close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

priest_90_di_fdcl_no2PT14 : 114051 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114050.7 114050.7 21.57 / 0.02% 4057 / 3.6% 21.2 5207.4 5149.0 Mana 0.51% 47.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:303695|237002|137398|130075|91656|91081|77598|44112&chds=0,607391&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++303695++devouring_plague,9482C9,0,0,15|t++237002++halo,9482C9,1,0,15|t++137398++shadow_word_pain,9482C9,2,0,15|t++130075++vampiric_touch,9482C9,3,0,15|t++91656++shadow_word_death,9482C9,4,0,15|t++91081++mind_blast,9482C9,5,0,15|t++77598++mind_spike,4A79D3,6,0,15|t++44112++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,13,11,8,6,6,6,5,4,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|devouring_plague|halo_damage|mind_flay|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadowfiend: melee|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:46666555664356846667642210zyxwwxxyz10zyxwvuutttttutsssrpmlkkklllmmmmmlklllklmnppppoonnmmllmmmnnnmllkkjjjjjlmnomlkkkjijkllmnnooonnmlmnooopqponnnmmlkkjjkklmmmmmmmlllllmnoppponooooooopqrsssrrqqpqrrqpppppppooonnnnoopqqrrrrqqppppooppqqomlkkjihggghhijjjjjjijlllmnopqqqqqponmmlllmmmmmllkjjiiijkklmllllmllkllmnnoppooonnnonnmnnoonnnnnmmlmmmnopqqrrssssssttuvvvusrppppooooppqrrrrqqpqrstsssttttssrqqppppqqrrrrssrrrrqqqqqqrqpppqppooonoooppqqrrrsttttuvwxxyyzzzzyyyxxxxyyyyxxxwwvvuuuuusrqqqppnnnmnmnnnopppoqsttsttvvwwwxxxxwwvvwvvwwwwxxwwwvvuuuuutsstsstsstrrrrrqqqqqq&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6997,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114051|max=163004&chxp=1,1,70,100&chtt=priest_90_di_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,24,32,40,72,48,112,232,224,320,512,672,832,1192,1136,1656,1824,2112,2312,2520,2680,2872,2952,2880,2984,2464,2568,2424,2032,1872,1648,1272,1088,936,728,648,504,464,232,224,136,136,120,72,104,32,8,8,16&chds=0,2984&chbh=5&chxt=x&chxl=0:|min=105448|avg=114051|max=123082&chxp=0,1,49,100&chtt=priest_90_di_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:19.4,16.4,15.9,15.5,15.5,5.9,3.9,2.8,0.5,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 87.5s|shadow_word_pain 74.2s|mind_spike 71.8s|vampiric_touch 70.0s|mind_blast 69.7s|devouring_plague 26.6s|shadow_word_death 17.4s|halo 12.7s|shadowfiend 2.4s|waiting 2.3s&chtt=priest_90_di_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no2PT14 114051
devouring_plague 6761 (17936) 5.9% (15.7%) 22.4 20.59sec 361205 303695 112371 232493 136106 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.39 22.39 0.00 0.00 1.1894 0.0000 3046655.39 3046655.39 0.00 303695.30 303695.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.96 80.24% 112371.30 102399 137090 112393.67 104690 120360 2018493 2018493 0.00
crit 4.42 19.76% 232492.97 210941 282405 230926.08 0 282405 1028162 1028162 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2664 2.3% 53.3 8.00sec 22525 0 18597 38484 22552 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.32 53.26 0.00 0.00 0.0000 0.0000 1201116.18 1201116.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.67 80.11% 18596.60 17006 22766 18598.54 17765 19685 793423 793423 0.00
crit 10.59 19.89% 38483.86 35032 46897 38478.83 35032 43208 407693 407693 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8511 7.5% 22.4 20.59sec 171446 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.4 18574 38467 22521 19.8% 0.0% 28.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.39 22.39 170.41 170.41 0.0000 0.7534 3837812.15 3837812.15 0.00 29892.30 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.6 80.16% 18573.83 17006 30926 18575.36 17730 19439 2537160 2537160 0.00
crit 33.8 19.84% 38466.98 35032 63707 38464.83 36414 41442 1300652 1300652 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6683) 0.0% (5.9%) 10.8 43.22sec 279334 237002 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 10.78 0.00 0.00 1.1786 0.0000 0.00 0.00 0.00 237002.44 237002.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.66 80.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.12 19.62% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6683 5.9% 10.8 43.22sec 279334 0 115130 238232 139665 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 21.56 0.00 0.00 0.0000 0.0000 3011116.03 3011116.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.26 80.07% 115130.16 104363 139821 115145.30 107741 123196 1987392 1987392 0.00
crit 4.30 19.93% 238231.90 214987 288030 236258.30 0 288030 1023724 1023724 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.22sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.78 228.39 0.00 0.00 0.0000 0.0000 0.00 44691379.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.88 77.01% 0.00 0 0 0.00 0 0 0 27626188 100.00
crit 52.51 22.99% 0.00 0 0 0.00 0 0 0 17065191 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14096 12.4% 58.2 7.69sec 109166 91081 89953 186304 109167 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.19 58.19 0.00 0.00 1.1986 0.0000 6352295.92 6352295.92 0.00 91081.48 91081.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.59 80.06% 89953.09 82079 110390 89968.02 86854 93884 4190529 4190529 0.00
crit 11.60 19.94% 186304.01 169082 227403 186316.14 0 204710 2161767 2161767 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 6530 (8576) 5.7% (7.5%) 55.6 7.73sec 69385 44112 0 0 0 0.0% 0.0% 0.0% 0.0% 100.4 24104 50003 29271 20.0% 0.0% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.64 55.64 100.44 100.44 1.5729 0.7327 2939875.26 2939875.26 0.00 44112.38 44112.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.4 80.05% 24103.58 21797 29181 24110.89 23008 25700 1937918 1937918 0.00
crit 20.0 19.95% 50002.69 44901 60113 50016.34 46500 55411 1001958 1001958 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2046 1.8% 31.4 13.14sec 29290 0 24129 50029 29300 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.45 31.43 0.00 0.00 0.0000 0.0000 921016.94 921016.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.16 80.03% 24128.68 21797 29181 24136.43 22568 26442 607034 607034 0.00
crit 6.28 19.97% 50028.59 44901 60113 49917.27 0 60113 313983 313983 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 12365 10.8% 61.0 7.10sec 91438 77598 75426 156154 91436 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.96 60.96 0.00 0.00 1.1783 0.0000 5573796.64 5573796.64 0.00 77598.14 77598.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.87 80.17% 75426.46 68964 93036 75432.31 72023 78619 3685897 3685897 0.00
crit 12.09 19.83% 156153.56 142066 191655 156178.17 142066 176595 1887900 1887900 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3535 3.1% 14.6 4.96sec 109570 91656 90041 186573 109568 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 14.55 0.00 0.00 1.1955 0.0000 1594542.03 1594542.03 0.00 91656.15 91656.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.61 79.77% 90041.30 79678 107383 90123.16 82210 98033 1045275 1045275 0.00
crit 2.94 20.23% 186572.98 164137 221210 178924.72 0 221210 549267 549267 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17323 (22608) 15.2% (19.8%) 62.8 7.17sec 162284 137398 0 0 0 0.0% 0.0% 0.0% 0.0% 449.3 14331 29666 17379 19.9% 0.0% 193.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.79 62.79 449.28 449.28 1.1811 1.9437 7807930.49 7807930.49 0.00 10755.94 137397.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 360.0 80.12% 14330.60 12783 17966 14332.91 14001 14692 5158681 5158681 0.00
crit 89.3 19.88% 29666.25 26333 37009 29670.68 28540 30858 2649249 2649249 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5286 4.6% 140.7 3.17sec 16937 0 13980 28940 16951 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.67 140.55 0.00 0.00 0.0000 0.0000 2382442.48 2382442.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.63 80.14% 13980.20 12783 17110 13982.29 13515 14490 1574607 1574607 0.00
crit 27.91 19.86% 28940.01 26333 35247 28947.02 27391 30954 807835 807835 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2245 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4381 3.8% 94.2 4.74sec 20978 0 17766 35714 21333 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.16 92.59 0.00 0.00 0.0000 0.0000 1975345.50 1975345.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.19 80.12% 17765.98 15875 22484 17769.18 17123 18445 1318032 1318032 0.00
crit 18.41 19.88% 35714.00 31750 44968 35724.50 32934 38670 657313 657313 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15484 (20211) 13.6% (17.7%) 59.0 7.54sec 154301 130075 0 0 0 0.0% 0.0% 0.0% 0.0% 357.4 16105 33351 19526 19.8% 0.0% 177.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.04 59.04 357.43 357.43 1.1863 2.2357 6979288.01 6979288.01 0.00 10481.56 130074.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.5 80.16% 16104.56 14287 20366 16107.09 15609 16660 4614220 4614220 0.00
crit 70.9 19.84% 33350.74 29431 41955 33355.84 31804 35303 2365068 2365068 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4727 4.1% 111.9 3.93sec 19041 0 15707 32536 19056 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.90 111.81 0.00 0.00 0.0000 0.0000 2130635.09 2130635.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.56 80.10% 15706.96 14287 19397 15710.01 15164 16279 1406644 1406644 0.00
crit 22.25 19.90% 32536.27 29431 39957 32544.74 30430 35659 723991 723991 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46201 / 3659
melee 46201 3.2% 31.2 12.61sec 52312 51499 45636 92197 52312 20.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.17 31.17 0.00 0.00 1.0158 0.0000 1630457.25 1630457.25 0.00 51498.97 51498.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 55.77% 45635.96 36329 55931 45655.92 40346 51738 793206 793206 0.00
crit 6.29 20.18% 92196.78 72658 111863 92053.72 0 111863 579786 579786 0.00
glance 7.50 24.06% 34337.79 27247 41949 34350.19 27247 41949 257465 257465 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.42%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.4 2.1 15.8sec 14.7sec 9.06% 45.57%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.06%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.66%
glyph_mind_spike 37.1 23.9 11.8sec 7.1sec 43.50% 69.46%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.51%
  • glyph_mind_spike_2:14.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.6sec 43.60% 43.84%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.60%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.19% 42.19%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.19%

    Trigger Attempt Success

    • trigger_pct:14.49%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.42% 49.49%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.42%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 40.4 30.0 10.8sec 6.2sec 45.97% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.79%
  • surge_of_darkness_2:12.17%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no2PT14
devouring_plague Shadow Orb 22.4 67.2 3.0 3.0 120402.0
halo Mana 10.8 436577.0 40500.0 40500.1 6.9
mind_blast Mana 58.2 270816.5 4654.1 4654.1 23.5
mind_flay Mana 55.6 166930.6 3000.0 3000.0 23.1
shadow_word_death Mana 14.6 113513.1 7800.0 7800.1 14.0
shadow_word_pain Mana 62.8 828877.6 13200.0 13200.1 12.3
vampiric_touch Mana 59.0 531361.4 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.17 153950.21 (6.63%) 4939.39 126560.35 45.12%
Shadow Orbs from Mind Blast Shadow Orb 58.19 58.19 (88.79%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.35 7.35 (11.21%) 1.00 0.00 0.00%
Devouring Plague Health Health 223.67 0.00 (-nan%) 0.00 3106023.61 100.00%
Vampiric Touch Mana Mana 469.24 1764347.09 (75.99%) 3760.02 715667.95 28.86%
mp5_regen Mana 1803.14 403453.01 (17.38%) 223.75 137490.05 25.42%
Resource RPS-Gain RPS-Loss
Mana 5149.04 5207.42
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 273670.19 151800.00 300000.00
Shadow Orb 1.38 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.6%
shadowfiend-Mana Cap 25.6%
lightwell-Mana Cap 25.6%

Procs

Count Interval
Shadowy Recall Extra Tick 337.0 1.3sec
Shadowy Apparition Procced 94.2 4.7sec
Divine Insight Mind Blast CD Reset 52.0 14.7sec
FDCL Mind Spike proc 70.4 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 114050.73
Minimum 105447.61
Maximum 123082.16
Spread ( max - min ) 17634.55
Range [ ( max - min ) / 2 * 100% ] 7.73%
Standard Deviation 2461.0951
5th Percentile 110121.67
95th Percentile 118235.14
( 95th Percentile - 5th Percentile ) 8113.47
Mean Distribution
Standard Deviation 11.0072
95.00% Confidence Intervall ( 114029.16 - 114072.31 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1788
0.1 Scale Factor Error with Delta=300 51705
0.05 Scale Factor Error with Delta=300 206823
0.01 Scale Factor Error with Delta=300 5170594
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114050.73
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49753868.11
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 353.03
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.78 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.55 shadow_word_death,if=active_enemies<=5
F 59.61 mind_blast,if=active_enemies<=6&cooldown_react
G 44.94 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.55 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.09 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.78 halo,if=talent.halo.enabled
M 14.61 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.57 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.81 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 42.87 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 40.04 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.85 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGFGHHLTFTRTJRGFGHHJMRTFJFRWWHHGJFMRRTRRQQQQLFHGFHGJRTFMJHHRTFGGTRHQFHJRTFGDFGLHHTQFTTFMFGFGHFDFHGWWHFHTGRRRFLHMTHGFRTGWWFFHHMFRTTFGGHHJRLFMBWWHFGHQFRTRTFHGHMRGFRWWWWHFHJLRRTFGDFHHJGRRQFFMGRWGHFHQQQQQFTRTRFHHLGGDFJRWRWWHFHQFMQQGFRRTHFHGTQFGLRHHFMRTGRTFHGHRTQFTWWWWFHHMGFRTLTRTFHHGRTFDFGBGFHHJFMRRTREEFGGHHJEDELFJRHHEEFGGDFTEEHHQFMTEE9GFGHHJEDEFJLJRGEEFGHDFH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_fdcl_no4PT14 : 117040 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
117039.7 117039.7 21.39 / 0.02% 4029 / 3.4% 21.8 5206.7 5147.4 Mana 0.51% 47.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:303750|236753|149439|129973|91643|90948|77579|44085&chds=0,607499&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++303750++devouring_plague,9482C9,0,0,15|t++236753++halo,9482C9,1,0,15|t++149439++shadow_word_pain,9482C9,2,0,15|t++129973++vampiric_touch,9482C9,3,0,15|t++91643++shadow_word_death,9482C9,4,0,15|t++90948++mind_blast,9482C9,5,0,15|t++77579++mind_spike,4A79D3,6,0,15|t++44085++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,12,11,8,6,6,6,5,5,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|devouring_plague|halo_damage|mind_flay|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:355655556543567566676432110zyxxxyy0100zywvvuuttuuutsssspnllklllmmmmmmlklllklnoppppooonmmllmmnnnnnmllkkjjjklmnonllkkjjjllmmnnoooonmlmnooopqpoonnnmllkkkkllmmmmnnmmmlllmnopqponopopooopqrsssrrrqqqrrqppppppppoonnnnoppqqrrrrrqqppppopqqqomllkjjihghhiijjjjjjjkllmmnopqrrqqqponmmmmmmmmmmlkkjjjjjklmmmllmmmlllmnnooppppoonooonmnooponnonnmmmmnnopqrrsssssssttuvvvusrpqpppooopqrrrrrrqpqsstststtttssrqqqppqqqrrrsssssrrqqqqqqrqpppqppooooooppqqrrrrsuuutuvwxxyyzzzzzyyyyyyyyyyyxxxwvvuuuuusrqqqpponnnnmnnoopppoqsttsttvwwwwxxxxwwwwwvwwwwwwwwwwvvuuuuutsststuttuwwwwwwwwxyy&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.7040,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=117040|max=166257&chxp=1,1,70,100&chtt=priest_90_di_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,40,24,56,80,144,256,376,496,680,840,1112,1424,1784,1848,2208,2328,2896,2592,3152,2912,3136,2816,2632,2680,2504,1992,1640,1664,1168,1128,760,672,480,432,304,272,152,112,56,16,56,16,16,0,8,16&chds=0,3152&chbh=5&chxt=x&chxl=0:|min=108138|avg=117040|max=126670&chxp=0,1,48,100&chtt=priest_90_di_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:19.4,16.4,15.9,15.5,15.5,5.9,3.9,2.8,0.5,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 87.5s|shadow_word_pain 74.1s|mind_spike 71.9s|vampiric_touch 70.0s|mind_blast 69.7s|devouring_plague 26.6s|shadow_word_death 17.4s|halo 12.7s|shadowfiend 2.4s|waiting 2.3s&chtt=priest_90_di_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no4PT14 117040
devouring_plague 6762 (17926) 5.8% (15.3%) 22.4 20.60sec 361226 303750 112351 232540 136219 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.37 22.37 0.00 0.00 1.1892 0.0000 3047819.24 3047819.24 0.00 303749.67 303749.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.93 80.14% 112350.73 102399 137090 112371.52 106675 118379 2014544 2014544 0.00
crit 4.44 19.86% 232539.75 210941 282405 230203.25 0 282405 1033276 1033276 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2661 2.3% 53.3 8.01sec 22516 0 18594 38466 22544 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.29 53.23 0.00 0.00 0.0000 0.0000 1199923.16 1199923.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.65 80.12% 18593.82 17006 22766 18596.28 17600 19921 792950 792950 0.00
crit 10.58 19.88% 38465.76 35032 46897 38466.58 35032 43794 406973 406973 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8502 7.3% 22.4 20.60sec 171376 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.2 18575 38441 22524 19.9% 0.0% 28.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.37 22.37 170.24 170.24 0.0000 0.7532 3834428.94 3834428.94 0.00 29903.21 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.4 80.12% 18574.60 17006 33422 18576.66 17649 19564 2533407 2533407 0.00
crit 33.8 19.88% 38441.27 35032 68848 38442.14 35859 42182 1301022 1301022 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6677) 0.0% (5.7%) 10.8 43.22sec 279047 236753 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 10.78 0.00 0.00 1.1787 0.0000 0.00 0.00 0.00 236753.46 236753.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.66 80.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.12 19.66% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6677 5.7% 10.8 43.22sec 279047 0 115114 238046 139523 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 21.56 0.00 0.00 0.0000 0.0000 3008426.21 3008426.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.28 80.14% 115114.34 104363 139821 115126.19 106972 122460 1989271 1989271 0.00
crit 4.28 19.86% 238046.21 214987 288030 235149.84 0 288030 1019155 1019155 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.22sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.78 228.45 0.00 0.00 0.0000 0.0000 0.00 44687040.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.95 77.02% 0.00 0 0 0.00 0 0 0 27629148 100.00
crit 52.51 22.98% 0.00 0 0 0.00 0 0 0 17057893 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14062 12.0% 58.2 7.70sec 109012 90948 89936 186297 109012 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.15 58.15 0.00 0.00 1.1986 0.0000 6339374.93 6339374.93 0.00 90948.38 90948.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.64 80.20% 89936.02 82079 110390 89954.52 87085 93237 4194648 4194648 0.00
crit 11.51 19.80% 186296.77 169082 227403 186352.41 170805 215738 2144727 2144727 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 6529 (8571) 5.6% (7.3%) 55.7 7.73sec 69283 44085 0 0 0 0.0% 0.0% 0.0% 0.0% 100.4 24107 49973 29277 20.0% 0.0% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.68 55.68 100.37 100.37 1.5716 0.7325 2938628.61 2938628.61 0.00 44085.15 44085.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.3 80.01% 24107.35 21797 29181 24113.93 23002 25158 1936113 1936113 0.00
crit 20.1 19.99% 49972.98 44901 60113 49988.80 45637 55279 1002515 1002515 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2041 1.7% 31.4 13.17sec 29288 0 24130 50044 29301 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.38 31.36 0.00 0.00 0.0000 0.0000 918954.71 918954.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.11 80.05% 24129.96 21797 29181 24137.03 22562 26482 605788 605788 0.00
crit 6.26 19.95% 50044.33 44901 60113 49938.70 0 60113 313167 313167 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 12362 10.6% 61.0 7.10sec 91426 77579 75434 156093 91426 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.97 60.97 0.00 0.00 1.1785 0.0000 5574079.66 5574079.66 0.00 77579.40 77579.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.88 80.17% 75433.91 68964 93036 75442.57 72344 80289 3687199 3687199 0.00
crit 12.09 19.83% 156092.68 142066 191655 156121.37 142066 176129 1886881 1886881 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3537 3.0% 14.6 4.96sec 109537 91643 90059 186706 109537 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.56 14.56 0.00 0.00 1.1953 0.0000 1595238.00 1595238.00 0.00 91643.48 91643.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.63 79.85% 90058.88 79678 107383 90140.40 81167 98966 1047242 1047242 0.00
crit 2.94 20.15% 186706.31 164137 221210 179750.99 0 221210 547996 547996 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18836 (24581) 16.1% (21.0%) 62.8 7.17sec 176503 149439 0 0 0 0.0% 0.0% 0.0% 0.0% 449.2 14328 29627 18898 29.9% 0.0% 193.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.77 62.77 449.22 449.22 1.1811 1.9438 8489339.47 8489339.47 0.00 11694.47 149439.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 315.0 70.13% 14328.08 12783 17966 14330.60 13935 14722 4513748 4513748 0.00
crit 134.2 29.87% 29627.21 26333 37009 29631.56 28575 30730 3975592 3975592 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5745 4.9% 140.6 3.17sec 18415 0 13975 28897 18431 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.61 140.49 0.00 0.00 0.0000 0.0000 2589324.53 2589324.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.54 70.14% 13975.50 12783 17110 13978.35 13558 14497 1377122 1377122 0.00
crit 41.95 29.86% 28897.08 26333 35247 28903.34 27563 30408 1212202 1212202 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2243 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5467 4.7% 117.6 3.81sec 20966 0 17763 35714 21323 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.56 115.60 0.00 0.00 0.0000 0.0000 2464886.27 2464886.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.67 80.17% 17763.12 15875 22484 17766.48 17218 18338 1646143 1646143 0.00
crit 22.93 19.83% 35713.58 31750 44968 35723.24 33351 38502 818744 818744 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15478 (20196) 13.2% (17.3%) 59.0 7.54sec 154208 129973 0 0 0 0.0% 0.0% 0.0% 0.0% 357.3 16104 33349 19524 19.8% 0.0% 177.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.03 59.03 357.34 357.34 1.1865 2.2357 6976735.49 6976735.49 0.00 10476.36 129973.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.5 80.17% 16104.25 14287 20366 16106.49 15630 16617 4613465 4613465 0.00
crit 70.9 19.83% 33348.87 29431 41955 33353.98 31913 35057 2363270 2363270 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4718 4.0% 111.8 3.93sec 19020 0 15704 32519 19035 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.81 111.72 0.00 0.00 0.0000 0.0000 2126596.10 2126596.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.59 80.19% 15704.36 14287 19397 15707.45 15149 16361 1406934 1406934 0.00
crit 22.13 19.81% 32518.87 29431 39957 32526.90 30315 35579 719662 719662 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46228 / 3661
melee 46228 3.1% 31.2 12.61sec 52361 51545 45632 92217 52361 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.16 31.16 0.00 0.00 1.0158 0.0000 1631822.01 1631822.01 0.00 51545.33 51545.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.36 55.69% 45632.49 36329 55931 45652.36 41317 52013 792039 792039 0.00
crit 6.32 20.27% 92217.49 72658 111863 92160.61 0 111863 582613 582613 0.00
glance 7.49 24.03% 34335.44 27247 41949 34352.14 0 41949 257170 257170 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1997 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.42%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.4 2.1 15.9sec 14.7sec 9.08% 45.52%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.08%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.48%
glyph_mind_spike 37.0 23.9 11.8sec 7.1sec 43.52% 69.71%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.55%
  • glyph_mind_spike_2:14.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 9.0 36.7sec 20.7sec 43.53% 43.78%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.53%

