec
priest_90_tof_swi priest_90_tof_swi mind_flay ticks -15407 5656572 15455 29.56 25803 53536 84.3 180.3 20.1% 0.0% 0.0% 0.0% 4.23sec 5656572 366.00sec
priest_90_tof_swi priest_90_tof_swi mind_flay_mastery 124468 1769979 4836 9.25 25807 53528 56.5 56.4 20.0% 0.0% 0.0% 0.0% 6.17sec 1769979 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_death 32379 1692871 4625 2.05 110983 230531 12.5 12.5 20.4% 0.0% 0.0% 0.0% 4.88sec 1692871 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_insanity 129249 4877131 13325 3.94 167082 346457 24.0 24.0 20.0% 0.0% 0.0% 0.0% 14.09sec 4877131 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain ticks -589 6725049 18374 55.07 15165 31389 37.9 336.0 29.9% 0.0% 0.0% 0.0% 9.72sec 6725049 366.00sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain_mastery 124464 2110142 5765 17.21 15219 31516 105.2 105.0 30.0% 0.0% 0.0% 0.0% 3.44sec 2110142 366.00sec
priest_90_tof_swi priest_90_tof_swi shadowfiend 34433 0 0 0.33 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.11sec 0 366.00sec
priest_90_tof_swi priest_90_tof_swi shadowy_apparition 87532 2059248 5626 14.83 18943 38167 92.4 90.4 19.9% 0.0% 0.0% 0.0% 3.92sec 2059248 366.00sec
priest_90_tof_swi priest_90_tof_swi vampiric_embrace 15286 0 0 0.15 0 0 0.9 0.9 0.0% 0.0% 0.0% 0.0% nansec 0 366.00sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch ticks -34914 6533937 17852 52.07 16942 35164 38.1 317.6 19.9% 0.0% 0.0% 0.0% 9.39sec 6533937 366.00sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch_mastery 124465 2058762 5625 16.28 17087 35458 99.4 99.3 19.8% 0.0% 0.0% 0.0% 3.59sec 2058762 366.00sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend melee 0 1433281 51432 57.89 49390 99917 26.9 26.9 20.7% 7.3% 24.0% 2.3% 14.65sec 1433281 27.87sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend shadowcrawl 63619 0 0 10.77 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.54sec 0 27.87sec

enemy1 : 154142 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
154142.5 154142.5 2.00 / 0.00% 368 / 0.2% -1.0 0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for enemy1 Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:100&chds=0,100&chdls=ffffff&chco=9482C9&chl=raid_damage_shadow&chtt=enemy1 Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:JIPONMMLNMLLLLOOOJJJLLLGGGIIIGGGIIIGGGIIIGGGIIIGGGIIIGGJJJJHKKKKKLLLLLNLLLLNKKKKMJJJJLIIIILIIIILIIIILIIIILIIIILIIILLJJMMMKNNNNOOOOQOOOQNNNPMMMOLLLOLLLNLLLNLLLNLLLNLLLNLLLNLLPPNSSSVVVaXXaaYbbbbbbYYYWWWTTTQQQPPPPPPPPPPPPPPPPPPPPPPPPPPRPSSTTWUXXYYbZccccfcfcfcebdacZbYaXZWYWYWYWYWYWYWYWYWYWYWYWYYaaddghklopstwx014577877766543210zyxwvvuuuuuuuuuuuuuuuuuuuuuuuwy00112233456&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3681,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=154142|max=418798&chxp=1,1,37,100&chtt=enemy1 DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,40,0,0,464,0,0,0,2168,0,0,5400,0,0,9592,0,0,0,10864,0,0,9216,0,0,6144,0,0,3704,0,0,0,1504,0,0,600,0,0,192,0,0,0,80,0,0,8,0,0,8&chds=0,10864&chbh=5&chxt=x&chxl=0:|min=153372|avg=154142|max=155210&chxp=0,1,42,100&chtt=enemy1 DPS Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy1 154142
raid_damage_shadow 154142 100.0% 1534.3 2.38sec 36770 0 36770 0 36770 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raid_damage_shadow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1534.29 1534.29 0.00 0.00 0.0000 0.0000 56416147.70 56416147.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1534.29 100.00% 36770.21 35156 44855 36770.19 36737 36816 56416148 56416148 0.00
DPS Timeline Chart

Action details: raid_damage_shadow

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:44000.00
  • base_dd_max:44000.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.91% 7.91%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.91%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.81% 8.81%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.82% 11.82%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.83% 10.83%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.36% 10.36%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.73% 11.73%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.87% 10.87%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.81% 11.81%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.85% 9.85%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
flying 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_flying
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • flying_1:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 933103.08
Combat End Resource Mean Min Max
Health 803009.20 0.00 8733506.11
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data enemy1 Damage Per Second
Count 49992
Mean 154142.48
Minimum 153371.65
Maximum 155209.97
Spread ( max - min ) 1838.32
Range [ ( max - min ) / 2 * 100% ] 0.60%
Standard Deviation 228.2526
5th Percentile 153739.32
95th Percentile 154474.65
( 95th Percentile - 5th Percentile ) 735.33
Mean Distribution
Standard Deviation 1.0209
95.00% Confidence Intervall ( 154140.48 - 154144.48 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 8
0.1 Scale Factor Error with Delta=300 444
0.05 Scale Factor Error with Delta=300 1778
0.01 Scale Factor Error with Delta=300 44474
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 154142.48
Distribution Chart

Damage

Sample Data
Count 49992
Mean 56416147.70
Distribution Chart

DTPS

Sample Data enemy1 Damage Taken Per Second
Count 49992
Mean 937897.97
Distribution Chart

HPS

Sample Data enemy1 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy1 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 342373387 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy1"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

enemy2 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for enemy2 Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|&chxp=1,1,-nan,100&chtt=enemy2 DPS Timeline&chts=dddddd,18

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.21% 11.21%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.91% 9.91%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.91%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.67% 9.67%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.83% 10.83%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.47% 10.47%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 9.71% 9.71%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:9.71%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.45% 10.45%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.88% 8.88%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 232345.31
Combat End Resource Mean Min Max
Health 22424.59 0.00 1804839.29
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Distribution Chart

DPS

Sample Data enemy2 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy2 Damage Taken Per Second
Count 49992
Mean 237680.63
Distribution Chart

HPS

Sample Data enemy2 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy2 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 85074417 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy2"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 366.00
Vary Combat Length: 0.00

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.