    Trigger Attempt Success

    • trigger_pct:1.71%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.18% 42.18%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.18%

    Trigger Attempt Success

    • trigger_pct:14.41%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.4sec 10.4sec 9.43% 49.49%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.43%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 40.4 29.9 10.8sec 6.2sec 45.92% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.81%
  • surge_of_darkness_2:12.11%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no4PT14
devouring_plague Shadow Orb 22.4 67.1 3.0 3.0 120408.9
halo Mana 10.8 436628.9 40500.0 40499.5 6.9
mind_blast Mana 58.2 270682.6 4654.7 4654.7 23.4
mind_flay Mana 55.7 167035.2 3000.0 3000.0 23.1
shadow_word_death Mana 14.6 113599.2 7800.0 7800.3 14.0
shadow_word_pain Mana 62.8 828531.3 13200.0 13200.0 13.4
vampiric_touch Mana 59.0 531296.6 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.16 154012.18 (6.64%) 4941.86 126471.02 45.09%
Shadow Orbs from Mind Blast Shadow Orb 58.15 58.15 (88.77%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.36 7.36 (11.23%) 1.00 0.00 0.00%
Devouring Plague Health Health 223.46 0.00 (-nan%) 0.00 3103115.20 100.00%
Vampiric Touch Mana Mana 469.06 1763566.70 (75.98%) 3759.79 715637.62 28.87%
mp5_regen Mana 1803.14 403447.63 (17.38%) 223.75 137495.42 25.42%
Resource RPS-Gain RPS-Loss
Mana 5147.43 5206.75
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 273249.06 140700.00 300000.00
Shadow Orb 1.39 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.6%
shadowfiend-Mana Cap 25.6%
lightwell-Mana Cap 25.6%

Procs

Count Interval
Shadowy Recall Extra Tick 336.8 1.3sec
Shadowy Apparition Procced 117.6 3.8sec
Divine Insight Mind Blast CD Reset 51.9 14.7sec
FDCL Mind Spike proc 70.3 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 117039.66
Minimum 108137.55
Maximum 126669.66
Spread ( max - min ) 18532.11
Range [ ( max - min ) / 2 * 100% ] 7.92%
Standard Deviation 2440.0497
5th Percentile 113114.13
95th Percentile 121171.25
( 95th Percentile - 5th Percentile ) 8057.11
Mean Distribution
Standard Deviation 10.9131
95.00% Confidence Intervall ( 117018.27 - 117061.05 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1669
0.1 Scale Factor Error with Delta=300 50825
0.05 Scale Factor Error with Delta=300 203301
0.01 Scale Factor Error with Delta=300 5082542
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 117039.66
Distribution Chart

Damage

Sample Data
Count 49992
Mean 51103755.30
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 353.02
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.77 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.56 shadow_word_death,if=active_enemies<=5
F 59.58 mind_blast,if=active_enemies<=6&cooldown_react
G 44.91 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.57 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.02 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.78 halo,if=talent.halo.enabled
M 14.61 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.58 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.75 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 42.94 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 40.11 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.86 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTRTFTGGHHFJRTRWWFMWHHGFRRFTLJRTHFGHDFGTFRWHHFJMRTGQFRTHHGQFLJRTWWFGHHMTFTRTGHFGHTQFGFMHLHTFGTJRTGHFHFJMRTRGFJHFGHJRTQFMLTGHHFTGTRBWWFHGHRRTFMTHRHGFJRGLJRWFHHTQFMRTGHTFGHRTGRFGHHTLFMTRTFGHHGJRQFRWWWFHHMTRGFRTHHGFLTGWWFHHDFQQQFRTTHFGGHMRTWWWWFHHLTGJRFTHRRGFHMRTGGBRFHHTQFRTEEGGFHHDEELRFWTHEDEFGHHTFEDEGFHJHRE9EFGMRHLEEFGHTRFDEEGHRQF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no2PT14 : 111772 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
111772.0 111772.0 19.89 / 0.02% 3751 / 3.4% 18.1 5637.1 5578.1 Mana 0.48% 42.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:302653|236881|129718|119955|91878|89928|45087&chds=0,605307&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302653++devouring_plague,9482C9,0,0,15|t++236881++halo,9482C9,1,0,15|t++129718++vampiric_touch,9482C9,2,0,15|t++119955++shadow_word_pain,9482C9,3,0,15|t++91878++shadow_word_death,9482C9,4,0,15|t++89928++mind_blast,9482C9,5,0,15|t++45087++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,13,11,10,8,7,6,5,5,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_flay|mindbender: melee|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_mb_no2PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:z13666666653567466686421ywwvutssttvxwvutsrrrrqrqrrqpooonllkklmnopqqrrqqqqrqqrsssrqponlkjiiijjkkkjihhhhhhhhijklkjihhgiillmopqrstttsrstuuuuutrqonmljjhggghiijijjjjiiiijklmmnmmlkkkkkjjkklmnnnnoonnoooooooppoonnlllllllmmnnnnnnmmmmmlmnnnljihggggggghiklmnopqqrssttuuuuuttrqonmkjhhhhhhhhhhgggggghijkjjjjjjjjklmnopqqrsstttutssstssrqponmmllkkjklmnnoppqqqrrrssttrqponllkkjjjkklllmnnnpqrrrstuuuuttsrrqppoooooooppppooooooooonmnnnmmllmmnopqrstvwxz000112343322100zyxwvvuuuuuuuuuuutttsssrppppoommmmnnoppqrstuxz00011232212000yxwwvutttuuuuuuuuuuttttsrrsrrrqonllkkjjiiihg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6881,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=111772|max=162442&chxp=1,1,69,100&chtt=priest_90_di_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,16,32,40,64,184,264,328,528,648,840,1152,1480,1816,2136,2448,2920,2824,3272,3056,3064,3224,2992,2544,2520,2040,1968,1704,1384,1008,848,608,504,464,376,176,192,128,56,32,48,0,16,0,0,0,16,0,16&chds=0,3272&chbh=5&chxt=x&chxl=0:|min=104027|avg=111772|max=122043&chxp=0,1,43,100&chtt=priest_90_di_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.7,19.3,15.5,14.5,5.5,3.8,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 143.0s|shadow_word_pain 87.1s|vampiric_touch 69.7s|mind_blast 65.3s|devouring_plague 24.9s|shadow_word_death 17.3s|halo 12.8s|mindbender 8.3s|waiting 2.2s&chtt=priest_90_di_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no2PT14 111772
devouring_plague 6347 (16738) 5.7% (15.0%) 21.0 22.08sec 360205 302653 112439 232929 136507 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 0.00 0.00 1.1902 0.0000 2860065.73 2860065.73 0.00 302653.39 302653.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.77 80.03% 112439.38 102399 137090 112461.70 106851 120231 1885259 1885259 0.00
crit 4.18 19.97% 232928.77 210941 282405 230922.64 0 282405 974807 974807 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2475 2.2% 49.6 8.59sec 22509 0 18609 38528 22541 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.59 49.52 0.00 0.00 0.0000 0.0000 1116310.39 1116310.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.75 80.26% 18609.11 17006 22766 18610.88 17454 19703 739641 739641 0.00
crit 9.78 19.74% 38528.03 35032 46897 38522.35 0 44793 376670 376670 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7917 7.1% 21.0 22.08sec 170419 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.5 18588 38481 22523 19.8% 0.0% 26.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 158.53 158.53 0.0000 0.7538 3570588.82 3570588.82 0.00 29880.15 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.2 80.22% 18588.08 17006 37377 18589.57 17720 20515 2363896 2363896 0.00
crit 31.4 19.78% 38480.90 35032 76996 38480.85 35722 41474 1206693 1206693 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6731) 0.0% (6.0%) 10.9 42.98sec 279353 236881 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.85 10.85 0.00 0.00 1.1793 0.0000 0.00 0.00 0.00 236881.24 236881.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.69 80.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.16 19.89% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6731 6.0% 10.9 42.98sec 279353 0 115096 238194 139676 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.85 21.71 0.00 0.00 0.0000 0.0000 3031842.97 3031842.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 80.03% 115096.21 104363 139821 115128.67 106962 123965 1999437 1999437 0.00
crit 4.33 19.97% 238194.50 214987 288030 236213.77 0 288030 1032406 1032406 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.98sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.85 228.62 0.00 0.00 0.0000 0.0000 0.00 44727785.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.05 77.00% 0.00 0 0 0.00 0 0 0 27646275 100.00
crit 52.57 23.00% 0.00 0 0 0.00 0 0 0 17081510 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13035 11.7% 53.9 8.32sec 109120 89928 89958 186304 109120 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.85 53.85 0.00 0.00 1.2134 0.0000 5876324.17 5876324.17 0.00 89927.68 89927.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.14 80.11% 89957.81 82079 110390 89973.26 87065 93278 3880948 3880948 0.00
crit 10.71 19.89% 186303.65 169082 227403 186350.18 169082 208218 1995376 1995376 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10915 (14326) 9.8% (12.8%) 88.9 4.93sec 72493 45087 0 0 0 0.0% 0.0% 0.0% 0.0% 168.4 24024 49793 29173 20.0% 0.0% 27.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.93 88.93 168.37 168.37 1.6078 0.7358 4911785.27 4911785.27 0.00 45087.48 45087.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.7 80.02% 24024.20 21797 29181 24029.46 23357 24843 3236587 3236587 0.00
crit 33.6 19.98% 49792.69 44901 60113 49801.86 47302 53546 1675199 1675199 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3412 3.0% 52.6 8.14sec 29186 0 24041 49823 29198 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.60 52.58 0.00 0.00 0.0000 0.0000 1535228.30 1535228.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.06 79.99% 24040.82 21797 29181 24046.33 22927 25466 1011143 1011143 0.00
crit 10.52 20.01% 49822.77 44901 60113 49838.02 44901 60113 524085 524085 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1987 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3527 3.2% 14.5 4.99sec 109811 91878 90030 186970 109809 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.47 14.47 0.00 0.00 1.1952 0.0000 1589392.03 1589392.03 0.00 91877.68 91877.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.52 79.59% 90030.10 79678 107383 90117.35 81081 101685 1037186 1037186 0.00
crit 2.95 20.41% 186969.77 164137 221210 180101.02 0 221210 552206 552206 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17749 (23169) 15.9% (20.7%) 73.7 6.10sec 141694 119955 0 0 0 0.0% 0.0% 0.0% 0.0% 460.9 14319 29641 17360 19.8% 0.0% 194.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.71 73.71 460.90 460.90 1.1812 1.8981 8001082.34 8001082.34 0.00 10857.56 119955.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 369.4 80.16% 14319.00 12783 17966 14321.11 14001 14755 5290017 5290017 0.00
crit 91.5 19.84% 29640.81 26333 37009 29646.25 28450 30866 2711065 2711065 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5420 4.9% 144.2 3.10sec 16945 0 13979 28942 16959 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.17 144.05 0.00 0.00 0.0000 0.0000 2443047.86 2443047.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.36 80.08% 13978.54 12783 17110 13981.12 13557 14467 1612505 1612505 0.00
crit 28.70 19.92% 28941.51 26333 35247 28947.92 27339 31092 830543 830543 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4436 4.0% 95.4 4.68sec 20968 0 17760 35701 21333 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.38 93.75 0.00 0.00 0.0000 0.0000 2000029.24 2000029.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.08 80.09% 17759.92 15875 22484 17763.63 17162 18392 1333469 1333469 0.00
crit 18.67 19.91% 35701.03 31750 44968 35711.77 33098 38717 666560 666560 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15372 (20063) 13.8% (18.0%) 58.7 7.58sec 154129 129718 0 0 0 0.0% 0.0% 0.0% 0.0% 355.1 16093 33326 19511 19.8% 0.0% 176.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.67 58.67 355.12 355.12 1.1882 2.2353 6928556.81 6928556.81 0.00 10472.14 129718.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 284.7 80.17% 16092.93 14287 20366 16095.32 15698 16721 4581581 4581581 0.00
crit 70.4 19.83% 33325.63 29431 41955 33331.58 31655 34971 2346975 2346975 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4691 4.2% 111.0 3.96sec 19047 0 15709 32542 19062 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.99 110.91 0.00 0.00 0.0000 0.0000 2114118.65 2114118.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.81 80.08% 15709.29 14287 19397 15712.56 15000 16288 1395184 1395184 0.00
crit 22.09 19.92% 32541.99 29431 39957 32548.30 30086 35437 718935 718935 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37653 / 9747
melee 37653 8.7% 105.2 4.17sec 41725 39146 36412 73375 41725 20.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.19 105.19 0.00 0.00 1.0659 0.0000 4388858.06 4388858.06 0.00 39145.69 39145.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.75 55.85% 36411.59 29063 44745 36422.66 34725 38485 2139023 2139023 0.00
crit 21.27 20.23% 73375.03 58126 89490 73380.41 66955 79821 1560982 1560982 0.00
glance 25.17 23.93% 27371.31 21797 33559 27377.89 25120 29702 688853 688853 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.1916 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.43%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.7 2.6 15.7sec 14.3sec 10.56% 48.35%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.56%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.45%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.5sec 20.6sec 43.67% 43.95%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.67%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.31% 42.31%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.31%

    Trigger Attempt Success

    • trigger_pct:14.32%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.38% 49.52%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no2PT14
devouring_plague Shadow Orb 21.0 62.9 3.0 3.0 120067.5
halo Mana 10.9 439551.4 40500.0 40500.1 6.9
mind_blast Mana 53.9 221610.2 4115.1 4115.2 26.5
mind_flay Mana 88.9 266799.4 3000.0 3000.0 24.2
shadow_word_death Mana 14.5 112900.3 7800.0 7800.3 14.1
shadow_word_pain Mana 73.7 972956.2 13200.0 13199.9 10.7
vampiric_touch Mana 58.7 528025.0 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.19 288453.60 (11.47%) 2742.29 172365.81 37.40%
Shadow Orbs from Mind Blast Shadow Orb 53.85 53.85 (88.05%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.31 7.31 (11.95%) 1.00 0.00 0.00%
Devouring Plague Health Health 208.06 0.00 (-nan%) 0.00 2889183.64 100.00%
Vampiric Touch Mana Mana 466.03 1812589.01 (72.07%) 3889.45 650851.15 26.42%
mp5_regen Mana 1803.14 414165.72 (16.47%) 229.69 126777.34 23.44%
Resource RPS-Gain RPS-Loss
Mana 5578.08 5637.14
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 273361.91 124323.81 300000.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.6%
shadowfiend-Mana Cap 23.6%
lightwell-Mana Cap 23.6%

Procs

Count Interval
Shadowy Recall Extra Tick 357.1 1.2sec
Shadowy Apparition Procced 95.4 4.7sec
Divine Insight Mind Blast CD Reset 53.4 14.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no2PT14 Damage Per Second
Count 49992
Mean 111772.01
Minimum 104027.03
Maximum 122043.16
Spread ( max - min ) 18016.13
Range [ ( max - min ) / 2 * 100% ] 8.06%
Standard Deviation 2268.6970
5th Percentile 108154.32
95th Percentile 115655.98
( 95th Percentile - 5th Percentile ) 7501.66
Mean Distribution
Standard Deviation 10.1467
95.00% Confidence Intervall ( 111752.12 - 111791.90 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1582
0.1 Scale Factor Error with Delta=300 43937
0.05 Scale Factor Error with Delta=300 175750
0.01 Scale Factor Error with Delta=300 4393763
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 111772.01
Distribution Chart

Damage

Sample Data
Count 49992
Mean 45978372.58
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 316.43
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.77 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.47 shadow_word_death,if=active_enemies<=5
F 56.69 mind_blast,if=active_enemies<=6&cooldown_react
G 43.54 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.43 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.85 halo,if=talent.halo.enabled
M 14.18 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.77 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 17.58 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 54.06 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 30.17 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTQQFTGGHHFMTWWWWWFHGHTFLTHHQQGFTFGMAFWHHTFTGTHHFMGTLTFWGWHHTFTTHFDFGGFHFMGAWHQFLTHTGTQFTHTGHFMTGWWWFHHTFTTHFGHGLMTFFAFHHTGTFGDFHTHTFQQQQQQFMGTWWWWFHHLTQQFTGTHHTFGMTGWAFGHHTFTFLGDFGHHTFWWWTFHHMGTTFTFGHFHMTGFALTHHGFTTGFHHMTGWWWWFTHHTGTFTLTHFGHMQQQQQFGGWWAHFHTQFMEEGHGHFLEDEFWWHHGEEFMTTQQFEEHGHTFDEE9GWHAFHEDELQQQFTFTEDEGGHFH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no4PT14 : 114885 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114885.5 114885.5 20.14 / 0.02% 3726 / 3.2% 18.6 5640.7 5580.4 Mana 0.48% 42.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:302850|236571|130294|129847|91702|90013|45078&chds=0,605701&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302850++devouring_plague,9482C9,0,0,15|t++236571++halo,9482C9,1,0,15|t++130294++shadow_word_pain,9482C9,2,0,15|t++129847++vampiric_touch,9482C9,3,0,15|t++91702++shadow_word_death,9482C9,4,0,15|t++90013++mind_blast,9482C9,5,0,15|t++45078++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,15,12,10,9,8,6,6,6,5,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_flay|mindbender: melee|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_mb_no4PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:z13565556543567466686431yxwvutsttuvxwvutsrrrrrrrrrqqoopnlllllmoppqrrrrqqrrqqrsssrrponlkkjijjjkkkkiiihhhhhhijklkjihhhiilmnopqsstttsrstuvuuutrqpomlkjihghhijjjjjjjjjiijllmnnnmlkkkkkkkklmnnnnnoonnoooooppppoonnmmllllmmnnnoonnnnmmmmmnnnljiihgggggghjklmnopqqrssttuuuuuttsqonmljihhiihhhhhhgggghiijkjjjjjjjkklmnopqqrsstttutssstssrqponmmmlkkkklmnooppqqrrrrssttrqponmlkkkkkkkllmmnnnpqrrrttuuuuutsrrrqpoooooooppppoooooooooonnnnmnmmmnnopqrstvwxy000012333222100zyyxwvvuuuuuuuuuuttttssrppppoonmmmnnoppqrstuwz000012222110zzyxwvvuttttuuuuuuuutttttsrrrrqqqponnnmmlllllk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6909,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114885|max=166289&chxp=1,1,69,100&chtt=priest_90_di_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,32,32,40,88,168,304,320,496,912,1360,1624,2048,2768,2792,3272,3568,3952,3440,3272,3408,2992,2536,2536,1848,1608,1208,904,688,600,376,176,200,192,40,64,56,24,8,16,0,0,0,8,0,0,0,8&chds=0,3952&chbh=5&chxt=x&chxl=0:|min=106253|avg=114885|max=127173&chxp=0,1,41,100&chtt=priest_90_di_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.7,19.3,15.4,14.5,5.5,3.8,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 143.0s|shadow_word_pain 87.2s|vampiric_touch 69.7s|mind_blast 65.3s|devouring_plague 24.9s|shadow_word_death 17.3s|halo 12.8s|mindbender 8.3s|waiting 2.1s&chtt=priest_90_di_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no4PT14 114885
devouring_plague 6346 (16751) 5.5% (14.6%) 21.0 22.08sec 360416 302850 112438 232863 136439 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 0.00 0.00 1.1901 0.0000 2858471.03 2858471.03 0.00 302850.28 302850.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.78 80.07% 112437.50 102399 137090 112465.78 105441 118123 1886161 1886161 0.00
crit 4.18 19.93% 232862.50 210941 282405 230488.96 0 282405 972310 972310 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2480 2.2% 49.7 8.57sec 22512 0 18604 38523 22542 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.69 49.63 0.00 0.00 0.0000 0.0000 1118680.12 1118680.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.82 80.23% 18603.85 17006 22766 18605.66 17667 19762 740727 740727 0.00
crit 9.81 19.77% 38523.43 35032 46897 38519.05 35032 44838 377953 377953 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7925 6.9% 21.0 22.08sec 170582 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.6 18584 38481 22530 19.8% 0.0% 26.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 158.62 158.62 0.0000 0.7537 3573814.82 3573814.82 0.00 29893.64 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.2 80.17% 18583.89 17006 32152 18586.13 17775 19767 2363191 2363191 0.00
crit 31.5 19.83% 38481.27 35032 66233 38483.31 36150 41739 1210624 1210624 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6723) 0.0% (5.8%) 10.9 42.96sec 278864 236571 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 10.86 0.00 0.00 1.1788 0.0000 0.00 0.00 0.00 236570.64 236570.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 80.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.13 19.66% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6723 5.8% 10.9 42.96sec 278864 0 115089 238200 139436 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 21.72 0.00 0.00 0.0000 0.0000 3028104.17 3028104.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.42 80.23% 115088.81 104363 139821 115111.20 109039 122911 2005209 2005209 0.00
crit 4.29 19.77% 238199.58 214987 288030 235697.14 0 288030 1022895 1022895 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.96sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.86 228.71 0.00 0.00 0.0000 0.0000 0.00 44719180.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.27 77.07% 0.00 0 0 0.00 0 0 0 27680721 100.00
crit 52.44 22.93% 0.00 0 0 0.00 0 0 0 17038460 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13047 11.4% 53.8 8.32sec 109213 90013 89964 186260 109211 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.84 53.84 0.00 0.00 1.2133 0.0000 5880370.34 5880370.34 0.00 90013.02 90013.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.08 80.01% 89964.01 82079 110390 89982.41 86512 93483 3875686 3875686 0.00
crit 10.76 19.99% 186260.47 169082 227403 186292.76 0 211416 2004684 2004684 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10906 (14320) 9.5% (12.4%) 88.9 4.93sec 72488 45078 0 0 0 0.0% 0.0% 0.0% 0.0% 168.4 24020 49782 29151 19.9% 0.0% 27.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.91 88.91 168.39 168.39 1.6080 0.7358 4908719.47 4908719.47 0.00 45078.42 45078.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.8 80.08% 24020.27 21797 29181 24025.42 23323 24878 3239030 3239030 0.00
crit 33.5 19.92% 49782.01 44901 60113 49790.47 46946 53042 1669690 1669690 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3414 3.0% 52.7 8.13sec 29175 0 24037 49857 29188 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.66 52.64 0.00 0.00 0.0000 0.0000 1536457.76 1536457.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.14 80.05% 24036.57 21797 29181 24042.12 22758 25467 1012851 1012851 0.00
crit 10.50 19.95% 49857.30 44901 60113 49861.72 0 57610 523607 523607 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1984 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3522 3.1% 14.5 4.99sec 109584 91702 90078 186670 109582 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.49 14.49 0.00 0.00 1.1951 0.0000 1587628.37 1587628.37 0.00 91701.52 91701.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.56 79.81% 90077.52 79678 107383 90164.82 82656 99613 1041480 1041480 0.00
crit 2.93 20.19% 186670.21 164137 221210 179323.52 0 221210 546148 546148 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19312 (25204) 16.8% (21.9%) 73.8 6.09sec 153915 130294 0 0 0 0.0% 0.0% 0.0% 0.0% 461.1 14316 29599 18881 29.9% 0.0% 194.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.81 73.81 461.07 461.07 1.1813 1.8977 8705441.20 8705441.20 0.00 11807.74 130294.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 323.3 70.13% 14316.17 12783 17966 14318.25 13998 14682 4629126 4629126 0.00
crit 137.7 29.87% 29599.20 26333 37009 29603.56 28672 30594 4076316 4076316 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5892 5.1% 144.3 3.09sec 18407 0 13974 28885 18423 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.28 144.15 0.00 0.00 0.0000 0.0000 2655692.42 2655692.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.14 70.16% 13973.50 12783 17110 13975.85 13551 14484 1413252 1413252 0.00
crit 43.01 29.84% 28885.46 26333 35247 28890.32 27595 30867 1242441 1242441 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5521 4.8% 118.7 3.77sec 20963 0 17758 35707 21321 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.75 116.75 0.00 0.00 0.0000 0.0000 2489246.85 2489246.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.57 80.15% 17758.44 15875 22484 17762.03 17251 18329 1661676 1661676 0.00
crit 23.18 19.85% 35707.23 31750 44968 35715.35 33689 38319 827571 827571 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15368 (20065) 13.4% (17.5%) 58.6 7.58sec 154263 129847 0 0 0 0.0% 0.0% 0.0% 0.0% 355.0 16092 33333 19514 19.9% 0.0% 176.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.63 58.63 354.97 354.97 1.1880 2.2351 6927087.37 6927087.37 0.00 10479.37 129847.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 284.5 80.15% 16091.82 14287 20366 16094.29 15600 16597 4578294 4578294 0.00
crit 70.5 19.85% 33333.16 29431 41955 33337.73 31966 35021 2348793 2348793 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4697 4.1% 111.2 3.95sec 19041 0 15710 32537 19057 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.18 111.09 0.00 0.00 0.0000 0.0000 2117021.22 2117021.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.99 80.11% 15710.03 14287 19397 15713.18 15156 16294 1398073 1398073 0.00
crit 22.10 19.89% 32537.03 29431 39957 32543.00 30297 34935 718949 718949 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37600 / 9733
melee 37600 8.5% 105.2 4.17sec 41670 39099 36421 73374 41670 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.18 105.18 0.00 0.00 1.0658 0.0000 4382697.55 4382697.55 0.00 39098.76 39098.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.84 55.94% 36420.76 29063 44745 36432.10 34650 38259 2142827 2142827 0.00
crit 21.12 20.08% 73373.62 58126 89490 73389.22 66505 80891 1549658 1549658 0.00
glance 25.22 23.98% 27366.89 21797 33559 27373.00 25276 30552 690213 690213 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 1.1914 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.43%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.6 2.6 15.7sec 14.3sec 10.50% 48.30%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.50%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.51%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.58% 43.83%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.58%

    Trigger Attempt Success

    • trigger_pct:1.71%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.31% 42.31%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.31%

    Trigger Attempt Success

    • trigger_pct:14.23%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.38% 49.53%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no4PT14
devouring_plague Shadow Orb 21.0 62.9 3.0 3.0 120138.5
halo Mana 10.9 439771.7 40500.0 40499.5 6.9
mind_blast Mana 53.8 221940.0 4122.0 4122.0 26.5
mind_flay Mana 88.9 266742.7 3000.0 3000.0 24.2
shadow_word_death Mana 14.5 113008.9 7800.0 7800.3 14.0
shadow_word_pain Mana 73.8 974343.7 13200.0 13199.9 11.7
vampiric_touch Mana 58.6 527649.1 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.18 289232.82 (11.49%) 2749.97 171541.03 37.23%
Shadow Orbs from Mind Blast Shadow Orb 53.84 53.84 (88.04%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.31 7.31 (11.96%) 1.00 0.00 0.00%
Devouring Plague Health Health 208.25 0.00 (-nan%) 0.00 2891923.19 100.00%
Vampiric Touch Mana Mana 466.06 1812675.04 (72.04%) 3889.33 650441.60 26.41%
mp5_regen Mana 1803.14 414362.70 (16.47%) 229.80 126580.36 23.40%
Resource RPS-Gain RPS-Loss
Mana 5580.43 5640.72
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 272812.40 137652.38 300000.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.5%
shadowfiend-Mana Cap 23.5%
lightwell-Mana Cap 23.5%

Procs

Count Interval
Shadowy Recall Extra Tick 357.5 1.2sec
Shadowy Apparition Procced 118.7 3.8sec
Divine Insight Mind Blast CD Reset 53.3 14.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no4PT14 Damage Per Second
Count 49992
Mean 114885.47
Minimum 106252.85
Maximum 127173.16
Spread ( max - min ) 20920.32
Range [ ( max - min ) / 2 * 100% ] 9.10%
Standard Deviation 2297.7027
5th Percentile 111324.35
95th Percentile 118776.67
( 95th Percentile - 5th Percentile ) 7452.32
Mean Distribution
Standard Deviation 10.2765
95.00% Confidence Intervall ( 114865.33 - 114905.61 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1536
0.1 Scale Factor Error with Delta=300 45068
0.05 Scale Factor Error with Delta=300 180273
0.01 Scale Factor Error with Delta=300 4506831
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114885.47
Distribution Chart

Damage

Sample Data
Count 49992
Mean 47386735.13
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 316.28
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.72 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.49 shadow_word_death,if=active_enemies<=5
F 56.66 mind_blast,if=active_enemies<=6&cooldown_react
G 43.53 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.39 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.86 halo,if=talent.halo.enabled
M 14.23 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.77 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 17.42 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 54.02 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 30.28 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTTGFGHHMTFTWFWWWHHTGFMTLTFHHGTGTFAWFHFHMTGFTHHGTFLTWFMGHHTFTTFGHHFGDFTAGWFHHLTGTFMTHHGTFTWGWWFHHTFMQFHGHLGTFTWAFHHGMTQFTTHHGFTGTWFLMHFHTFTTGGHFHMTQFGWAGHFHQQQFTLTFHDFGGHTWWWWFHQQQQHFMTGTFTHFGHLTFGFAHMHQQQQFGTTFHGHQQQFMTGWWWWFHHLTGTFTHHGFMTGGWFAHHTFTTFDEEGGFHFDEELWFHTFDEEGHTFHPEDEGTFHE9EGHAFHDEEGLTFHTEDEFGHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no2PT14 : 111009 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
111009.2 111009.2 21.08 / 0.02% 3948 / 3.6% 17.9 5999.5 5906.7 Mana 0.41% 43.5 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:302604|236469|143481|130145|111280|91559|89696|45088&chds=0,605208&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302604++devouring_plague,9482C9,0,0,15|t++236469++halo,9482C9,1,0,15|t++143481++shadow_word_insanity,9482C9,2,0,15|t++130145++vampiric_touch,9482C9,3,0,15|t++111280++shadow_word_pain,9482C9,4,0,15|t++91559++shadow_word_death,9482C9,5,0,15|t++89696++mind_blast,9482C9,6,0,15|t++45088++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,12,9,9,7,6,6,5,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|shadow_word_insanity|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_swi_no2PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:3445434666535684666753210zzxvutuuvwxxwvussrrqqqqqrqpponlihhhhhiiiiijjjiijjijlmnonnmmmllkjjjkklmmlkkjjijjjjklnonlkkjiihiikkllmmmmmkjklllmnnonmlkjjhhhggghhijijjjjjjjjklmnoonnmmnnnnnnoprsrqqpppoppqpooppqponmlllllmmnooppqppponnnnnopppnmkkjihgffffgghhiiihghijklmnopppoonmlkkjjkkkkjjiiihhhghijjkkkjjjkjjjjkklmmnnnmmmlmnmmlmnoonnnmmllkkklmmnoppqqqppqqrrsttusqpoooonnnnoopqpppppopqrsrrrrrrrqpononnnnoopppqqqqqqqqpqqqqqpoooonnnmmmmmnnoopppprsssstuvwwxxxxxyxxwwwwwwwwwvvvuuutttsssrppppoonmmmmlmmnnooooqssssttuuuuuvuuutttttttttuuuuuuuuuuuuuutsssssttssttttttuuttu&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6730,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=111009|max=164953&chxp=1,1,67,100&chtt=priest_90_di_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,32,16,40,96,112,176,400,400,560,768,1008,1400,1640,2016,2352,2800,3240,3368,3096,3152,3008,2792,2600,2800,2416,1968,1656,1344,1048,992,768,560,360,296,248,152,120,48,56,24,16,8,16,0,8,0,0,8&chds=0,3368&chbh=5&chxt=x&chxl=0:|min=102568|avg=111009|max=121994&chxp=0,1,43,100&chtt=priest_90_di_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:26.7,19.7,15.6,14.3,6.5,5.5,3.8,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 120.3s|shadow_word_pain 88.9s|vampiric_touch 70.2s|mind_blast 64.6s|shadow_word_insanity 29.1s|devouring_plague 24.6s|shadow_word_death 17.3s|halo 12.7s|shadowfiend 2.4s|waiting 1.8s&chtt=priest_90_di_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no2PT14 111009
devouring_plague 6273 (16542) 5.7% (14.9%) 20.7 22.36sec 360219 302604 112392 232718 136533 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.70 20.70 0.00 0.00 1.1904 0.0000 2826104.13 2826104.13 0.00 302604.22 302604.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.55 79.94% 112392.37 102399 137090 112421.27 106206 118970 1859668 1859668 0.00
crit 4.15 20.06% 232718.08 210941 282405 229982.33 0 282405 966436 966436 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2447 2.2% 48.9 8.70sec 22543 0 18599 38516 22572 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.91 48.85 0.00 0.00 0.0000 0.0000 1102681.64 1102681.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.11 80.05% 18599.17 17006 22766 18600.69 17438 19716 727374 727374 0.00
crit 9.74 19.95% 38515.63 35032 46897 38514.13 0 45197 375308 375308 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7822 7.1% 20.7 22.36sec 170413 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.7 18572 38447 22509 19.8% 0.0% 26.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.70 20.70 156.71 156.71 0.0000 0.7537 3527382.21 3527382.21 0.00 29866.49 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.7 80.19% 18571.68 17006 29771 18574.00 17807 19670 2333717 2333717 0.00
crit 31.0 19.81% 38447.47 35032 61328 38447.38 36129 42045 1193665 1193665 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6640) 0.0% (6.0%) 10.7 43.55sec 279199 236469 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.72 10.72 0.00 0.00 1.1808 0.0000 0.00 0.00 0.00 236468.71 236468.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.60 80.19% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.12 19.81% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6640 6.0% 10.7 43.55sec 279199 0 115132 238183 139597 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.72 21.44 0.00 0.00 0.0000 0.0000 2992511.46 2992511.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.17 80.12% 115132.31 104363 139821 115143.06 108092 124040 1977272 1977272 0.00
crit 4.26 19.88% 238182.53 214987 288030 235838.29 0 288030 1015239 1015239 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.7 43.55sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.72 227.67 0.00 0.00 0.0000 0.0000 0.00 44490613.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.64 77.15% 0.00 0 0 0.00 0 0 0 27584278 100.00
crit 52.03 22.85% 0.00 0 0 0.00 0 0 0 16906335 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12851 11.6% 53.1 8.44sec 109044 89696 89975 186321 109044 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.11 53.11 0.00 0.00 1.2157 0.0000 5791520.38 5791520.38 0.00 89696.45 89696.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.60 80.21% 89975.00 82079 110390 89994.64 85950 93561 3832936 3832936 0.00
crit 10.51 19.79% 186320.71 169082 227403 186395.19 169082 210684 1958584 1958584 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 9175 (12049) 8.3% (10.8%) 75.2 5.80sec 72081 45088 0 0 0 0.0% 0.0% 0.0% 0.0% 142.1 23957 49633 29060 19.9% 0.0% 23.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.25 75.25 142.13 142.13 1.5987 0.7313 4130165.57 4130165.57 0.00 45087.75 45087.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.9 80.12% 23956.54 21797 29181 23961.93 23171 24756 2728113 2728113 0.00
crit 28.2 19.88% 49633.49 44901 60113 49641.31 46635 52932 1402053 1402053 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2874 2.6% 44.5 9.51sec 29077 0 23965 49690 29090 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.49 44.47 0.00 0.00 0.0000 0.0000 1293709.87 1293709.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.61 80.08% 23965.20 21797 29181 23971.20 22481 25434 853502 853502 0.00
crit 8.86 19.92% 49689.60 44901 60113 49701.11 0 60113 440208 440208 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3515 3.2% 14.5 4.99sec 109425 91559 90014 186501 109423 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.48 14.48 0.00 0.00 1.1952 0.0000 1584974.04 1584974.04 0.00 91558.78 91558.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.57 79.88% 90014.42 79678 107383 90095.13 82880 97913 1041529 1041529 0.00
crit 2.91 20.12% 186500.67 164137 221210 178442.37 0 221210 543445 543445 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9249 8.3% 24.6 17.52sec 169693 143481 139846 289621 169693 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.60 24.60 0.00 0.00 1.1827 0.0000 4175139.98 4175139.98 0.00 143480.53 143480.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.70 80.07% 139846.07 122772 173880 139917.20 131963 149815 2755116 2755116 0.00
crit 4.90 19.93% 289620.82 252910 358194 287459.42 0 358194 1420024 1420024 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 16812 (21938) 15.2% (19.8%) 74.9 6.00sec 131922 111280 0 0 0 0.0% 0.0% 0.0% 0.0% 436.4 14316 29647 17363 19.9% 0.0% 180.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.95 74.95 436.42 436.42 1.1855 1.8686 7577321.14 7577321.14 0.00 10933.03 111280.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 349.7 80.13% 14315.53 12783 17966 14317.99 13978 14671 5005859 5005859 0.00
crit 86.7 19.87% 29646.87 26333 37009 29650.90 28514 31094 2571462 2571462 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5126 4.6% 136.4 3.27sec 16940 0 13978 28937 16954 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.37 136.25 0.00 0.00 0.0000 0.0000 2310032.46 2310032.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.15 80.11% 13977.86 12783 17110 13980.34 13513 14478 1525657 1525657 0.00
crit 27.11 19.89% 28937.12 26333 35247 28944.92 27231 31253 784376 784376 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2242 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4293 3.9% 92.3 4.84sec 20980 0 17757 35699 21337 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.25 90.71 0.00 0.00 0.0000 0.0000 1935481.12 1935481.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.61 80.05% 17757.24 15875 22484 17760.62 17186 18432 1289347 1289347 0.00
crit 18.10 19.95% 35699.08 31750 44968 35710.59 33333 39137 646134 646134 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15538 (20269) 14.0% (18.3%) 59.2 7.52sec 154426 130145 0 0 0 0.0% 0.0% 0.0% 0.0% 358.3 16109 33352 19544 19.9% 0.0% 177.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.16 59.16 358.34 358.34 1.1866 2.2354 7003460.46 7003460.46 0.00 10485.39 130144.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 287.0 80.08% 16108.99 14287 20366 16111.86 15617 16587 4622531 4622531 0.00
crit 71.4 19.92% 33351.90 29431 41955 33356.42 31957 35235 2380930 2380930 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4730 4.3% 112.0 3.93sec 19038 0 15712 32528 19053 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.98 111.89 0.00 0.00 0.0000 0.0000 2131789.55 2131789.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.65 80.13% 15711.62 14287 19397 15714.86 15196 16350 1408606 1408606 0.00
crit 22.23 19.87% 32528.44 29431 39957 32533.55 30177 35878 723184 723184 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46254 / 3663
melee 46254 3.3% 31.2 12.62sec 52401 51568 45642 92170 52400 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.16 31.16 0.00 0.00 1.0162 0.0000 1632733.38 1632733.38 0.00 51567.60 51567.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 55.74% 45641.60 36329 55931 45654.51 41396 51542 792726 792726 0.00
crit 6.34 20.36% 92170.09 72658 111863 92043.92 0 111863 584615 584615 0.00
glance 7.45 23.90% 34293.12 27247 41949 34297.96 0 41949 255393 255393 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1997 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.48%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 26.4 2.3 16.5sec 15.1sec 10.14% 46.68%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.14%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.56%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.60% 43.83%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.60%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.21% 42.21%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.21%

    Trigger Attempt Success

    • trigger_pct:14.36%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.38% 49.54%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no2PT14
devouring_plague Shadow Orb 20.7 62.1 3.0 3.0 120071.8
halo Mana 10.7 434088.7 40500.0 40500.2 6.9
mind_blast Mana 53.1 226146.2 4257.9 4257.9 25.6
mind_flay Mana 75.2 225740.6 3000.0 3000.0 24.0
shadow_word_death Mana 14.5 112983.9 7800.0 7800.3 14.0
shadow_word_insanity Mana 24.6 184528.8 7500.0 7499.9 22.6
shadow_word_pain Mana 74.9 989322.0 13200.0 13200.0 10.0
vampiric_touch Mana 59.2 532404.0 9000.0 9000.0 17.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.16 170362.42 (6.40%) 5467.57 110066.06 39.25%
Shadow Orbs from Mind Blast Shadow Orb 53.11 53.11 (87.90%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.31 7.31 (12.10%) 1.00 0.00 0.00%
Devouring Plague Health Health 205.56 0.00 (-nan%) 0.00 2854511.55 100.00%
Vampiric Touch Mana Mana 470.23 2037582.14 (76.50%) 4333.18 448129.06 18.03%
mp5_regen Mana 1803.14 455440.70 (17.10%) 252.58 85502.35 15.81%
Resource RPS-Gain RPS-Loss
Mana 5906.69 5999.46
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 258174.03 98700.00 300000.00
Shadow Orb 1.32 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 16.0%
shadowfiend-Mana Cap 16.0%
lightwell-Mana Cap 16.0%

Procs

Count Interval
Shadowy Recall Extra Tick 341.5 1.3sec
Shadowy Apparition Procced 92.3 4.8sec
Divine Insight Mind Blast CD Reset 50.7 15.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no2PT14 Damage Per Second
Count 49992
Mean 111009.19
Minimum 102568.06
Maximum 121993.54
Spread ( max - min ) 19425.48
Range [ ( max - min ) / 2 * 100% ] 8.75%
Standard Deviation 2404.5767
5th Percentile 107198.43
95th Percentile 115094.50
( 95th Percentile - 5th Percentile ) 7896.06
Mean Distribution
Standard Deviation 10.7545
95.00% Confidence Intervall ( 110988.11 - 111030.27 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1802
0.1 Scale Factor Error with Delta=300 49358
0.05 Scale Factor Error with Delta=300 197433
0.01 Scale Factor Error with Delta=300 4935838
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 111009.19
Distribution Chart

Damage

Sample Data
Count 49992
Mean 48382274.01
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 326.62
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.23 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.49 shadow_word_death,if=active_enemies<=5
F 56.04 mind_blast,if=active_enemies<=6&cooldown_react
G 45.76 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.64 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 24.60 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.72 halo,if=talent.halo.enabled
M 13.47 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.48 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.59 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.43 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 29.19 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHFTTFIGGHHMTFTFWWWFGHHMTQQQFTFLTHGHIFGMTWWWFHHIGFTTHFHGMIGLTWWWWFHHTIGFTHHIFGMTIGGWFHHFLTTFIGHHGMQFTWWFIGHHTFMTIGHHFGLQQQQQFTBIGFHHIGMTQFQQFTHHGTFIGMWWWWFHHLTIFGTHHGFTFMFTGGWHHFTQQQQFMTTHFGGHLTWWWWFHHFIGMTTFHIGFHTIFGMWWHFHLTIGFTHGHTFMQQQQIFGWWHHTFTTIGFHHIGLMTQFTGBIGHFHTFMEEFGHGFDEEHWWWWFEDEFGHHFHEDEIGFHLTEE9FGHMIGEEFHHTHIEDEFGGFH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no4PT14 : 114008 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114008.4 114008.4 20.86 / 0.02% 3920 / 3.4% 18.4 6001.6 5909.5 Mana 0.41% 43.5 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:302102|236223|143584|130133|120986|91671|89785|45116&chds=0,604203&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302102++devouring_plague,9482C9,0,0,15|t++236223++halo,9482C9,1,0,15|t++143584++shadow_word_insanity,9482C9,2,0,15|t++130133++vampiric_touch,9482C9,3,0,15|t++120986++shadow_word_pain,9482C9,4,0,15|t++91671++shadow_word_death,9482C9,5,0,15|t++89785++mind_blast,9482C9,6,0,15|t++45116++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,12,8,8,7,6,6,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|shadow_word_insanity|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_swi_no4PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:244443465643468466676322100yvvuuvwxyxwvusssrqqqqqrqpponliihhhhiiiiijjjijjjjjlmnonnnmmllkkkjkllmmmlkkjjjjjklmnonmlkjiihjjkllmmmmmmljklmmmnnonmlkkjiihhhhhiijjjkkkjjjjlmnnoonnmnnnonnnoprsrqqpppoppqpooppqppnmmlmlmmnnooppqqppoonnnnopppnmlkjihgfffgghihiiiihijkklmnopppoonmmkkkkkkkkkjjiihhhhhijjkkkjkkkjjjjkklmnnnnnnmmmnmmmnnoponnmmllllllmnnopqqqqqqqqrrstuutrqopoonnnnoppqpqqppoprrsrrrrsrrqppnonnnoooppqqqqqqqqqqqqqrrpoooooonmmmmmnooopppprsssstuvwwxxxxxyxxwwwwwwwwwwvvvuutttsstrppppoonmmmmlmnnoooooqstssttuvvuuvvuuutttttttuuuuvvvvvuuuvuvusttssttssrrrrrrrrqqq&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6765,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114008|max=168518&chxp=1,1,68,100&chtt=priest_90_di_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,32,32,72,96,80,208,392,544,600,856,1008,1208,1536,1816,2088,2776,2624,2856,3048,2792,2728,2856,2592,2704,2176,2088,1792,1728,1304,1232,952,760,568,496,320,296,208,144,120,80,40,72,32,0,0,0,0,16&chds=0,3048&chbh=5&chxt=x&chxl=0:|min=106155|avg=114008|max=123702&chxp=0,1,45,100&chtt=priest_90_di_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:26.7,19.7,15.6,14.3,6.5,5.5,3.8,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 120.2s|shadow_word_pain 88.9s|vampiric_touch 70.2s|mind_blast 64.5s|shadow_word_insanity 29.2s|devouring_plague 24.6s|shadow_word_death 17.3s|halo 12.7s|shadowfiend 2.4s|waiting 1.8s&chtt=priest_90_di_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no4PT14 114008
devouring_plague 6254 (16500) 5.5% (14.5%) 20.7 22.38sec 359600 302102 112378 232602 136230 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.69 20.69 0.00 0.00 1.1903 0.0000 2818402.21 2818402.21 0.00 302101.71 302101.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.58 80.16% 112377.52 102399 137090 112406.56 106207 118719 1863621 1863621 0.00
crit 4.10 19.84% 232602.11 210941 282405 229935.11 0 282405 954782 954782 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2441 2.1% 48.9 8.70sec 22505 0 18594 38496 22539 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.92 48.84 0.00 0.00 0.0000 0.0000 1100873.39 1100873.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.16 80.18% 18594.18 17006 22766 18595.29 17627 19817 728186 728186 0.00
crit 9.68 19.82% 38496.21 35032 46897 38506.04 35032 46897 372688 372688 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7806 6.9% 20.7 22.38sec 170157 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.4 18567 38436 22508 19.8% 0.0% 26.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.69 20.69 156.40 156.40 0.0000 0.7537 3520281.10 3520281.10 0.00 29863.51 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.4 80.17% 18567.09 17006 27589 18568.63 17763 19388 2327927 2327927 0.00
crit 31.0 19.83% 38435.65 35032 56833 38436.70 35934 41230 1192354 1192354 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6630) 0.0% (5.8%) 10.7 43.54sec 278971 236223 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.71 10.71 0.00 0.00 1.1810 0.0000 0.00 0.00 0.00 236223.05 236223.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.60 80.26% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.11 19.74% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6630 5.8% 10.7 43.54sec 278971 0 115109 238316 139486 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.71 21.42 0.00 0.00 0.0000 0.0000 2988457.76 2988457.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.19 80.21% 115109.38 104363 139821 115106.54 107856 123271 1978256 1978256 0.00
crit 4.24 19.79% 238315.83 214987 288030 235585.17 0 288030 1010201 1010201 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.7 43.54sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.71 227.49 0.00 0.00 0.0000 0.0000 0.00 44508156.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.19 77.01% 0.00 0 0 0.00 0 0 0 27512884 100.00
crit 52.30 22.99% 0.00 0 0 0.00 0 0 0 16995273 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12855 11.3% 53.1 8.45sec 109196 89785 89958 186376 109197 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.07 53.07 0.00 0.00 1.2162 0.0000 5794575.34 5794575.34 0.00 89785.48 89785.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.48 80.05% 89958.33 82079 110390 89977.47 87148 93866 3821189 3821189 0.00
crit 10.59 19.95% 186376.35 169082 227403 186427.54 169082 209691 1973386 1973386 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 9174 (12045) 8.0% (10.6%) 75.2 5.80sec 72135 45116 0 0 0 0.0% 0.0% 0.0% 0.0% 142.0 23953 49648 29073 19.9% 0.0% 23.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.16 75.16 142.04 142.04 1.5989 0.7314 4129563.06 4129563.06 0.00 45116.29 45116.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.7 80.08% 23952.77 21797 29181 23957.78 23182 24912 2724434 2724434 0.00
crit 28.3 19.92% 49648.33 44901 60113 49661.79 46607 53652 1405129 1405129 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2871 2.5% 44.5 9.52sec 29064 0 23969 49673 29074 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.47 44.45 0.00 0.00 0.0000 0.0000 1292466.98 1292466.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.62 80.14% 23968.55 21797 29181 23973.11 22736 25307 853833 853833 0.00
crit 8.83 19.86% 49673.19 44901 60113 49682.83 0 60113 438634 438634 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3522 3.1% 14.5 4.99sec 109570 91671 90020 186827 109568 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.49 14.49 0.00 0.00 1.1953 0.0000 1587473.94 1587473.94 0.00 91671.42 91671.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.56 79.80% 90019.50 79678 107383 90108.47 81380 99788 1040833 1040833 0.00
crit 2.93 20.20% 186826.51 164137 221210 179434.85 0 221210 546641 546641 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9278 8.1% 24.6 17.48sec 169811 143584 139824 290002 169812 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.65 24.65 0.00 0.00 1.1827 0.0000 4185774.98 4185774.98 0.00 143584.49 143584.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.73 80.03% 139823.60 122772 173880 139898.77 130302 152093 2758367 2758367 0.00
crit 4.92 19.97% 290002.19 252910 358194 287908.19 0 358194 1427408 1427408 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18287 (23867) 16.0% (20.9%) 75.0 5.99sec 143418 120986 0 0 0 0.0% 0.0% 0.0% 0.0% 436.5 14314 29600 18881 29.9% 0.0% 180.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.01 75.01 436.52 436.52 1.1854 1.8681 8242231.63 8242231.63 0.00 11894.80 120985.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 306.1 70.12% 14313.87 12783 17966 14316.38 13987 14689 4381214 4381214 0.00
crit 130.4 29.88% 29599.76 26333 37009 29604.57 28637 30745 3861018 3861018 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5580 4.9% 136.6 3.27sec 18418 0 13978 28897 18434 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.57 136.46 0.00 0.00 0.0000 0.0000 2515445.95 2515445.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.70 70.13% 13977.96 12783 17110 13980.29 13598 14521 1337706 1337706 0.00
crit 40.76 29.87% 28897.49 26333 35247 28902.82 27471 30174 1177740 1177740 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2241 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5387 4.7% 115.9 3.86sec 20955 0 17749 35703 21309 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.91 113.98 0.00 0.00 0.0000 0.0000 2428883.39 2428883.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.38 80.17% 17749.00 15875 22484 17752.33 17208 18403 1621902 1621902 0.00
crit 22.60 19.83% 35703.26 31750 44968 35712.74 33235 39455 806982 806982 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15531 (20264) 13.6% (17.8%) 59.2 7.52sec 154385 130133 0 0 0 0.0% 0.0% 0.0% 0.0% 358.4 16107 33361 19533 19.9% 0.0% 177.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.16 59.16 358.36 358.36 1.1864 2.2355 6999819.28 6999819.28 0.00 10482.19 130133.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 287.2 80.14% 16107.17 14287 20366 16109.90 15678 16736 4626061 4626061 0.00
crit 71.2 19.86% 33361.47 29431 41955 33367.25 31971 35050 2373759 2373759 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4733 4.2% 112.1 3.92sec 19037 0 15706 32545 19052 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.06 111.96 0.00 0.00 0.0000 0.0000 2133189.05 2133189.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.72 80.13% 15706.34 14287 19397 15709.02 15119 16371 1409101 1409101 0.00
crit 22.25 19.87% 32544.91 29431 39957 32547.56 29781 34947 724088 724088 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46214 / 3660
melee 46214 3.2% 31.2 12.61sec 52356 51525 45614 92178 52356 20.3% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.16 31.16 0.00 0.00 1.0162 0.0000 1631328.01 1631328.01 0.00 51524.84 51524.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.32 55.60% 45614.50 36329 55931 45633.74 40805 51000 790193 790193 0.00
crit 6.33 20.31% 92178.10 72658 111863 92177.41 0 111863 583266 583266 0.00
glance 7.51 24.09% 34348.75 27247 41949 34338.93 0 41949 257869 257869 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1997 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.49%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 26.4 2.3 16.5sec 15.1sec 10.10% 46.57%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.10%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.49%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.46% 43.71%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.46%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.23% 42.23%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.23%

    Trigger Attempt Success

    • trigger_pct:14.38%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.39% 49.53%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.39%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.37% 77.48%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no4PT14
devouring_plague Shadow Orb 20.7 62.1 3.0 3.0 119866.3
halo Mana 10.7 433855.4 40500.0 40500.2 6.9
mind_blast Mana 53.1 226431.4 4267.0 4267.0 25.6
mind_flay Mana 75.2 225495.4 3000.0 3000.0 24.0
shadow_word_death Mana 14.5 113012.6 7800.0 7800.3 14.0
shadow_word_insanity Mana 24.6 184867.2 7500.0 7499.8 22.6
shadow_word_pain Mana 75.0 990114.0 13200.0 13199.9 10.9
vampiric_touch Mana 59.2 532418.4 9000.0 9000.0 17.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.16 170135.23 (6.38%) 5460.36 110288.93 39.33%
Shadow Orbs from Mind Blast Shadow Orb 53.07 53.07 (87.89%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.31 7.31 (12.11%) 1.00 0.00 0.00%
Devouring Plague Health Health 205.25 0.00 (-nan%) 0.00 2850183.38 100.00%
Vampiric Touch Mana Mana 470.32 2038830.05 (76.51%) 4334.96 447215.23 17.99%
mp5_regen Mana 1803.14 455672.78 (17.10%) 252.71 85270.27 15.76%
Resource RPS-Gain RPS-Loss
Mana 5909.47 6001.63
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 258438.74 114000.00 300000.00
Shadow Orb 1.31 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.9%
shadowfiend-Mana Cap 15.9%
lightwell-Mana Cap 15.9%

Procs

Count Interval
Shadowy Recall Extra Tick 341.7 1.3sec
Shadowy Apparition Procced 115.9 3.9sec
Divine Insight Mind Blast CD Reset 50.5 15.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no4PT14 Damage Per Second
Count 49992
Mean 114008.37
Minimum 106155.44
Maximum 123701.99
Spread ( max - min ) 17546.55
Range [ ( max - min ) / 2 * 100% ] 7.70%
Standard Deviation 2380.0696
5th Percentile 110195.77
95th Percentile 118035.01
( 95th Percentile - 5th Percentile ) 7839.23
Mean Distribution
Standard Deviation 10.6448
95.00% Confidence Intervall ( 113987.50 - 114029.23 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1674
0.1 Scale Factor Error with Delta=300 48357
0.05 Scale Factor Error with Delta=300 193429
0.01 Scale Factor Error with Delta=300 4835740
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114008.37
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49737438.05
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 326.71
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.49 shadow_word_death,if=active_enemies<=5
F 56.05 mind_blast,if=active_enemies<=6&cooldown_react
G 45.76 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.63 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 24.65 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.71 halo,if=talent.halo.enabled
M 13.47 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.50 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.60 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.41 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 29.25 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTTIGIGFHHMTQFWFIGTHHTQFTIGLIFGHHMTFIGWHHFGTFTFHDFGHIGLTWWWWFHHTFGMTHFGHFTGGFHHMLTFTTIGHIGFHTWWWWFHHGMFTQFTHHGFIGLMBWFHHTFIGTTFHGHMTFGWWWFHHFDFLTIGQFHHGTFMGIGHHQFTQQFTFGHDFGFHLTWWWWFHMHIGFTFTHIGFHIGMQQFWWHTHLFIGTTHTFHGMTFGWFWHHTFMTTIGHFGHFLTBGIFGDFHHTTEEFGDFGHEEFMWFHLEEHIFGMQQQPEEFHGHTPEDEG9WWFHEEHTFDEEGHFGHFDE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no2PT14 : 114168 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114168.0 114168.0 20.74 / 0.02% 3891 / 3.4% 20.2 5456.5 5402.5 Mana 0.28% 45.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311657|244911|141537|141235|94715|91838|79157|47380&chds=0,623313&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311657++devouring_plague,9482C9,0,0,15|t++244911++halo,9482C9,1,0,15|t++141537++shadow_word_pain,9482C9,2,0,15|t++141235++vampiric_touch,9482C9,3,0,15|t++94715++shadow_word_death,9482C9,4,0,15|t++91838++mind_blast,9482C9,5,0,15|t++79157++mind_spike,4A79D3,6,0,15|t++47380++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,12,10,7,6,6,5,5,5,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|shadowy_apparition|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:565676666532468465675200zxwvuttuuuwvutrqpnnmmmmnnonmmmmjhggggghhhggggfeefeegijkkkkkjjjjihhhhhhhhgfeedddeefghijihhhggfghiijjkllllllklmnnnoponmmmlljihhhhhhiiiiiiihhhhijklllkkjjkjkkjjjklmmllllkkkllkjjjjkkkjjjiihiijjkkllllllkkkjjjjkkkihgffeddddefghjjkklllmnnooqqrrqqponlkjihhgghhhhgggffeeefgghhhghiihhhghhiijkjjjiihiihhghiijiihhhhgggghijklmmmnnnnnnnnooppnmljjjjjjjklmoppppppqrstvuuuuuutsrqppoooooooooonnnnmmmllllllkjkklkkjjjjjjjkklmmmmopoooppqqqrrssssssrrrrssssssssrrqqpppppommllkkkjjjjkklmnoopoqsuuuvuuvvwwwwvvuutssrrrqqrrrrrrqqqqppponoonnooooppppopppppp&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6353,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114168|max=179698&chxp=1,1,64,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,8,8,24,16,48,56,112,256,232,352,472,720,1040,1160,1496,1656,2136,1936,2456,2616,3128,2680,3368,2856,2896,2752,2280,2232,2160,1664,1536,1168,1024,832,576,616,400,344,208,112,88,32,56,80,32,16,24,16&chds=0,3368&chbh=5&chxt=x&chxl=0:|min=105368|avg=114168|max=123065&chxp=0,1,50,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:23.0,17.1,16.9,15.2,12.1,4.7,3.8,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 103.5s|mind_spike 76.9s|shadow_word_pain 76.1s|vampiric_touch 68.7s|mind_blast 54.5s|devouring_plague 21.3s|shadow_word_death 17.0s|halo 12.5s|shadowfiend 2.4s|waiting 1.3s&chtt=priest_90_pi_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no2PT14 114168
devouring_plague 5555 (14713) 4.9% (12.9%) 18.3 25.42sec 361445 311657 112486 233119 136388 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 0.00 0.00 1.1598 0.0000 2502563.52 2502563.52 0.00 311656.63 311656.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.71 80.19% 112485.97 102399 137090 112511.40 104991 120071 1654998 1654998 0.00
crit 3.64 19.81% 233119.45 210941 282405 228083.78 0 282405 847565 847565 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2190 1.9% 43.8 9.68sec 22547 0 18615 38549 22576 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.80 43.74 0.00 0.00 0.0000 0.0000 987459.34 987459.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.05 80.13% 18615.38 17006 22766 18616.31 17582 19812 652441 652441 0.00
crit 8.69 19.87% 38549.08 35032 46897 38553.99 0 44846 335018 335018 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6969 6.1% 18.3 25.42sec 171240 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.7 18567 38431 22497 19.8% 0.0% 22.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 139.67 139.67 0.0000 0.7381 3142030.33 3142030.33 0.00 30479.11 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.0 80.22% 18567.33 17006 22766 18568.21 17738 19312 2080240 2080240 0.00
crit 27.6 19.78% 38431.25 35032 46897 38433.59 36024 41493 1061791 1061791 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6773) 0.0% (5.9%) 10.9 42.71sec 278831 244911 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 10.94 0.00 0.00 1.1385 0.0000 0.00 0.00 0.00 244911.28 244911.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.76 80.08% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.18 19.92% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6773 5.9% 10.9 42.71sec 278831 0 115097 238155 139413 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 21.88 0.00 0.00 0.0000 0.0000 3050859.85 3050859.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.56 80.24% 115097.03 104363 139821 115125.42 108184 123372 2020953 2020953 0.00
crit 4.32 19.76% 238155.15 214987 288030 235858.69 0 288030 1029907 1029907 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.71sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.94 230.39 0.00 0.00 0.0000 0.0000 0.00 45067016.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.41 77.01% 0.00 0 0 0.00 0 0 0 27858838 100.00
crit 52.97 22.99% 0.00 0 0 0.00 0 0 0 17208178 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11111 9.7% 45.9 9.78sec 109006 91838 89953 186213 109006 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.95 45.95 0.00 0.00 1.1869 0.0000 5008272.94 5008272.94 0.00 91837.62 91837.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.85 80.21% 89952.82 82079 110390 89967.47 86037 93033 3314875 3314875 0.00
crit 9.09 19.79% 186212.58 169082 227403 186262.16 169082 215595 1693398 1693398 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 8285 (10883) 7.3% (9.5%) 67.0 6.50sec 73164 47380 0 0 0 0.0% 0.0% 0.0% 0.0% 127.2 24165 50116 29353 20.0% 0.0% 19.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.02 67.02 127.17 127.17 1.5442 0.6947 3732880.16 3732880.16 0.00 47380.48 47380.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.7 80.01% 24164.90 21797 29181 24172.56 23246 25309 2458598 2458598 0.00
crit 25.4 19.99% 50116.09 44901 60113 50130.73 46643 54894 1274283 1274283 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2598 2.3% 39.9 10.63sec 29363 0 24190 50162 29377 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.86 39.84 0.00 0.00 0.0000 0.0000 1170477.90 1170477.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.89 80.03% 24190.29 21797 29181 24198.31 22558 26067 771354 771354 0.00
crit 7.96 19.97% 50162.40 44901 60113 50147.37 0 60113 399124 399124 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13506 11.8% 66.5 6.56sec 91572 79157 75567 156373 91572 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.48 66.48 0.00 0.00 1.1569 0.0000 6088097.71 6088097.71 0.00 79156.67 79156.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.32 80.19% 75567.23 68964 93036 75576.44 72462 78473 4028920 4028920 0.00
crit 13.17 19.81% 156372.61 142066 191655 156391.19 142066 173954 2059178 2059178 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3575 3.1% 14.7 4.92sec 109852 94715 90113 186898 109849 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 1.1599 0.0000 1611951.09 1611951.09 0.00 94714.79 94714.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.68 79.61% 90113.19 79678 107383 90194.56 82082 98484 1052634 1052634 0.00
crit 2.99 20.39% 186897.61 164137 221210 179644.29 0 221210 559317 559317 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18323 (23896) 16.1% (20.9%) 65.9 6.83sec 163484 141537 0 0 0 0.0% 0.0% 0.0% 0.0% 473.1 14383 29790 17451 19.9% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.86 65.86 473.09 473.09 1.1551 1.8545 8256004.99 8256004.99 0.00 11293.64 141536.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 378.9 80.08% 14382.75 12783 17966 14385.87 14059 14734 5449101 5449101 0.00
crit 94.2 19.92% 29789.96 26333 37009 29796.42 28574 31224 2806904 2806904 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5573 4.9% 148.0 3.02sec 16963 0 13999 28992 16978 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.04 147.91 0.00 0.00 0.0000 0.0000 2511259.38 2511259.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.52 80.13% 13998.85 12783 17110 14001.91 13573 14451 1659179 1659179 0.00
crit 29.39 19.87% 28992.17 26333 35247 28996.96 27418 30910 852080 852080 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2244 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4525 4.0% 97.1 4.60sec 21010 0 17792 35787 21374 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.08 95.42 0.00 0.00 0.0000 0.0000 2039595.18 2039595.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.43 80.09% 17792.20 15875 22484 17795.66 17155 18465 1359850 1359850 0.00
crit 18.99 19.91% 35787.18 31750 44968 35796.36 33330 38608 679745 679745 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16486 (21516) 14.4% (18.9%) 59.2 7.52sec 163676 141235 0 0 0 0.0% 0.0% 0.0% 0.0% 380.0 16126 33401 19553 19.8% 0.0% 180.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.24 59.24 380.00 380.00 1.1589 2.1431 7430165.52 7430165.52 0.00 10981.18 141234.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.6 80.16% 16126.39 14287 20366 16129.89 15631 16668 4912482 4912482 0.00
crit 75.4 19.84% 33401.33 29431 41955 33406.57 31855 35072 2517683 2517683 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5030 4.4% 118.8 3.71sec 19086 0 15745 32629 19101 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.77 118.67 0.00 0.00 0.0000 0.0000 2266740.36 2266740.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.08 80.12% 15745.03 14287 19397 15748.94 15230 16309 1496999 1496999 0.00
crit 23.59 19.88% 32628.83 29431 39957 32636.92 30672 35302 769742 769742 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46355 / 3671
melee 46355 3.2% 31.2 12.60sec 52477 51717 45718 92376 52477 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0147 0.0000 1636120.35 1636120.35 0.00 51717.04 51717.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 55.72% 45718.12 36329 55931 45736.37 41362 51656 794191 794191 0.00
crit 6.33 20.31% 92375.80 72658 111863 92384.65 0 111863 584941 584941 0.00
glance 7.47 23.97% 34383.85 27247 41949 34374.10 0 41949 256988 256988 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1377 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.34%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.49%
glyph_mind_spike 37.4 29.1 11.8sec 6.6sec 50.61% 72.87%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.62%
  • glyph_mind_spike_2:18.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.4sec 20.2sec 44.32% 44.83%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.32%

    Trigger Attempt Success

    • trigger_pct:1.71%
light_of_the_cosmos 9.8 0.0 48.1sec 48.1sec 42.32% 42.32%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.32%

    Trigger Attempt Success

    • trigger_pct:14.39%
power_infusion 4.3 0.0 121.4sec 121.1sec 18.53% 20.57%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.50% 49.48%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.50%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 44.4 30.3 9.9sec 5.9sec 43.93% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.13%
  • surge_of_darkness_2:10.81%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.56%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no2PT14
devouring_plague Shadow Orb 18.3 55.0 3.0 3.0 120481.1
halo Mana 10.9 416977.6 38109.4 38109.4 7.3
mind_blast Mana 45.9 397443.2 8650.4 8650.4 12.6
mind_flay Mana 67.0 190279.4 2839.3 2839.2 25.8
shadow_word_death Mana 14.7 110157.0 7506.7 7507.0 14.6
shadow_word_pain Mana 65.9 832583.3 12641.5 12641.5 12.9
vampiric_touch Mana 59.2 512927.4 8657.8 8657.8 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 140360.73 (5.76%) 4501.95 140239.11 49.98%
Shadow Orbs from Mind Blast Shadow Orb 45.95 45.95 (86.11%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.41 7.41 (13.89%) 1.00 0.00 0.00%
Devouring Plague Health Health 183.41 0.00 (-nan%) 0.00 2546915.37 100.00%
Vampiric Touch Mana Mana 498.67 1885176.17 (77.39%) 3780.44 750819.67 28.48%
mp5_regen Mana 1803.14 410488.65 (16.85%) 227.65 130454.41 24.12%
Resource RPS-Gain RPS-Loss
Mana 5402.47 5456.45
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 275659.19 115500.00 300000.00
Shadow Orb 1.31 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.3%
shadowfiend-Mana Cap 24.3%
lightwell-Mana Cap 24.3%

Procs

Count Interval
Shadowy Recall Extra Tick 350.2 1.3sec
Shadowy Apparition Procced 97.1 4.6sec
FDCL Mind Spike proc 74.7 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 114168.02
Minimum 105368.42
Maximum 123064.98
Spread ( max - min ) 17696.55
Range [ ( max - min ) / 2 * 100% ] 7.75%
Standard Deviation 2366.3022
5th Percentile 110381.06
95th Percentile 118162.97
( 95th Percentile - 5th Percentile ) 7781.90
Mean Distribution
Standard Deviation 10.5833
95.00% Confidence Intervall ( 114147.27 - 114188.76 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1650
0.1 Scale Factor Error with Delta=300 47799
0.05 Scale Factor Error with Delta=300 191198
0.01 Scale Factor Error with Delta=300 4779958
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114168.02
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49798358.27
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 342.73
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.58 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.67 shadow_word_death,if=active_enemies<=5
F 48.07 mind_blast,if=active_enemies<=6&cooldown_react
G 44.90 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.67 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.20 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.94 halo,if=talent.halo.enabled
M 13.77 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.74 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.17 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 48.29 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 44.48 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.96 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTRFTGGHHJFJMRTRRFWWHHRGRFJRTLRTFHHGJMGFJRWWWHFHJRTRGFMHRHGTFLJRWWRGFHHRTFMTGHHFGJRTCGFWHHLRTRFGMTQFHGHJRTFGWWHHJFJMJRTTFGHHGLRFRRBJRFHGHMGRFRTHHQFJRGTGFMLHHRTFTGRTFGHHRTRQFGCMGHHFJRTRTLFTGHHGJQFMRTWWWRFHHRGTQFRTRHHGFMRLRGTFRRHHTGFRTTGFHHMTRTFGWWRHHGFJLRTTFTHHGJRFGJMGBCRFHHTQFGJREDEGHFHJLPEERFGJMHEEFGHJRTEDEFGHHRTEE9GWFHLDEEGHFHRTEDEGHFRTH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no4PT14 : 117365 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
117364.8 117364.8 20.83 / 0.02% 3890 / 3.3% 20.8 5452.6 5398.8 Mana 0.28% 45.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311843|244367|154114|141394|94535|91848|79190|47336&chds=0,623686&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311843++devouring_plague,9482C9,0,0,15|t++244367++halo,9482C9,1,0,15|t++154114++shadow_word_pain,9482C9,2,0,15|t++141394++vampiric_touch,9482C9,3,0,15|t++94535++shadow_word_death,9482C9,4,0,15|t++91848++mind_blast,9482C9,5,0,15|t++79190++mind_spike,4A79D3,6,0,15|t++47336++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,15,12,10,7,6,6,5,5,5,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:465666666532467465675210zxwvuttuuuwvutsqponmmmmnnonnmmmjhggghhhhhghhgfeffffgijklkkkjjjjihhhhhhiigffeeeeeefghijihhhhgfghiijjklllllllmnnnooponmmmllkjihhhhiiiiiijiihhhijkllllkjjkkkkjjjklmmllllkkllmlkkjkklkkkjjiiijjjklllllllkkkkjjjkkkjhgffeeddeefhijjkklllmnoopqrrrrqponlljjhhhhhhhhhhggfffffghhihhhiiihhhhiijjkkkjjjiijihhiijjiiiiihhgghijkllmmnnnnnnnnnooppnmljjjjjjjklmopppppqqrstvuvuuuutsrqpppoooooooooonnnnmmlllllllkkllkkkjjjjjkkklmmnnopoooppqqqrrssssssrrrrssssssssrrqqpppppommmmklkjjjjkllmnoppprtuuuvvvvvwwwwvvuutssssrrrrrrrrqqqppppponnnnnoonnoooonnnnoon&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6389,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=117365|max=183705&chxp=1,1,64,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,24,40,128,64,208,272,312,312,656,648,904,1208,1216,1688,2104,2152,2480,2840,2864,2768,2760,2944,2688,2360,2384,2328,2072,1784,1600,1208,1032,1000,776,560,360,320,224,208,120,112,80,64,32,16,24,8,0,16&chds=0,2944&chbh=5&chxt=x&chxl=0:|min=109531|avg=117365|max=126610&chxp=0,1,46,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.9,17.1,16.8,15.2,12.1,4.7,3.8,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 103.3s|mind_spike 77.2s|shadow_word_pain 75.9s|vampiric_touch 68.6s|mind_blast 54.5s|devouring_plague 21.3s|shadow_word_death 17.0s|halo 12.5s|shadowfiend 2.4s|waiting 1.3s&chtt=priest_90_pi_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no4PT14 117365
devouring_plague 5562 (14723) 4.7% (12.6%) 18.4 25.42sec 361668 311843 112513 232961 136565 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 0.00 0.00 1.1598 0.0000 2506316.53 2506316.53 0.00 311843.03 311843.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.69 80.03% 112512.76 102399 137090 112544.69 105802 119691 1652577 1652577 0.00
crit 3.66 19.97% 232960.51 210941 282405 228522.73 0 282405 853739 853739 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2189 1.9% 43.8 9.69sec 22556 0 18617 38550 22589 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.78 43.71 0.00 0.00 0.0000 0.0000 987423.45 987423.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.00 80.07% 18617.45 17006 22766 18621.25 17565 19659 651644 651644 0.00
crit 8.71 19.93% 38550.33 35032 46897 38532.53 0 45096 335780 335780 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6971 5.9% 18.4 25.42sec 171301 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.7 18570 38430 22505 19.8% 0.0% 22.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 139.69 139.69 0.0000 0.7382 3143839.01 3143839.01 0.00 30485.42 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.0 80.18% 18569.52 17006 22766 18571.30 17741 19528 2079991 2079991 0.00
crit 27.7 19.82% 38429.54 35032 46897 38431.08 35581 41192 1063848 1063848 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6758) 0.0% (5.8%) 10.9 42.68sec 278127 244367 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 10.95 0.00 0.00 1.1382 0.0000 0.00 0.00 0.00 244367.42 244367.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.78 80.17% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.17 19.83% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6758 5.8% 10.9 42.68sec 278127 0 115072 238049 139062 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 21.89 0.00 0.00 0.0000 0.0000 3044573.70 3044573.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.62 80.49% 115071.57 104363 139821 115097.45 108671 122838 2027808 2027808 0.00
crit 4.27 19.51% 238049.16 214987 288030 235664.95 0 288030 1016766 1016766 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.68sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.95 230.57 0.00 0.00 0.0000 0.0000 0.00 45065303.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.70 77.07% 0.00 0 0 0.00 0 0 0 27898676 100.00
crit 52.87 22.93% 0.00 0 0 0.00 0 0 0 17166628 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11111 9.5% 45.9 9.78sec 109031 91848 89967 186346 109032 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.94 45.94 0.00 0.00 1.1871 0.0000 5008549.31 5008549.31 0.00 91847.74 91847.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.85 80.22% 89967.27 82079 110390 89979.79 86765 93524 3315367 3315367 0.00
crit 9.09 19.78% 186345.57 169082 227403 186432.81 169082 219044 1693182 1693182 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 8269 (10848) 7.0% (9.2%) 66.9 6.51sec 73061 47336 0 0 0 0.0% 0.0% 0.0% 0.0% 126.8 24162 50099 29383 20.1% 0.0% 19.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.90 66.90 126.79 126.79 1.5435 0.6949 3725390.95 3725390.95 0.00 47335.65 47335.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.3 79.87% 24162.27 21797 29181 24169.36 23340 25267 2446849 2446849 0.00
crit 25.5 20.13% 50098.99 44901 60113 50108.81 46057 54400 1278542 1278542 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2580 2.2% 39.6 10.70sec 29369 0 24181 50154 29384 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.57 39.55 0.00 0.00 0.0000 0.0000 1162252.09 1162252.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.63 79.97% 24181.15 21797 29181 24187.61 22650 26130 764874 764874 0.00
crit 7.92 20.03% 50153.88 44901 60113 50178.49 44901 60113 397379 397379 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13566 11.6% 66.7 6.54sec 91617 79190 75590 156572 91617 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.74 66.74 0.00 0.00 1.1569 0.0000 6114230.69 6114230.69 0.00 79189.62 79189.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.53 80.21% 75590.27 68964 93036 75595.51 72274 78709 4046261 4046261 0.00
crit 13.21 19.79% 156571.52 142066 191655 156598.31 143165 178683 2067970 2067970 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3571 3.0% 14.7 4.91sec 109676 94535 90079 186826 109676 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.69 14.69 0.00 0.00 1.1602 0.0000 1611246.02 1611246.02 0.00 94534.50 94534.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.72 79.74% 90079.49 79678 107383 90149.40 81167 99142 1055310 1055310 0.00
crit 2.98 20.26% 186825.55 164137 221210 179955.92 0 221210 555936 555936 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19923 (25973) 17.0% (22.1%) 65.8 6.84sec 177991 154114 0 0 0 0.0% 0.0% 0.0% 0.0% 472.9 14381 29747 18982 29.9% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.76 65.76 472.94 472.94 1.1549 1.8549 8977383.94 8977383.94 0.00 12278.64 154113.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 331.3 70.06% 14381.42 12783 17966 14384.10 13974 14791 4765050 4765050 0.00
crit 141.6 29.94% 29746.75 26333 37009 29752.24 28701 30987 4212334 4212334 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6051 5.2% 147.9 3.02sec 18438 0 14001 28947 18455 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.87 147.74 0.00 0.00 0.0000 0.0000 2726476.54 2726476.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.72 70.20% 14001.24 12783 17110 14004.28 13632 14492 1452157 1452157 0.00
crit 44.02 29.80% 28947.16 26333 35247 28952.79 27641 30435 1274320 1274320 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2249 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5606 4.8% 120.3 3.72sec 21008 0 17786 35765 21368 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.31 118.29 0.00 0.00 0.0000 0.0000 2527580.37 2527580.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.72 80.08% 17786.25 15875 22484 17789.77 17296 18319 1684714 1684714 0.00
crit 23.57 19.92% 35765.38 31750 44968 35774.56 33518 38672 842867 842867 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16498 (21534) 14.1% (18.4%) 59.2 7.52sec 163842 141394 0 0 0 0.0% 0.0% 0.0% 0.0% 380.1 16127 33403 19563 19.9% 0.0% 180.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.24 59.24 380.09 380.09 1.1588 2.1425 7435508.34 7435508.34 0.00 10991.48 141394.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.5 80.11% 16127.22 14287 20366 16130.50 15651 16685 4910824 4910824 0.00
crit 75.6 19.89% 33403.02 29431 41955 33408.39 32002 35376 2524684 2524684 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5037 4.3% 118.9 3.71sec 19094 0 15748 32641 19110 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.88 118.78 0.00 0.00 0.0000 0.0000 2269790.71 2269790.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.14 80.10% 15747.55 14287 19397 15751.16 15180 16315 1498144 1498144 0.00
crit 23.64 19.90% 32641.33 29431 39957 32651.25 30297 36028 771647 771647 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46397 / 3674
melee 46397 3.1% 31.2 12.60sec 52505 51750 45746 92317 52504 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0146 0.0000 1637159.35 1637159.35 0.00 51749.88 51749.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 55.72% 45745.79 36329 55931 45769.17 41148 51468 794863 794863 0.00
crit 6.35 20.35% 92317.00 72658 111863 92147.01 0 111863 585873 585873 0.00
glance 7.46 23.92% 34375.89 27247 41949 34384.95 0 41949 256423 256423 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1379 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.35%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.16% 20.16%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.16%

    Trigger Attempt Success

    • trigger_pct:15.64%
glyph_mind_spike 37.5 29.3 11.8sec 6.5sec 50.77% 73.09%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.71%
  • glyph_mind_spike_2:19.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.5 36.3sec 20.1sec 44.44% 44.93%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.44%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.8 0.0 48.1sec 48.1sec 42.33% 42.33%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.33%

    Trigger Attempt Success

    • trigger_pct:14.46%
power_infusion 4.3 0.0 121.4sec 121.1sec 18.53% 20.57%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.51% 49.47%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.51%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 44.5 30.4 9.9sec 5.9sec 44.08% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.21%
  • surge_of_darkness_2:10.87%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.37% 77.55%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no4PT14
devouring_plague Shadow Orb 18.4 55.1 3.0 3.0 120555.2
halo Mana 10.9 416999.7 38093.6 38093.6 7.3
mind_blast Mana 45.9 397352.2 8649.9 8649.9 12.6
mind_flay Mana 66.9 189970.5 2839.7 2839.7 25.7
shadow_word_death Mana 14.7 110296.0 7507.5 7507.7 14.6
shadow_word_pain Mana 65.8 831202.9 12640.8 12640.8 14.1
vampiric_touch Mana 59.2 512820.6 8657.3 8657.3 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 140206.20 (5.76%) 4496.46 140426.76 50.04%
Shadow Orbs from Mind Blast Shadow Orb 45.94 45.94 (86.09%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.42 7.42 (13.91%) 1.00 0.00 0.00%
Devouring Plague Health Health 183.41 0.00 (-nan%) 0.00 2546933.14 100.00%
Vampiric Touch Mana Mana 498.86 1884220.90 (77.40%) 3777.05 752621.18 28.54%
mp5_regen Mana 1803.14 409951.99 (16.84%) 227.35 130991.07 24.22%
Resource RPS-Gain RPS-Loss
Mana 5398.82 5452.63
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 275741.32 125760.00 300000.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.4%
shadowfiend-Mana Cap 24.4%
lightwell-Mana Cap 24.4%

Procs

Count Interval
Shadowy Recall Extra Tick 349.8 1.3sec
Shadowy Apparition Procced 120.3 3.7sec
FDCL Mind Spike proc 74.9 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 117364.76
Minimum 109531.50
Maximum 126609.55
Spread ( max - min ) 17078.06
Range [ ( max - min ) / 2 * 100% ] 7.28%
Standard Deviation 2376.4440
5th Percentile 113539.67
95th Percentile 121319.95
( 95th Percentile - 5th Percentile ) 7780.27
Mean Distribution
Standard Deviation 10.6286
95.00% Confidence Intervall ( 117343.92 - 117385.59 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1574
0.1 Scale Factor Error with Delta=300 48210
0.05 Scale Factor Error with Delta=300 192840
0.01 Scale Factor Error with Delta=300 4821019
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 117364.76
Distribution Chart

Damage

Sample Data
Count 49992
Mean 51240561.66
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 343.01
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.58 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.69 shadow_word_death,if=active_enemies<=5
F 48.11 mind_blast,if=active_enemies<=6&cooldown_react
G 44.90 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.67 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.23 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.95 halo,if=talent.halo.enabled
M 13.78 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.76 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.22 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 48.51 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 44.49 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.85 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTJRTFRTGGHHFJMRTJRWFWWHHGTFJRLTRTHFGHMGRTRFRHHTFGTGTHRFHMTLTQFGRGWHHFTTFRHHGGTQFMRCGRWFHHLTGQFJRTRHHGFJMRTGFJRHHRTFGTTGFHHLMTFBGWHGFHJRTTFHTGHRFGMRWWWLFHHTFGJRHGHTFMTCGWGFHHRRTFLJJRGHGFHMTWWWWFHHTGRTFTHHTFGLRTGRFHHJMRGFJRTGFHHJRTQFMGRWHHFGJLRTTQFTHHGTFGMRGBCWFHHTQFTGEETHHFGDLEEJRFGTHEDEFGHHJREEFGHJMHEE9GRFHLREDEFGHRTGEEFHJMH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no2PT14 : 110450 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
110450.3 110450.3 17.73 / 0.02% 3348 / 3.0% 16.9 5959.3 5891.0 Mana 0.29% 39.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:308293|243916|140546|119586|94561|85975|48640&chds=0,616586&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308293++devouring_plague,9482C9,0,0,15|t++243916++halo,9482C9,1,0,15|t++140546++vampiric_touch,9482C9,2,0,15|t++119586++shadow_word_pain,9482C9,3,0,15|t++94561++shadow_word_death,9482C9,4,0,15|t++85975++mind_blast,9482C9,5,0,15|t++48640++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,16,13,10,9,7,6,6,5,5,5,4,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mindbender: melee|mind_blast|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague|shadowy_apparition|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_mb_no2PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:024786565431346243441zwurpqomlmnnopqrqponmmmlmmllmljihhfeccdefhikklmmmmmmnmmoqoonmkihfedcdcdeeffgecccccddefgghffddccdcghjkmnpqqrrrqrsstttssonlkihffedcbbccdccddedeeefhihhiiihgggghgfeffghghhiiiiiiijjjikllmmlkkihhgghhiihhhhgfeddefgghffedccedddehikmlnnooopqqrstssssronljkihfedddededdccccbcdfeeeeeeeeeeffgghijlkllmmmnnmmmnnnnmlkjihigffffghiijjkkkkkkllmlmmkjihgfffeeefghiikklmoqrsstuvvvvutsrpqponmkkjkjkjjjjjjijjjiiihhiiiiihiijjjklmnoqrsuvuutuvwvvuuutttssrqppppppqqqpppppopooomllkjiiiiiiijkmmpqrstwyz0022222210zxxvvtsrqppoooononnnnnoonnmmmlljkjiihhhhgggffed&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6163,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=110450|max=179205&chxp=1,1,62,100&chtt=priest_90_pi_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,24,24,24,56,56,88,256,312,488,560,832,1040,1216,1456,1704,1816,2432,2488,2800,2824,2992,2800,2968,2704,2528,2576,2160,1712,1792,1488,1112,1112,832,704,464,456,272,304,192,104,32,40,32,32,24,16,16,0,16&chds=0,2992&chbh=5&chxt=x&chxl=0:|min=103724|avg=110450|max=118525&chxp=0,1,45,100&chtt=priest_90_pi_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.8,20.6,15.2,11.1,4.2,3.8,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 161.4s|shadow_word_pain 92.8s|vampiric_touch 68.3s|mind_blast 49.9s|devouring_plague 18.7s|shadow_word_death 16.9s|halo 12.6s|mindbender 7.9s|waiting 1.3s&chtt=priest_90_pi_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no2PT14 110450
devouring_plague 4899 (12806) 4.4% (11.6%) 16.2 28.55sec 356925 308293 112420 232790 136477 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.18 16.18 0.00 0.00 1.1578 0.0000 2208137.75 2208137.75 0.00 308292.96 308292.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.95 80.02% 112419.65 102399 137090 112449.12 105035 120153 1455414 1455414 0.00
crit 3.23 19.98% 232789.53 210941 282405 226542.77 0 282405 752724 752724 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1881 1.7% 37.8 10.97sec 22466 0 18550 38379 22502 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.79 37.73 0.00 0.00 0.0000 0.0000 848958.70 848958.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.21 80.07% 18549.99 17006 22766 18551.59 17374 19850 560330 560330 0.00
crit 7.52 19.93% 38378.51 35032 46897 38348.77 0 46897 288629 288629 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6025 5.5% 16.2 28.55sec 167979 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.9 18536 38361 22477 19.9% 0.0% 19.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.18 16.18 120.92 120.92 0.0000 0.7359 2717847.19 2717847.19 0.00 30542.07 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.9 80.12% 18535.89 17006 22766 18537.08 17794 19673 1795798 1795798 0.00
crit 24.0 19.88% 38360.83 35032 46897 38360.41 35934 41742 922049 922049 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6835) 0.0% (6.2%) 11.0 42.36sec 279178 243916 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.03 0.00 0.00 1.1446 0.0000 0.00 0.00 0.00 243916.09 243916.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.86 80.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.17 19.69% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6835 6.2% 11.0 42.36sec 279178 0 115066 238136 139589 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 22.06 0.00 0.00 0.0000 0.0000 3078952.80 3078952.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.66 80.07% 115066.16 104363 139821 115102.21 107956 123159 2032322 2032322 0.00
crit 4.40 19.93% 238136.09 214987 288030 235770.72 0 288030 1046631 1046631 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.36sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.03 232.80 0.00 0.00 0.0000 0.0000 0.00 45500602.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.38 77.05% 0.00 0 0 0.00 0 0 0 28154481 100.00
crit 53.43 22.95% 0.00 0 0 0.00 0 0 0 17346121 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9509 8.6% 39.4 11.45sec 108892 85975 89856 185954 108891 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 1.2666 0.0000 4288348.61 4288348.61 0.00 85975.03 85975.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.58 80.19% 89855.81 82079 110390 89873.93 86868 93331 2837666 2837666 0.00
crit 7.80 19.81% 185953.85 169082 227403 185922.49 0 211409 1450683 1450683 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13293 (17439) 12.0% (15.8%) 100.2 4.39sec 78360 48640 0 0 0 0.0% 0.0% 0.0% 0.0% 204.4 24092 49980 29273 20.0% 0.0% 31.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.20 100.20 204.44 204.44 1.6110 0.7028 5984379.31 5984379.31 0.00 48639.72 48639.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.5 79.99% 24091.80 21797 29181 24096.93 23536 24835 3939548 3939548 0.00
crit 40.9 20.01% 49979.78 44901 60113 49994.53 47343 53139 2044832 2044832 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4146 3.8% 63.8 6.78sec 29254 0 24113 49968 29270 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.83 63.80 0.00 0.00 0.0000 0.0000 1867336.77 1867336.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.07 80.06% 24112.80 21797 29181 24118.70 23040 25456 1231526 1231526 0.00
crit 12.72 19.94% 49968.49 44901 60113 49990.32 44901 57033 635811 635811 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1439 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3554 3.2% 14.6 4.94sec 109746 94561 90140 186824 109747 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 1.1607 0.0000 1601951.25 1601951.25 0.00 94560.61 94560.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.64 79.72% 90140.46 79678 107383 90219.89 83279 101723 1048952 1048952 0.00
crit 2.96 20.28% 186823.80 164137 221210 179832.42 0 221210 552999 552999 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18879 (24614) 17.1% (22.3%) 80.1 5.61sec 138517 119586 0 0 0 0.0% 0.0% 0.0% 0.0% 487.7 14372 29770 17445 20.0% 0.0% 194.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.08 80.08 487.69 487.69 1.1583 1.8012 8507722.19 8507722.19 0.00 11421.74 119586.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 390.4 80.04% 14371.96 12783 17966 14375.07 14050 14743 5610183 5610183 0.00
crit 97.3 19.96% 29770.14 26333 37009 29776.25 28652 31006 2897539 2897539 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5736 5.2% 152.3 2.93sec 16967 0 13999 28986 16982 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.34 152.21 0.00 0.00 0.0000 0.0000 2584842.34 2584842.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.92 80.10% 13999.50 12783 17110 14002.45 13553 14528 1706773 1706773 0.00
crit 30.29 19.90% 28985.54 26333 35247 28991.66 27355 31063 878069 878069 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4608 4.2% 98.8 4.52sec 21017 0 17787 35749 21381 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.84 97.16 0.00 0.00 0.0000 0.0000 2077285.63 2077285.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.71 79.99% 17786.83 15875 22484 17790.46 17198 18424 1382283 1382283 0.00
crit 19.44 20.01% 35748.78 31750 44968 35755.18 33117 39015 695002 695002 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16323 (21311) 14.8% (19.3%) 58.8 7.57sec 163322 140546 0 0 0 0.0% 0.0% 0.0% 0.0% 375.9 16131 33411 19568 19.9% 0.0% 178.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.80 58.80 375.87 375.87 1.1621 2.1463 7355114.65 7355114.65 0.00 10973.89 140546.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.1 80.11% 16130.69 14287 20366 16133.73 15618 16703 4856874 4856874 0.00
crit 74.8 19.89% 33411.02 29431 41955 33416.03 31870 34943 2498241 2498241 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4988 4.5% 117.6 3.75sec 19107 0 15753 32647 19122 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.63 117.54 0.00 0.00 0.0000 0.0000 2247575.35 2247575.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.10 80.06% 15753.26 14287 19397 15756.81 15206 16397 1482360 1482360 0.00
crit 23.44 19.94% 32647.33 29431 39957 32653.76 30364 35171 765215 765215 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37681 / 9774
melee 37681 8.8% 105.3 4.17sec 41776 39180 36484 73510 41776 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.35 105.35 0.00 0.00 1.0663 0.0000 4401069.59 4401069.59 0.00 39180.17 39180.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.82 55.84% 36484.42 29063 44745 36493.88 34597 38386 2146067 2146067 0.00
crit 21.25 20.17% 73510.40 58126 89490 73521.53 65719 81467 1562060 1562060 0.00
glance 25.28 23.99% 27413.46 21797 33559 27418.14 25173 29849 692942 692942 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.43 23.43 0.00 0.00 1.1245 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.25%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.53%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.5 36.4sec 20.1sec 44.54% 45.06%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.54%

    Trigger Attempt Success

    • trigger_pct:1.73%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.43% 42.43%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.43%

    Trigger Attempt Success

    • trigger_pct:14.29%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.52%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.47% 49.52%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.92%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no2PT14
devouring_plague Shadow Orb 16.2 48.5 3.0 3.0 118974.1
halo Mana 11.0 418630.0 37958.4 37958.4 7.4
mind_blast Mana 39.4 343250.5 8716.0 8716.0 12.5
mind_flay Mana 100.2 286192.6 2856.2 2856.2 27.4
shadow_word_death Mana 14.6 109696.0 7514.7 7515.0 14.6
shadow_word_pain Mana 80.1 1018937.4 12724.0 12723.9 10.9
vampiric_touch Mana 58.8 510393.3 8680.7 8680.7 18.8
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.35 284841.05 (10.72%) 2703.78 176688.43 38.28%
Shadow Orbs from Mind Blast Shadow Orb 39.38 39.38 (84.24%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (15.76%) 1.00 0.00 0.00%
Devouring Plague Health Health 158.65 0.00 (-nan%) 0.00 2203058.46 100.00%
Vampiric Touch Mana Mana 493.40 1947710.77 (73.32%) 3947.49 660108.11 25.31%
mp5_regen Mana 1803.14 423742.58 (15.95%) 235.00 117200.48 21.67%
Resource RPS-Gain RPS-Loss
Mana 5890.97 5959.29
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 269189.71 99072.38 300000.00
Shadow Orb 1.21 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.8%
shadowfiend-Mana Cap 21.8%
lightwell-Mana Cap 21.8%

Procs

Count Interval
Shadowy Recall Extra Tick 371.3 1.2sec
Shadowy Apparition Procced 98.8 4.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no2PT14 Damage Per Second
Count 49992
Mean 110450.26
Minimum 103723.71
Maximum 118524.87
Spread ( max - min ) 14801.16
Range [ ( max - min ) / 2 * 100% ] 6.70%
Standard Deviation 2022.1590
5th Percentile 107201.25
95th Percentile 113897.33
( 95th Percentile - 5th Percentile ) 6696.08
Mean Distribution
Standard Deviation 9.0441
95.00% Confidence Intervall ( 110432.54 - 110467.99 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1287
0.1 Scale Factor Error with Delta=300 34907
0.05 Scale Factor Error with Delta=300 139628
0.01 Scale Factor Error with Delta=300 3490714
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 110450.26
Distribution Chart

Damage

Sample Data
Count 49992
Mean 45368452.53
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 297.88
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 4.15 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.60 shadow_word_death,if=active_enemies<=5
F 44.84 mind_blast,if=active_enemies<=6&cooldown_react
G 43.65 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.43 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.03 halo,if=talent.halo.enabled
M 12.03 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.85 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.34 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.31 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.43 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHTFTWWWWWFHHGMTFLTHHTGFGTAWWFHHMTGFTHHTGTFLTWWWGHFHMTQFTHHGGTFTCGAWFHHLMTGTFTHGHFTGWWWWFHHTFTGHHLGFMTWAWFGHHTQFTHHTFGGMTWLWWFHHTGFTHHTGFMTGACGFHHTLQFTGTGFHHTWWWWFHHMGTFTHGFHLTGWWAFHHTFMGHTGHQFTWWWWWFGHHLTQFTGFHGHMTGWACFHHTGFTEDEGHHLFTPEEWGWWFDEEHHTFTEDEGGHFHTEE9WWAFHDEEGHHFLTEDEGHQFTHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no4PT14 : 113644 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113643.9 113643.9 17.35 / 0.02% 3236 / 2.8% 17.4 5959.3 5891.0 Mana 0.29% 39.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:307923|243815|140567|130016|94359|86033|48670&chds=0,615846&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++307923++devouring_plague,9482C9,0,0,15|t++243815++halo,9482C9,1,0,15|t++140567++vampiric_touch,9482C9,2,0,15|t++130016++shadow_word_pain,9482C9,3,0,15|t++94359++shadow_word_death,9482C9,4,0,15|t++86033++mind_blast,9482C9,5,0,15|t++48670++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,16,13,9,9,7,6,6,5,5,5,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mindbender: melee|mind_blast|halo_damage|shadow_word_pain_mastery|devouring_plague_tick|shadowy_apparition|vampiric_touch_mastery|devouring_plague|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_mb_no4PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:024686565432356343442zxvrpqpnmmnopqqsqqponnmmmnlmmlkiihgeddeeghjklmmmnmmnnnmoqopnmkjhffeddddeffghedddddddefgghgfeddcedhijlmopqqrrrrrssttustpnmkjhggfdccccddcddeeeefffhiiijiiihhghhhgfffghhhhiiiijjijkkjkmmmmlkljiihhhiiiiiiiggfeeeggghgfeddceeeefhikmmonoppqrrssussttrpnmjkiigfeeefeeddddccccefefffeffeefffghijjllllmmmnnnmmnnnnmlkkjhihgggggiijkkkkllllllmmmnkjihgfffffffghjjklmmpqssttvvvvvuusrqqponmkkkkjkkjjkjjjjjkjijihiijiiiijjjklmmnoqrsuvuutvvwvvvvuutttsrqpppppqqqqqqpppppooonllkkjjiiiijklmnpqrstwyz0122222211zyxwvutsqqpppoooooonnnoooonmmmlklkjjjjjiiiihhgg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6235,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113644|max=182275&chxp=1,1,62,100&chtt=priest_90_pi_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,0,0,8,24,8,56,32,72,152,176,304,456,576,800,1168,1568,1920,2000,2472,2680,3096,3168,3176,3328,3152,3112,2824,2512,2168,1888,1464,1216,1120,880,728,464,424,200,232,120,88,24,32,32,8,16,8,8,8&chds=0,3328&chbh=5&chxt=x&chxl=0:|min=105747|avg=113644|max=121896&chxp=0,1,49,100&chtt=priest_90_pi_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.8,20.6,15.2,11.1,4.2,3.8,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 161.5s|shadow_word_pain 92.7s|vampiric_touch 68.3s|mind_blast 49.9s|devouring_plague 18.7s|shadow_word_death 16.9s|halo 12.6s|mindbender 7.9s|waiting 1.3s&chtt=priest_90_pi_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no4PT14 113644
devouring_plague 4897 (12801) 4.3% (11.3%) 16.2 28.52sec 356508 307923 112409 232645 136287 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 0.00 0.00 1.1578 0.0000 2206900.95 2206900.95 0.00 307922.84 307922.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.98 80.14% 112409.07 102399 137090 112436.75 103629 119696 1458740 1458740 0.00
crit 3.22 19.86% 232645.08 210941 282405 225361.06 0 282405 748161 748161 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1883 1.7% 37.9 10.93sec 22421 0 18546 38403 22458 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.88 37.82 0.00 0.00 0.0000 0.0000 849379.67 849379.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.37 80.30% 18545.73 17006 22766 18547.34 17490 19923 563194 563194 0.00
crit 7.45 19.70% 38402.58 35032 46897 38380.10 0 46897 286186 286186 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6022 5.3% 16.2 28.52sec 167767 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.9 18529 38371 22464 19.8% 0.0% 19.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 120.94 120.94 0.0000 0.7359 2716656.80 2716656.80 0.00 30525.26 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.0 80.17% 18528.52 17006 22766 18529.30 17541 19586 1796378 1796378 0.00
crit 24.0 19.83% 38370.82 35032 46897 38368.57 35483 41679 920279 920279 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6833) 0.0% (6.0%) 11.0 42.34sec 279014 243815 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.03 0.00 0.00 1.1444 0.0000 0.00 0.00 0.00 243815.16 243815.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.84 80.13% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.19 19.87% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6833 6.0% 11.0 42.34sec 279014 0 115079 237958 139508 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 22.06 0.00 0.00 0.0000 0.0000 3077678.72 3077678.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.68 80.12% 115078.88 104363 139821 115109.88 107355 123077 2034069 2034069 0.00
crit 4.39 19.88% 237957.71 214987 288030 235447.63 0 288030 1043610 1043610 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.34sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.03 232.92 0.00 0.00 0.0000 0.0000 0.00 45524765.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.43 77.04% 0.00 0 0 0.00 0 0 0 28160519 100.00
crit 53.49 22.96% 0.00 0 0 0.00 0 0 0 17364247 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9515 8.4% 39.4 11.44sec 108891 86033 89850 185997 108891 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.41 39.41 0.00 0.00 1.2657 0.0000 4291926.52 4291926.52 0.00 86032.96 86032.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.61 80.20% 89849.75 82079 110390 89865.22 85800 94081 2840054 2840054 0.00
crit 7.81 19.80% 185996.95 169082 227403 186031.98 169082 222230 1451873 1451873 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13291 (17455) 11.7% (15.3%) 100.2 4.39sec 78441 48670 0 0 0 0.0% 0.0% 0.0% 0.0% 204.4 24094 49949 29268 20.0% 0.0% 31.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.18 100.18 204.45 204.45 1.6117 0.7028 5983756.73 5983756.73 0.00 48670.04 48670.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.5 79.99% 24093.66 21797 29181 24098.55 23428 24867 3940017 3940017 0.00
crit 40.9 20.01% 49948.53 44901 60113 49956.86 47320 52902 2043740 2043740 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4164 3.7% 64.0 6.77sec 29275 0 24106 49987 29290 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.02 63.99 0.00 0.00 0.0000 0.0000 1874264.57 1874264.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.18 79.97% 24106.40 21797 29181 24111.24 23108 25432 1233652 1233652 0.00
crit 12.82 20.03% 49986.56 44901 60113 49999.66 44901 57933 640612 640612 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1444 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3545 3.1% 14.6 4.94sec 109500 94359 90114 186797 109500 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 1.1605 0.0000 1598724.84 1598724.84 0.00 94359.02 94359.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.67 79.95% 90113.56 79678 107383 90182.06 81781 101599 1051875 1051875 0.00
crit 2.93 20.05% 186797.02 164137 221210 178576.54 0 221210 546850 546850 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 20513 (26754) 18.1% (23.5%) 80.1 5.61sec 150605 130016 0 0 0 0.0% 0.0% 0.0% 0.0% 487.7 14369 29723 18956 29.9% 0.0% 194.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.05 80.05 487.68 487.68 1.1584 1.8014 9244579.02 9244579.02 0.00 12413.80 130015.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 342.0 70.12% 14368.83 12783 17966 14371.70 14032 14834 4913737 4913737 0.00
crit 145.7 29.88% 29723.36 26333 37009 29729.32 28484 31017 4330842 4330842 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6240 5.5% 152.4 2.93sec 18453 0 13993 28944 18469 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.39 152.25 0.00 0.00 0.0000 0.0000 2811898.90 2811898.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.68 70.07% 13993.45 12783 17110 13996.54 13565 14442 1492785 1492785 0.00
crit 45.58 29.93% 28943.73 26333 35247 28949.95 27584 30566 1319114 1319114 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5662 5.0% 121.6 3.68sec 20990 0 17779 35751 21351 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.61 119.55 0.00 0.00 0.0000 0.0000 2552624.15 2552624.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.79 80.12% 17778.81 15875 22484 17782.78 17286 18329 1703011 1703011 0.00
crit 23.76 19.88% 35751.28 31750 44968 35758.24 33792 39004 849613 849613 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16327 (21313) 14.4% (18.8%) 58.8 7.57sec 163311 140567 0 0 0 0.0% 0.0% 0.0% 0.0% 376.0 16133 33411 19569 19.9% 0.0% 178.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.81 58.81 375.97 375.97 1.1618 2.1462 7357364.76 7357364.76 0.00 10973.36 140566.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.2 80.11% 16133.30 14287 20366 16135.96 15598 16846 4859348 4859348 0.00
crit 74.8 19.89% 33410.52 29431 41955 33415.51 31906 35244 2498017 2498017 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4986 4.4% 117.6 3.75sec 19105 0 15751 32641 19120 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.59 117.50 0.00 0.00 0.0000 0.0000 2246587.02 2246587.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.07 80.06% 15751.23 14287 19397 15754.60 15261 16393 1481666 1481666 0.00
crit 23.43 19.94% 32640.83 29431 39957 32648.55 30293 35440 764921 764921 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37649 / 9766
melee 37649 8.6% 105.3 4.17sec 41744 39148 36473 73497 41745 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.35 105.35 0.00 0.00 1.0663 0.0000 4397591.63 4397591.63 0.00 39148.16 39148.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.88 55.89% 36473.42 29063 44745 36483.18 34600 38490 2147541 2147541 0.00
crit 21.19 20.12% 73496.84 58126 89490 73516.77 66779 80488 1557457 1557457 0.00
glance 25.28 23.99% 27402.10 21797 33559 27406.46 25398 29739 692593 692593 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.43 23.43 0.00 0.00 1.1245 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.24%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.48%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.4sec 20.2sec 44.34% 44.87%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.34%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.43% 42.43%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.43%

    Trigger Attempt Success

    • trigger_pct:14.36%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.51%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.47% 49.51%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no4PT14
devouring_plague Shadow Orb 16.2 48.6 3.0 3.0 118835.2
halo Mana 11.0 418560.0 37945.5 37945.5 7.4
mind_blast Mana 39.4 343547.4 8716.2 8716.2 12.5
mind_flay Mana 100.2 286128.1 2856.2 2856.2 27.5
shadow_word_death Mana 14.6 109724.2 7514.9 7515.2 14.6
shadow_word_pain Mana 80.1 1018712.2 12725.5 12725.4 11.8
vampiric_touch Mana 58.8 510440.0 8679.8 8679.8 18.8
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.35 284485.17 (10.71%) 2700.48 177030.99 38.36%
Shadow Orbs from Mind Blast Shadow Orb 39.41 39.41 (84.25%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (15.75%) 1.00 0.00 0.00%
Devouring Plague Health Health 158.76 0.00 (-nan%) 0.00 2204569.33 100.00%
Vampiric Touch Mana Mana 493.47 1948055.44 (73.34%) 3947.66 660259.28 25.31%
mp5_regen Mana 1803.14 423788.53 (15.95%) 235.03 117154.52 21.66%
Resource RPS-Gain RPS-Loss
Mana 5891.04 5959.31
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 269213.08 121452.38 300000.00
Shadow Orb 1.21 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.8%
shadowfiend-Mana Cap 21.8%
lightwell-Mana Cap 21.8%

Procs

Count Interval
Shadowy Recall Extra Tick 371.6 1.2sec
Shadowy Apparition Procced 121.6 3.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no4PT14 Damage Per Second
Count 49992
Mean 113643.85
Minimum 105747.27
Maximum 121895.95
Spread ( max - min ) 16148.68
Range [ ( max - min ) / 2 * 100% ] 7.10%
Standard Deviation 1979.3963
5th Percentile 110539.65
95th Percentile 117010.92
( 95th Percentile - 5th Percentile ) 6471.27
Mean Distribution
Standard Deviation 8.8528
95.00% Confidence Intervall ( 113626.50 - 113661.21 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1165
0.1 Scale Factor Error with Delta=300 33446
0.05 Scale Factor Error with Delta=300 133785
0.01 Scale Factor Error with Delta=300 3344638
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113643.85
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46812342.67
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 297.96
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 4.17 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.60 shadow_word_death,if=active_enemies<=5
F 44.85 mind_blast,if=active_enemies<=6&cooldown_react
G 43.64 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.44 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.03 halo,if=talent.halo.enabled
M 12.03 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.86 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.37 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.36 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.41 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHTFTWWWWFHHGMTFLTHHTGFTGTAWWFHHTFGMHHTGQFLTWWWGFHHTFTHGHFGMTACGWFHHLTGTFTGHHQFMTGWWWWFHHTFTGHLHTFGMTWAWFGHHTQQFTHHGQFMGTLWWWFHHTQFGTHHQFGTGACGFHHMTLTFTGHHGQFTWWWWFHHMGTFTHHGLFTGWAFHHMTQFTGHGHQFTWWWWLFHGHMTQFTHGHFTGTGWWACFHHTLFGDEETHGHFTEDEWGWFHHEETQFMTEEGGHFHLED9EWFAHTHEEGQFTEDEFGHHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no2PT14 : 109986 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
109986.3 109986.3 18.55 / 0.02% 3503 / 3.2% 16.9 6285.3 6179.9 Mana 0.24% 41.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309358|240024|145188|141795|112807|94596|85820|49173&chds=0,618715&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309358++devouring_plague,9482C9,0,0,15|t++240024++halo,9482C9,1,0,15|t++145188++shadow_word_insanity,9482C9,2,0,15|t++141795++vampiric_touch,9482C9,3,0,15|t++112807++shadow_word_pain,9482C9,4,0,15|t++94596++shadow_word_death,9482C9,5,0,15|t++85820++mind_blast,9482C9,6,0,15|t++49173++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,16,11,9,9,6,6,5,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague|shadowy_apparition|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_swi_no2PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:576875666431356233330xuusqrpnnnopqrqsrqppoonooonnonlkjhfdbbbbceefeffggfghhghkmlnmmkiihhffffghhijjhffeeeefghhijihggfdddfghijklkllmmlmmmnnpopnmlkjjijhgeddeffeeeeffeeddeghhiiihiiijkjjikmnonomllllllkjmmlnmmkjihigijjkklmmnkkjjiiiijlkllihggfdfddddeffhghiijjjklnorqrrrrqppnpnljhhhhheeddddccbbcdddeeeffhgghghghjjkjkjkkjjjjigjkjkjjiiihighgghijklmlllllllmnoopppnmllkmkkkkmnoqppqqqqrssututuuutsqpnpommmlmmnmmmmmmmllllmlllkkkkkjjjijiiijkklllmnopppprrstttutttutttssrrsrsrrrqqqppoppppommmmlmlkkkklmnnoppqqsuvvvwvvwwwvvututtsrrqqqqqqrrssssssssrrqpppooppoopoooooopooo&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6253,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=109986|max=175882&chxp=1,1,63,100&chtt=priest_90_pi_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,0,24,16,24,88,120,208,272,488,696,808,1032,1312,1360,1824,2184,2664,2736,3072,2896,3104,3064,2896,2912,2584,2456,2048,1792,1664,1272,1048,760,600,480,504,264,144,176,104,112,56,56,0,8,16,8,0,8&chds=0,3104&chbh=5&chxt=x&chxl=0:|min=102396|avg=109986|max=118776&chxp=0,1,46,100&chtt=priest_90_pi_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.6,20.8,15.2,11.0,6.4,4.1,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 138.0s|shadow_word_pain 93.7s|vampiric_touch 68.4s|mind_blast 49.7s|shadow_word_insanity 29.0s|devouring_plague 18.6s|shadow_word_death 16.9s|halo 12.6s|shadowfiend 2.4s|waiting 1.1s&chtt=priest_90_pi_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no2PT14 109986
devouring_plague 4868 (12792) 4.4% (11.6%) 16.1 28.73sec 358391 309358 112439 232784 136335 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 0.00 0.00 1.1586 0.0000 2194215.80 2194215.80 0.00 309357.60 309357.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.90 80.14% 112438.60 102399 137090 112476.78 105179 119255 1450262 1450262 0.00
crit 3.20 19.86% 232784.26 210941 282405 225548.07 0 282405 743954 743954 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1895 1.7% 38.0 10.91sec 22505 0 18585 38469 22545 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.96 37.90 0.00 0.00 0.0000 0.0000 854365.73 854365.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.35 80.09% 18584.76 17006 22766 18590.39 17538 19720 564053 564053 0.00
crit 7.55 19.91% 38468.98 35032 46897 38450.37 0 46897 290313 290313 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6029 5.5% 16.1 28.73sec 168968 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.1 18531 38365 22448 19.7% 0.0% 19.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 121.14 121.14 0.0000 0.7380 2719391.02 2719391.02 0.00 30418.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.2 80.25% 18531.32 17006 22766 18534.49 17686 19520 1801531 1801531 0.00
crit 23.9 19.75% 38364.99 35032 46897 38366.37 35934 41619 917860 917860 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6692) 0.0% (6.1%) 10.8 43.40sec 279139 240024 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.80 10.80 0.00 0.00 1.1630 0.0000 0.00 0.00 0.00 240023.54 240023.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.64 79.99% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.16 20.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6692 6.1% 10.8 43.40sec 279139 0 115117 238453 139569 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.80 21.60 0.00 0.00 0.0000 0.0000 3014695.72 3014695.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.32 80.17% 115117.38 104363 139821 115128.00 107719 122870 1993542 1993542 0.00
crit 4.28 19.83% 238452.83 214987 288030 236121.41 0 288030 1021154 1021154 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.40sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.80 225.16 0.00 0.00 0.0000 0.0000 0.00 44071146.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.27 76.96% 0.00 0 0 0.00 0 0 0 27214092 100.00
crit 51.88 23.04% 0.00 0 0 0.00 0 0 0 16857055 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9458 8.6% 39.1 11.52sec 108943 85820 89858 185936 108942 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.14 39.14 0.00 0.00 1.2694 0.0000 4264321.05 4264321.05 0.00 85820.22 85820.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.37 80.14% 89858.15 82079 110390 89879.17 86664 93273 2818634 2818634 0.00
crit 7.78 19.86% 185936.37 169082 227403 186001.67 169082 210781 1445687 1445687 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 11476 (15073) 10.4% (13.7%) 86.7 5.06sec 78281 49173 0 0 0 0.0% 0.0% 0.0% 0.0% 176.3 24117 50016 29295 20.0% 0.0% 27.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.68 86.68 176.34 176.34 1.5919 0.6963 5165949.02 5165949.02 0.00 49173.28 49173.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.1 80.01% 24117.27 21797 29181 24123.43 23382 24912 3402584 3402584 0.00
crit 35.3 19.99% 50015.73 44901 60113 50029.33 47020 53521 1763365 1763365 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3597 3.3% 55.2 7.78sec 29314 0 24130 50034 29327 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.23 55.21 0.00 0.00 0.0000 0.0000 1619077.86 1619077.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.13 79.93% 24129.56 21797 29181 24136.84 22961 25668 1064816 1064816 0.00
crit 11.08 20.07% 50033.86 44901 60113 50043.25 44901 57483 554262 554262 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3552 3.2% 14.6 4.95sec 109713 94596 90135 186923 109713 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 1.1599 0.0000 1601695.70 1601695.70 0.00 94595.78 94595.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.65 79.77% 90134.82 79678 107383 90218.94 81934 99613 1049714 1049714 0.00
crit 2.95 20.23% 186923.13 164137 221210 179653.95 0 221210 551982 551982 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9327 8.5% 25.1 16.05sec 167717 145188 138442 286636 167718 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.11 25.11 0.00 0.00 1.1552 0.0000 4211318.93 4211318.93 0.00 145187.86 145187.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.15 80.25% 138441.93 122772 173880 138473.32 130982 149011 2789512 2789512 0.00
crit 4.96 19.75% 286636.11 252910 358194 285263.70 0 349665 1421807 1421807 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 17982 (23447) 16.4% (21.3%) 80.8 5.56sec 130734 112807 0 0 0 0.0% 0.0% 0.0% 0.0% 463.8 14393 29830 17472 19.9% 0.0% 181.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.82 80.82 463.77 463.77 1.1589 1.7657 8103115.05 8103115.05 0.00 11577.91 112807.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 371.3 80.06% 14393.24 12783 17966 14396.52 14072 14798 5343883 5343883 0.00
crit 92.5 19.94% 29830.45 26333 37009 29837.23 28734 31277 2759232 2759232 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5465 5.0% 145.1 3.08sec 16969 0 14002 29002 16984 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.11 144.99 0.00 0.00 0.0000 0.0000 2462412.72 2462412.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.16 80.12% 14001.66 12783 17110 14004.73 13577 14510 1626502 1626502 0.00
crit 28.82 19.88% 29002.48 26333 35247 29008.94 27142 31085 835911 835911 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2245 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4449 4.0% 95.5 4.68sec 21008 0 17789 35772 21370 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.48 93.86 0.00 0.00 0.0000 0.0000 2005796.02 2005796.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.17 80.09% 17789.22 15875 22484 17792.76 17195 18416 1337171 1337171 0.00
crit 18.69 19.91% 35772.44 31750 44968 35779.52 32805 39526 668625 668625 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16487 (21526) 15.0% (19.6%) 59.2 7.53sec 163965 141795 0 0 0 0.0% 0.0% 0.0% 0.0% 380.1 16123 33400 19555 19.9% 0.0% 180.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.18 59.18 380.07 380.07 1.1564 2.1414 7432305.04 7432305.04 0.00 10997.83 141795.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.6 80.14% 16123.20 14287 20366 16126.21 15635 16705 4910785 4910785 0.00
crit 75.5 19.86% 33399.77 29431 41955 33403.39 31815 35420 2521521 2521521 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5039 4.6% 118.9 3.70sec 19097 0 15747 32630 19113 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.94 118.84 0.00 0.00 0.0000 0.0000 2271325.45 2271325.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.15 80.06% 15746.96 14287 19397 15750.00 15086 16420 1498300 1498300 0.00
crit 23.69 19.94% 32629.99 29431 39957 32637.76 30630 35175 773026 773026 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46361 / 3670
melee 46361 3.3% 31.2 12.60sec 52472 51721 45733 92441 52471 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0145 0.0000 1635823.26 1635823.26 0.00 51720.73 51720.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 55.76% 45732.62 36329 55931 45745.19 41897 52724 795028 795028 0.00
crit 6.31 20.25% 92440.66 72658 111863 92338.09 0 111863 583686 583686 0.00
glance 7.48 23.98% 34386.59 27247 41949 34381.25 0 41949 257109 257109 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1378 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.36%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.57%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.2sec 20.2sec 44.55% 45.12%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.55%

    Trigger Attempt Success

    • trigger_pct:1.76%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.35% 42.35%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.35%

    Trigger Attempt Success

    • trigger_pct:14.23%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.03%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.46% 49.52%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.52%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no2PT14
devouring_plague Shadow Orb 16.1 48.3 3.0 3.0 119463.6
halo Mana 10.8 418525.1 38752.3 38752.4 7.2
mind_blast Mana 39.1 340918.6 8709.6 8709.6 12.5
mind_flay Mana 86.7 247599.4 2856.6 2856.6 27.4
shadow_word_death Mana 14.6 109598.6 7507.0 7507.3 14.6
shadow_word_insanity Mana 25.1 178852.8 7122.9 7122.9 23.5
shadow_word_pain Mana 80.8 1026400.3 12700.3 12700.3 10.3
vampiric_touch Mana 59.2 512210.0 8655.0 8655.0 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 160778.72 (5.77%) 5157.21 119800.96 42.70%
Shadow Orbs from Mind Blast Shadow Orb 39.14 39.14 (84.16%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (15.84%) 1.00 0.00 0.00%
Devouring Plague Health Health 159.04 0.00 (-nan%) 0.00 2208504.24 100.00%
Vampiric Touch Mana Mana 498.91 2166050.88 (77.73%) 4341.53 470910.24 17.86%
mp5_regen Mana 1803.14 459763.37 (16.50%) 254.98 81179.68 15.01%
Resource RPS-Gain RPS-Loss
Mana 6179.94 6285.30
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 252487.17 66120.00 300000.00
Shadow Orb 1.23 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.2%
shadowfiend-Mana Cap 15.2%
lightwell-Mana Cap 15.2%

Procs

Count Interval
Shadowy Recall Extra Tick 356.9 1.3sec
Shadowy Apparition Procced 95.5 4.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no2PT14 Damage Per Second
Count 49992
Mean 109986.25
Minimum 102395.55
Maximum 118776.25
Spread ( max - min ) 16380.71
Range [ ( max - min ) / 2 * 100% ] 7.45%
Standard Deviation 2116.3296
5th Percentile 106544.16
95th Percentile 113549.44
( 95th Percentile - 5th Percentile ) 7005.28
Mean Distribution
Standard Deviation 9.4653
95.00% Confidence Intervall ( 109967.70 - 110004.80 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1422
0.1 Scale Factor Error with Delta=300 38234
0.05 Scale Factor Error with Delta=300 152936
0.01 Scale Factor Error with Delta=300 3823404
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 109986.25
Distribution Chart

Damage

Sample Data
Count 49992
Mean 47919985.09
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 313.47
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 4.25 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.60 shadow_word_death,if=active_enemies<=5
F 44.93 mind_blast,if=active_enemies<=6&cooldown_react
G 45.61 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.64 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.11 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.80 halo,if=talent.halo.enabled
M 11.84 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.65 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.26 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.29 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 35.21 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFIGIGHHTQFMTWWWWWFHGHTFLTHHGFGTWWWFHHMIGTQFTHHIGFLIGTWWWWFHHMTIFGTHHGTFTCGGWFHHLMTFTIGGFHHTWWWWFIGHHTFTLIGHFGHMTBWWFHTHIGTFTHIGHFIGLMWWWFHHTIGFTHIGHTFMTIGCGWFHHTLTFTIGHIGFHTWWIFGHHMTFTIGHFGHLTWWWFHHTIGTFMTHIGHQFTIGWWWWFHHLTFIGTHIGHFMTBCGGFHHTFTEDEGGHHFLPEEWWWWFDEEGHHTFTEDEGHFHIGEE9WWFLHDEEHIFGTIEDEGFHHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no4PT14 : 113133 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113133.1 113133.1 18.62 / 0.02% 3490 / 3.1% 17.4 6285.2 6180.0 Mana 0.24% 41.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309411|240535|145117|141798|122597|94803|85771|49200&chds=0,618822&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309411++devouring_plague,9482C9,0,0,15|t++240535++halo,9482C9,1,0,15|t++145117++shadow_word_insanity,9482C9,2,0,15|t++141798++vampiric_touch,9482C9,3,0,15|t++122597++shadow_word_pain,9482C9,4,0,15|t++94803++shadow_word_death,9482C9,5,0,15|t++85771++mind_blast,9482C9,6,0,15|t++49200++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,15,10,9,9,6,6,5,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_swi_no4PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:576875566431357343330yvusrsqonopqqrrtrrqppoooopnoonmljigecbccdeefegfgggghhhikmmnnmkjihiggffghhikkhggfefefghiijihggfeedfghikklkmmmmmmnnnopoponmkkkijigfeeffgefefgfeeedeghhiiiiijjjkjjjlmnonomllllllkkmmmnnmkjiijhikjkllmnnlkkjijiiklkllihggfefdddeegghgiijkjklmnorqrssrqqpopnlkihiihffdeedccbbcdddeffffhhhhgihijjkjkkkkjkkjihjkkljjjiihjhhgghijklmlmlllllmnoopqpnnllkmlkklmnoqppqqqqrssututuuutsqpoponnmmmmnmmmmmnmmlmmmmlmlkkkkjkjjjiijjkkllmnnopppprssttuuuttutttssrrssssrrqqqppoppppommmmlmllkkllmnnpppqqsuvvvwwwwwwwvvtutttsrrqqqqqrrssssssssrrqpppooppooonnnnnnnnmm&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6310,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113133|max=179282&chxp=1,1,63,100&chtt=priest_90_pi_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,0,0,0,24,56,64,152,168,304,416,744,888,1176,1448,1712,1880,2536,2728,3248,3072,3192,3352,3440,2680,2904,2552,2424,1784,1440,1376,1104,864,616,392,376,328,152,104,120,64,24,24,24,8,16,8&chds=0,3440&chbh=5&chxt=x&chxl=0:|min=104247|avg=113133|max=121683&chxp=0,1,51,100&chtt=priest_90_pi_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.6,20.8,15.2,11.0,6.4,4.1,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 138.0s|shadow_word_pain 93.7s|vampiric_touch 68.4s|mind_blast 49.7s|shadow_word_insanity 29.0s|devouring_plague 18.6s|shadow_word_death 16.9s|halo 12.5s|shadowfiend 2.4s|waiting 1.1s&chtt=priest_90_pi_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no4PT14 113133
devouring_plague 4866 (12796) 4.3% (11.3%) 16.1 28.72sec 358457 309411 112423 232534 136221 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 0.00 0.00 1.1585 0.0000 2192411.81 2192411.81 0.00 309410.89 309410.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.91 80.19% 112422.85 102399 137090 112467.29 105252 120686 1450938 1450938 0.00
crit 3.19 19.81% 232533.88 210941 282405 225174.51 0 282405 741474 741474 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1896 1.7% 38.0 10.89sec 22483 0 18581 38474 22520 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.04 37.97 0.00 0.00 0.0000 0.0000 855199.56 855199.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.45 80.20% 18581.21 17006 22766 18584.80 17490 19960 565883 565883 0.00
crit 7.52 19.80% 38474.12 35032 46897 38467.69 0 46897 289316 289316 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6034 5.3% 16.1 28.72sec 169103 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.2 18528 38335 22447 19.8% 0.0% 19.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 121.25 121.25 0.0000 0.7380 2721664.09 2721664.09 0.00 30418.15 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.3 80.21% 18528.02 17006 22766 18530.77 17598 19536 1801921 1801921 0.00
crit 24.0 19.79% 38334.50 35032 46897 38335.79 35587 41464 919743 919743 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6698) 0.0% (5.9%) 10.8 43.40sec 279657 240535 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 1.1627 0.0000 0.00 0.00 0.00 240534.88 240534.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.65 80.14% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.14 19.86% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6698 5.9% 10.8 43.40sec 279657 0 115134 238321 139829 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 21.59 0.00 0.00 0.0000 0.0000 3018231.71 3018231.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.26 79.95% 115133.63 104363 139821 115147.92 108199 124006 1986972 1986972 0.00
crit 4.33 20.05% 238321.20 214987 288030 236481.21 0 288030 1031260 1031260 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.40sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.79 225.04 0.00 0.00 0.0000 0.0000 0.00 44028626.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.36 77.04% 0.00 0 0 0.00 0 0 0 27232706 100.00
crit 51.68 22.96% 0.00 0 0 0.00 0 0 0 16795920 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9454 8.4% 39.2 11.52sec 108841 85771 89834 186080 108840 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.16 39.16 0.00 0.00 1.2690 0.0000 4262129.47 4262129.47 0.00 85770.94 85770.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.43 80.25% 89834.23 82079 110390 89850.15 86644 93135 2823129 2823129 0.00
crit 7.73 19.75% 186080.47 169082 227403 186067.62 0 222230 1439000 1439000 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 11487 (15087) 10.1% (13.3%) 86.7 5.06sec 78346 49200 0 0 0 0.0% 0.0% 0.0% 0.0% 176.4 24119 50009 29310 20.0% 0.0% 27.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.67 86.67 176.40 176.40 1.5924 0.6962 5170235.95 5170235.95 0.00 49200.14 49200.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.0 79.95% 24119.24 21797 29181 24125.48 23477 24886 3401651 3401651 0.00
crit 35.4 20.05% 50008.93 44901 60113 50025.20 47042 53614 1768585 1768585 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3599 3.2% 55.2 7.78sec 29328 0 24138 50074 29344 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.24 55.21 0.00 0.00 0.0000 0.0000 1619973.89 1619973.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.13 79.93% 24137.84 21797 29181 24143.73 22924 25706 1065109 1065109 0.00
crit 11.08 20.07% 50073.65 44901 60113 50088.05 44901 57033 554865 554865 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3557 3.1% 14.6 4.95sec 109941 94803 90118 186860 109941 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.59 14.59 0.00 0.00 1.1597 0.0000 1603776.02 1603776.02 0.00 94802.63 94802.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.60 79.51% 90118.22 79678 107383 90191.49 80660 98482 1045250 1045250 0.00
crit 2.99 20.49% 186860.02 164137 221210 179925.75 0 221210 558526 558526 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9321 8.3% 25.1 16.04sec 167654 145117 138396 286263 167654 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.11 25.11 0.00 0.00 1.1553 0.0000 4209832.83 4209832.83 0.00 145116.61 145116.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.14 80.21% 138395.72 122772 173880 138444.22 130412 148261 2787542 2787542 0.00
crit 4.97 19.79% 286263.06 252910 358194 285087.69 0 358194 1422291 1422291 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 19552 (25488) 17.3% (22.5%) 80.8 5.56sec 142085 122597 0 0 0 0.0% 0.0% 0.0% 0.0% 463.7 14390 29774 18999 30.0% 0.0% 181.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.83 80.83 463.73 463.73 1.1590 1.7658 8810234.51 8810234.51 0.00 12585.68 122597.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 324.8 70.04% 14389.81 12783 17966 14393.49 14060 14757 4673875 4673875 0.00
crit 138.9 29.96% 29773.55 26333 37009 29780.82 28761 30841 4136359 4136359 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5936 5.2% 144.9 3.08sec 18456 0 14002 28958 18472 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.92 144.79 0.00 0.00 0.0000 0.0000 2674552.73 2674552.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.52 70.11% 14002.32 12783 17110 14005.52 13574 14507 1421460 1421460 0.00
crit 43.27 29.89% 28957.56 26333 35247 28962.40 27539 30731 1253093 1253093 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2246 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5529 4.9% 118.8 3.77sec 20984 0 17778 35746 21347 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.81 116.79 0.00 0.00 0.0000 0.0000 2493157.98 2493157.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.59 80.13% 17777.87 15875 22484 17782.02 17325 18336 1663832 1663832 0.00
crit 23.20 19.87% 35745.63 31750 44968 35753.94 33355 38837 829326 829326 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16495 (21529) 14.6% (19.0%) 59.2 7.52sec 163993 141798 0 0 0 0.0% 0.0% 0.0% 0.0% 380.1 16127 33399 19563 19.9% 0.0% 180.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.18 59.18 380.13 380.13 1.1565 2.1412 7436461.72 7436461.72 0.00 10999.51 141798.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.5 80.11% 16127.06 14287 20366 16130.22 15639 16691 4910752 4910752 0.00
crit 75.6 19.89% 33398.87 29431 41955 33404.09 31855 34804 2525709 2525709 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5034 4.5% 118.8 3.71sec 19099 0 15749 32631 19115 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.82 118.72 0.00 0.00 0.0000 0.0000 2269345.27 2269345.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.05 80.06% 15748.77 14287 19397 15752.31 15240 16478 1496993 1496993 0.00
crit 23.67 19.94% 32631.38 29431 39957 32638.93 30479 35579 772352 772352 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46379 / 3672
melee 46379 3.2% 31.2 12.61sec 52472 51735 45769 92394 52471 20.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.19 31.19 0.00 0.00 1.0143 0.0000 1636471.39 1636471.39 0.00 51734.68 51734.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.45 55.95% 45768.71 36329 55931 45786.49 40912 51534 798602 798602 0.00
crit 6.29 20.18% 92393.73 72658 111863 92346.89 0 111863 581462 581462 0.00
glance 7.45 23.87% 34437.07 27247 41949 34444.03 0 41949 256407 256407 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1379 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.36%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.47%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.4sec 20.1sec 44.45% 44.99%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.45%

    Trigger Attempt Success

    • trigger_pct:1.76%
light_of_the_cosmos 9.8 0.0 48.0sec 48.0sec 42.35% 42.35%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.35%

    Trigger Attempt Success

    • trigger_pct:14.27%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.03%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.46% 49.53%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.54%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no4PT14
devouring_plague Shadow Orb 16.1 48.3 3.0 3.0 119484.7
halo Mana 10.8 418241.2 38752.4 38752.6 7.2
mind_blast Mana 39.2 341048.4 8709.2 8709.3 12.5
mind_flay Mana 86.7 247578.1 2856.6 2856.6 27.4
shadow_word_death Mana 14.6 109515.2 7507.1 7507.4 14.6
shadow_word_insanity Mana 25.1 178859.5 7122.9 7123.0 23.5
shadow_word_pain Mana 80.8 1026570.5 12700.3 12700.3 11.2
vampiric_touch Mana 59.2 512241.7 8655.0 8655.0 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.19 160772.29 (5.77%) 5154.97 119918.27 42.72%
Shadow Orbs from Mind Blast Shadow Orb 39.16 39.16 (84.17%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.36 7.36 (15.83%) 1.00 0.00 0.00%
Devouring Plague Health Health 159.22 0.00 (-nan%) 0.00 2211066.04 100.00%
Vampiric Touch Mana Mana 498.85 2166060.02 (77.73%) 4342.11 470862.70 17.86%
mp5_regen Mana 1803.14 459774.12 (16.50%) 254.98 81168.93 15.01%
Resource RPS-Gain RPS-Loss
Mana 6179.97 6285.19
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 252563.89 97920.00 300000.00
Shadow Orb 1.24 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.2%
shadowfiend-Mana Cap 15.2%
lightwell-Mana Cap 15.2%

Procs

Count Interval
Shadowy Recall Extra Tick 356.7 1.3sec
Shadowy Apparition Procced 118.8 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no4PT14 Damage Per Second
Count 49992
Mean 113133.15
Minimum 104247.05
Maximum 121683.46
Spread ( max - min ) 17436.42
Range [ ( max - min ) / 2 * 100% ] 7.71%
Standard Deviation 2123.7655
5th Percentile 109715.93
95th Percentile 116695.85
( 95th Percentile - 5th Percentile ) 6979.92
Mean Distribution
Standard Deviation 9.4985
95.00% Confidence Intervall ( 113114.53 - 113151.76 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1353
0.1 Scale Factor Error with Delta=300 38503
0.05 Scale Factor Error with Delta=300 154012
0.01 Scale Factor Error with Delta=300 3850319
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113133.15
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49337207.54
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 313.47
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.24 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.59 shadow_word_death,if=active_enemies<=5
F 44.93 mind_blast,if=active_enemies<=6&cooldown_react
G 45.61 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.64 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.11 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.79 halo,if=talent.halo.enabled
M 11.85 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.64 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.28 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.28 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 35.22 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHTFTWWWWFHHGMTFLTHHIGFIGTWWWFHHTIGTFMTHHIGQFTIGLWWWFHHTFGTHGHFMTCGIGFHHTLTFTIGIGHHQFMTWWWWFHGHTQFTHHGFIGLTBWWFHHMIGTQFTHHIGFTIGWWWWFHHLMTIFGTHHGTFTGCGWFHHMTQFTIGGHFHLTWWWWFGHHTQFTIGHFGHMTWWWFHHLTIGFTHIGHFMTIGWWWFHHTQFIGTHIGHFLTGBCGFHHMTQFTIEEGIGFHHTEDEWWWFHGEEHLTFMTEEHGHFGT9EDEFHHTIGEEFGMHTEEFHIG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no2PT14 : 112963 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
112963.2 112963.2 20.26 / 0.02% 3832 / 3.4% 19.3 5661.8 5588.7 Mana 0.26% 44.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:312614|243784|136203|133584|105392|91940|79505|45239&chds=0,625228&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++312614++devouring_plague,9482C9,0,0,15|t++243784++halo,9482C9,1,0,15|t++136203++shadow_word_pain,9482C9,2,0,15|t++133584++vampiric_touch,9482C9,3,0,15|t++105392++shadow_word_death,9482C9,4,0,15|t++91940++mind_blast,9482C9,5,0,15|t++79505++mind_spike,4A79D3,6,0,15|t++45239++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,15,12,10,7,6,6,5,5,4,4,4,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:58777776664245735457532110zyxxwyyz010zywvttsrrrsstsrrrrplklkllmmmllllkjjkjjkmopppppoooonmmmmmnnnmkjiihhhiiklmnmlllljjkllmmnnoonnmlklmnnnoponmmmmlkkjijjkklllllllkkkklmoppqponopopooopqrsssrqqpppqqpppppppooonnmmmnooppqqqqqpppooooppqpnmlkjihggfgghiijjjjjijkllmnoqqrqqqponllkkklllllkkjiiiiijklmmmlllmllklmmnooppppoonooonnnoppooooonnmnnoopqsstuuuuuuvvwxyyyxvussrsrqqrstuvuuuutsuvvxwxwxxxxwwvuuttttuuvvwwwwwvvvuuuuvvvvtuuvuutttttuuvvwxxyxz000012444556666555445555555554432211120yxxxwwuttttstttvvwvvxzzzz00233445555443333444555544432221110zzzyyzyxxyyyyyyyyyzz&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.7178,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=112963|max=157369&chxp=1,1,72,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,0,80,48,120,192,208,232,384,512,784,728,1080,1152,1264,1424,1848,1808,1976,2424,2568,2712,2696,2832,2256,2536,2152,2232,2080,2112,1704,1392,1232,1048,856,632,632,440,328,328,248,176,184,96,72,40,24,48,8,40&chds=0,2832&chbh=5&chxt=x&chxl=0:|min=105864|avg=112963|max=121014&chxp=0,1,47,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.4,17.2,16.5,15.6,12.3,4.8,3.9,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 100.9s|shadow_word_pain 77.4s|mind_spike 74.2s|vampiric_touch 70.4s|mind_blast 55.4s|devouring_plague 21.7s|shadow_word_death 17.4s|halo 12.8s|shadowfiend 2.4s|waiting 1.2s&chtt=priest_90_tof_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no2PT14 112963
devouring_plague 5735 (15019) 5.1% (13.3%) 18.1 25.64sec 373121 312614 117402 243248 142387 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 0.00 0.00 1.1936 0.0000 2584098.83 2584098.83 0.00 312613.82 312613.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.55 80.15% 117402.16 102399 157653 117420.28 108442 126169 1707631 1707631 0.00
crit 3.60 19.85% 243248.14 210941 324765 238275.08 0 324765 876468 876468 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2218 2.0% 42.5 9.95sec 23565 0 19453 40322 23597 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.46 42.40 0.00 0.00 0.0000 0.0000 1000519.64 1000519.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.98 80.14% 19452.59 17006 26181 19453.61 17888 21158 661004 661004 0.00
crit 8.42 19.86% 40321.78 35032 53932 40315.72 0 53932 339515 339515 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7065 6.3% 18.1 25.64sec 175603 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.7 19386 40146 23493 19.8% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 135.66 135.66 0.0000 0.7583 3186909.39 3186909.39 0.00 30978.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.8 80.22% 19385.96 17006 26181 19386.48 18418 20572 2109624 2109624 0.00
crit 26.8 19.78% 40146.35 35032 53932 40148.45 37016 43976 1077285 1077285 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6921) 0.0% (6.1%) 10.9 42.99sec 286856 243784 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1767 0.0000 0.00 0.00 0.00 243783.81 243783.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 80.25% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6921 6.1% 10.9 42.99sec 286856 0 118358 244934 143427 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 21.74 0.00 0.00 0.0000 0.0000 3118238.75 3118238.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.43 80.19% 118358.17 104363 160794 118374.83 110173 128130 2063557 2063557 0.00
crit 4.31 19.81% 244934.40 214987 331235 242767.94 0 331235 1054682 1054682 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.99sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 228.92 0.00 0.00 0.0000 0.0000 0.00 45984406.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.43 77.07% 0.00 0 0 0.00 0 0 0 28462697 100.00
crit 52.49 22.93% 0.00 0 0 0.00 0 0 0 17521709 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11291 10.0% 45.4 9.88sec 112019 91940 92425 191321 112018 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.44 45.44 0.00 0.00 1.2184 0.0000 5089898.40 5089898.40 0.00 91940.15 91940.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.44 80.19% 92424.92 82079 126948 92438.78 88606 95964 3367571 3367571 0.00
crit 9.00 19.81% 191321.40 169082 261513 191396.32 169082 238336 1722328 1722328 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 7724 (10140) 6.8% (9.0%) 63.8 6.79sec 71615 45239 0 0 0 0.0% 0.0% 0.0% 0.0% 117.3 24418 50618 29659 20.0% 0.0% 19.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.75 63.75 117.25 117.25 1.5830 0.7324 3477547.99 3477547.99 0.00 45239.32 45239.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.8 80.00% 24417.79 21797 33558 24422.06 23322 25671 2290397 2290397 0.00
crit 23.5 20.00% 50618.22 44901 69130 50626.85 46776 57725 1187151 1187151 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2416 2.1% 36.7 11.38sec 29662 0 24438 50681 29672 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.68 36.67 0.00 0.00 0.0000 0.0000 1088049.70 1088049.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.36 80.06% 24438.43 21797 33558 24444.91 22926 26362 717430 717430 0.00
crit 7.31 19.94% 50681.36 44901 69130 50620.09 0 61023 370620 370620 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13090 11.6% 63.0 6.89sec 93706 79505 77309 160301 93706 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.00 63.00 0.00 0.00 1.1786 0.0000 5903156.63 5903156.63 0.00 79504.86 79504.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.55 80.24% 77309.19 68964 106992 77306.95 73457 82911 3908027 3908027 0.00
crit 12.45 19.76% 160300.51 142066 220403 160328.80 143531 188795 1995129 1995129 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4076 3.6% 14.6 4.95sec 125984 105392 103546 214600 125985 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.59 14.59 0.00 0.00 1.1954 0.0000 1838032.17 1838032.17 0.00 105391.75 105391.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.64 79.79% 103545.59 79678 123491 103642.42 91629 113812 1205425 1205425 0.00
crit 2.95 20.21% 214600.12 164137 254391 206442.23 0 254391 632607 632607 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17915 (23390) 15.9% (20.7%) 65.5 6.87sec 161027 136203 0 0 0 0.0% 0.0% 0.0% 0.0% 452.9 14698 30437 17830 19.9% 0.0% 194.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.47 65.47 452.91 452.91 1.1823 1.9330 8075417.31 8075417.31 0.00 11064.29 136203.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 362.8 80.10% 14697.86 12783 20660 14698.81 14323 15138 5332066 5332066 0.00
crit 90.1 19.90% 30437.05 26333 42560 30438.28 29099 31927 2743351 2743351 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5475 4.8% 141.7 3.15sec 17412 0 14377 29790 17427 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.72 141.60 0.00 0.00 0.0000 0.0000 2467668.36 2467668.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.58 80.21% 14376.79 12783 19677 14378.49 13775 14910 1632880 1632880 0.00
crit 28.02 19.79% 29790.21 26333 40534 29795.24 27424 32822 834789 834789 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2243 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4521 4.0% 94.6 4.72sec 21551 0 18251 36712 21921 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.57 92.98 0.00 0.00 0.0000 0.0000 2038147.52 2038147.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.50 80.12% 18251.36 15875 25856 18253.00 17604 18971 1359676 1359676 0.00
crit 18.48 19.88% 36712.36 31750 51713 36717.48 33669 41258 678471 678471 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15980 (20854) 14.2% (18.5%) 59.4 7.49sec 158305 133584 0 0 0 0.0% 0.0% 0.0% 0.0% 359.8 16510 34206 20021 19.8% 0.0% 178.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.38 59.38 359.79 359.79 1.1851 2.2356 7203265.44 7203265.44 0.00 10746.97 133583.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.4 80.16% 16509.71 14287 23421 16510.04 15983 17121 4761579 4761579 0.00
crit 71.4 19.84% 34205.84 29431 48248 34205.12 32544 36213 2441686 2441686 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4874 4.3% 112.3 3.91sec 19561 0 16147 33466 19577 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.33 112.24 0.00 0.00 0.0000 0.0000 2197279.19 2197279.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.01 80.19% 16146.61 14287 22306 16148.17 15477 17092 1453323 1453323 0.00
crit 22.23 19.81% 33466.27 29431 45950 33468.37 30593 37966 743956 743956 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46248 / 3662
melee 46248 3.2% 31.2 12.61sec 52358 51549 45662 92251 52358 20.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0157 0.0000 1632252.48 1632252.48 0.00 51549.16 51549.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.41 55.85% 45662.14 36329 55931 45678.44 41559 52158 795036 795036 0.00
crit 6.30 20.21% 92250.50 72658 111863 92179.29 0 111863 581198 581198 0.00
glance 7.46 23.94% 34303.03 27247 41949 34301.08 0 41949 256018 256018 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.40%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.69%
glyph_mind_spike 35.9 27.0 12.2sec 6.9sec 49.33% 70.86%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.33%
  • glyph_mind_spike_2:18.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.57% 43.81%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.57%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.2sec 48.2sec 42.16% 42.16%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.16%

    Trigger Attempt Success

    • trigger_pct:14.39%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.45% 49.52%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.45%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 42.7 28.0 10.2sec 6.2sec 43.11% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.69%
  • surge_of_darkness_2:10.42%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.2 133.7 15.5sec 0.7sec 19.79% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:19.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.37% 77.46%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no2PT14
devouring_plague Shadow Orb 18.1 54.4 3.0 3.0 124372.7
halo Mana 10.9 440251.2 40500.0 40500.1 7.1
mind_blast Mana 45.4 408942.7 9000.0 9000.0 12.4
mind_flay Mana 63.8 191255.5 3000.0 3000.0 23.9
shadow_word_death Mana 14.6 113801.4 7800.0 7800.3 16.2
shadow_word_pain Mana 65.5 864262.1 13200.0 13200.1 12.2
vampiric_touch Mana 59.4 534441.6 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 163181.38 (6.48%) 5234.33 117395.42 41.84%
Shadow Orbs from Mind Blast Shadow Orb 45.44 45.44 (86.05%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.36 7.36 (13.95%) 1.00 0.00 0.00%
Devouring Plague Health Health 178.06 0.00 (-nan%) 0.00 2472656.44 100.00%
Vampiric Touch Mana Mana 472.03 1923176.78 (76.32%) 4074.29 572282.26 22.93%
mp5_regen Mana 1803.14 433634.45 (17.21%) 240.49 107308.61 19.84%
Resource RPS-Gain RPS-Loss
Mana 5588.69 5661.79
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 267052.90 127200.00 300000.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 20.0%
shadowfiend-Mana Cap 20.0%
lightwell-Mana Cap 20.0%

Procs

Count Interval
Shadowy Recall Extra Tick 332.9 1.3sec
Shadowy Apparition Procced 94.6 4.7sec
FDCL Mind Spike proc 70.7 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 112963.23
Minimum 105863.58
Maximum 121013.98
Spread ( max - min ) 15150.40
Range [ ( max - min ) / 2 * 100% ] 6.71%
Standard Deviation 2310.8197
5th Percentile 109171.90
95th Percentile 116835.31
( 95th Percentile - 5th Percentile ) 7663.41
Mean Distribution
Standard Deviation 10.3351
95.00% Confidence Intervall ( 112942.97 - 112983.48 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1607
0.1 Scale Factor Error with Delta=300 45584
0.05 Scale Factor Error with Delta=300 182337
0.01 Scale Factor Error with Delta=300 4558435
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 112963.23
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49268229.33
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 333.36
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.65 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.59 shadow_word_death,if=active_enemies<=5
F 47.75 mind_blast,if=active_enemies<=6&cooldown_react
G 44.64 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.73 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 16.97 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 13.50 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.65 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.46 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 46.02 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 43.71 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.84 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTRTFRTGGHHFJMRTRWFWRHHTGQFRTRLTRFGHHMTGFRJRWHHFRTRRGQFJMHHRGFLRTWWWGFHHTFRTHGHRFGMRTGJFHHJLRRGFTTGHFHJMRRTWFGWHHRTFTTHFGGHLMRRFBRWHHFGRRTRTFHHMRGRFTGJRWWFHHLRTFMTGTHGHFJRTGFWGHHTQFMTTHHFLGGRTWWWRFHHJRTGFMTHHTFGTJRFGHHLTFGMTHHFGTGRRFHHTGQFMTTHGFHLTGGBRFHHTRQFMTEEGGFHHREDEWWLFHHEEGTFMTEEHGHFJRED9EGFHHJREEGFLMRTPEEGFHHRTP

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no4PT14 : 116208 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
116208.4 116208.4 20.37 / 0.02% 3838 / 3.3% 19.9 5659.3 5588.1 Mana 0.26% 44.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:312912|243876|148223|133731|105541|92026|79568|45231&chds=0,625825&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++312912++devouring_plague,9482C9,0,0,15|t++243876++halo,9482C9,1,0,15|t++148223++shadow_word_pain,9482C9,2,0,15|t++133731++vampiric_touch,9482C9,3,0,15|t++105541++shadow_word_death,9482C9,4,0,15|t++92026++mind_blast,9482C9,5,0,15|t++79568++mind_spike,4A79D3,6,0,15|t++45231++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,12,10,7,6,6,5,5,5,4,4,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:57787776665345745567642211zzyxxyz0120zyxvutssrsssussssrpmlllllmmnmmmmljkkkjknoqqqqpppoonmmmmnnnnmljjiiiiijklnonmmllkkkmmmnnoooonnmlmnnoopppnnnnmmlkjjjkkllmmmmmmllkklmopqqqpooppppoopqrttsrrqqpqqrqppppqqppoonnmnoopqqrqqqqqpppppopqqqomllkjihggghiijjkkkkjklmmmopqrrrrqponmllllmmmmllkkjiiiijklmnmlmmnmmllmnoopqqpppooopoonopqqppppoonnnoopqrsttuuvuvvvwwxyzyxvustsssrrrstuvuvuuutuvwxxxxxyyyxxwvvuutuuvvwwwwxwwvvvvvvvvwvuvvvvvututuuvwwxxyyyz010022455667666665555666666655433222220yyyywwvutttttuuvwwwvxz00z002344466665444444556666554432222210100010zxwwwwwwwvvvu&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.7266,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=116208|max=159930&chxp=1,1,73,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,16,24,40,32,64,80,112,216,256,424,480,784,840,1072,1632,1624,1952,2208,2312,2632,2528,2728,2848,2592,2656,2760,2640,2440,2048,1904,1264,1488,1088,760,888,640,448,480,288,216,176,144,48,16,16,32,24,16&chds=0,2848&chbh=5&chxt=x&chxl=0:|min=107861|avg=116208|max=124447&chxp=0,1,50,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.4,17.2,16.5,15.6,12.3,4.8,3.9,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 100.8s|shadow_word_pain 77.4s|mind_spike 74.4s|vampiric_touch 70.4s|mind_blast 55.4s|devouring_plague 21.7s|shadow_word_death 17.4s|halo 12.8s|shadowfiend 2.4s|waiting 1.2s&chtt=priest_90_tof_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no4PT14 116208
devouring_plague 5734 (15030) 4.9% (12.9%) 18.1 25.65sec 373481 312912 117397 243433 142423 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.14 18.14 0.00 0.00 1.1936 0.0000 2584244.23 2584244.23 0.00 312912.46 312912.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.54 80.14% 117397.24 102399 157653 117415.37 109295 125414 1707171 1707171 0.00
crit 3.60 19.86% 243432.76 210941 324765 239432.09 0 324765 877073 877073 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2223 1.9% 42.5 9.94sec 23582 0 19465 40332 23612 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.51 42.46 0.00 0.00 0.0000 0.0000 1002526.66 1002526.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.02 80.13% 19465.37 17006 26181 19467.97 18110 21324 662209 662209 0.00
crit 8.44 19.87% 40331.64 35032 53932 40315.55 0 51512 340318 340318 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7073 6.1% 18.1 25.65sec 175806 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.7 19387 40172 23501 19.8% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.14 18.14 135.74 135.74 0.0000 0.7583 3189974.29 3189974.29 0.00 30992.89 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.9 80.21% 19387.40 17006 26181 19387.49 18397 20688 2110844 2110844 0.00
crit 26.9 19.79% 40171.62 35032 53932 40174.47 37148 44434 1079131 1079131 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6911) 0.0% (5.9%) 10.9 43.01sec 286943 243876 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.85 10.85 0.00 0.00 1.1766 0.0000 0.00 0.00 0.00 243876.27 243876.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 80.30% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.14 19.70% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6911 5.9% 10.9 43.01sec 286943 0 118325 244928 143472 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.85 21.71 0.00 0.00 0.0000 0.0000 3114543.88 3114543.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 80.14% 118325.39 104363 160794 118339.32 109586 128863 2058481 2058481 0.00
crit 4.31 19.86% 244928.35 214987 331235 242823.44 0 331235 1056063 1056063 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 43.01sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.85 228.63 0.00 0.00 0.0000 0.0000 0.00 45914796.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.22 77.08% 0.00 0 0 0.00 0 0 0 28421706 100.00
crit 52.41 22.92% 0.00 0 0 0.00 0 0 0 17493090 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11302 9.7% 45.4 9.88sec 112104 92026 92433 191380 112104 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.44 45.44 0.00 0.00 1.2182 0.0000 5094031.15 5094031.15 0.00 92026.43 92026.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.41 80.12% 92433.12 82079 126948 92445.17 88278 97112 3365163 3365163 0.00
crit 9.03 19.88% 191380.10 169082 261513 191450.43 169082 249617 1728868 1728868 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 7712 (10128) 6.6% (8.7%) 63.7 6.80sec 71620 45231 0 0 0 0.0% 0.0% 0.0% 0.0% 117.1 24416 50615 29659 20.0% 0.0% 19.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.66 63.66 117.05 117.05 1.5834 0.7325 3471575.64 3471575.64 0.00 45231.37 45231.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.6 79.99% 24416.30 21797 33558 24420.74 23157 25762 2286050 2286050 0.00
crit 23.4 20.01% 50615.49 44901 69130 50627.08 46235 56336 1185526 1185526 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2417 2.1% 36.7 11.38sec 29655 0 24442 50684 29665 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.69 36.67 0.00 0.00 0.0000 0.0000 1087927.28 1087927.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.37 80.09% 24441.55 21797 33558 24446.53 22813 26618 717910 717910 0.00
crit 7.30 19.91% 50683.79 44901 69130 50622.74 0 61351 370017 370017 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13133 11.3% 63.1 6.88sec 93770 79568 77345 160267 93771 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.15 63.15 0.00 0.00 1.1785 0.0000 5921426.61 5921426.61 0.00 79567.68 79567.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.64 80.19% 77344.80 68964 106992 77349.08 73426 81777 3916771 3916771 0.00
crit 12.51 19.81% 160267.05 142066 220403 160267.87 142066 190969 2004655 2004655 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4080 3.5% 14.6 4.95sec 126141 105541 103559 214492 126138 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.59 14.59 0.00 0.00 1.1952 0.0000 1840102.16 1840102.16 0.00 105540.70 105540.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.62 79.64% 103558.62 79678 123491 103647.45 95501 116174 1203149 1203149 0.00
crit 2.97 20.36% 214491.77 164137 254391 206269.60 0 254391 636953 636953 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19485 (25444) 16.8% (21.9%) 65.5 6.88sec 175243 148223 0 0 0 0.0% 0.0% 0.0% 0.0% 452.9 14701 30410 19392 29.9% 0.0% 194.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.45 65.45 452.93 452.93 1.1823 1.9332 8783433.18 8783433.18 0.00 12035.76 148222.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 317.7 70.13% 14700.81 12783 20660 14701.62 14284 15191 4669823 4669823 0.00
crit 135.3 29.87% 30409.51 26333 42560 30410.94 29368 31837 4113610 4113610 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5959 5.1% 141.8 3.15sec 18946 0 14377 29742 18963 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.80 141.68 0.00 0.00 0.0000 0.0000 2686641.57 2686641.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.39 70.15% 14376.86 12783 19677 14378.51 13872 14973 1428932 1428932 0.00
crit 42.29 29.85% 29742.28 26333 40534 29746.94 28180 32721 1257709 1257709 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2240 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5640 4.9% 118.0 3.79sec 21558 0 18256 36734 21927 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.97 115.99 0.00 0.00 0.0000 0.0000 2543237.52 2543237.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.94 80.13% 18255.52 15875 25856 18257.80 17676 18912 1696666 1696666 0.00
crit 23.05 19.87% 36734.48 31750 51713 36737.56 34023 40324 846572 846572 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15991 (20882) 13.8% (18.0%) 59.4 7.49sec 158480 133731 0 0 0 0.0% 0.0% 0.0% 0.0% 359.8 16515 34209 20034 19.9% 0.0% 178.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.39 59.39 359.79 359.79 1.1851 2.2358 7208104.88 7208104.88 0.00 10759.67 133730.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.2 80.11% 16514.57 14287 23421 16515.24 16008 17130 4759927 4759927 0.00
crit 71.6 19.89% 34209.04 29431 48248 34208.27 32381 36347 2448178 2448178 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4891 4.2% 112.6 3.91sec 19577 0 16153 33480 19594 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.61 112.51 0.00 0.00 0.0000 0.0000 2204517.08 2204517.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.17 80.14% 16152.56 14287 22306 16154.76 15487 16955 1456420 1456420 0.00
crit 22.34 19.86% 33479.81 29431 45950 33485.43 30591 37791 748097 748097 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46199 / 3659
melee 46199 3.1% 31.2 12.61sec 52296 51487 45640 92149 52297 20.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0157 0.0000 1630395.89 1630395.89 0.00 51487.27 51487.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 55.72% 45640.10 36329 55931 45660.72 40817 51562 792882 792882 0.00
crit 6.29 20.18% 92148.83 72658 111863 92083.18 0 111863 579645 579645 0.00
glance 7.51 24.10% 34321.15 27247 41949 34333.10 29155 41949 257869 257869 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1997 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.40%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.51%
glyph_mind_spike 36.0 27.2 12.2sec 6.9sec 49.39% 70.81%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.41%
  • glyph_mind_spike_2:17.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.67% 43.92%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.67%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.2sec 48.2sec 42.16% 42.16%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.16%

    Trigger Attempt Success

    • trigger_pct:14.44%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.45% 49.49%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.45%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 42.9 28.0 10.2sec 6.2sec 43.21% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.76%
  • surge_of_darkness_2:10.45%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.2 138.1 15.7sec 0.6sec 19.89% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:19.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.37% 77.45%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no4PT14
devouring_plague Shadow Orb 18.1 54.4 3.0 3.0 124493.8
halo Mana 10.9 439596.7 40500.0 40500.1 7.1
mind_blast Mana 45.4 408955.7 9000.0 8999.9 12.5
mind_flay Mana 63.7 190990.1 3000.0 3000.1 23.9
shadow_word_death Mana 14.6 113787.6 7800.0 7800.3 16.2
shadow_word_pain Mana 65.5 863953.7 13200.0 13199.8 13.3
vampiric_touch Mana 59.4 534538.1 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 163248.10 (6.48%) 5236.28 117338.78 41.82%
Shadow Orbs from Mind Blast Shadow Orb 45.44 45.44 (86.05%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (13.95%) 1.00 0.00 0.00%
Devouring Plague Health Health 178.20 0.00 (-nan%) 0.00 2474527.25 100.00%
Vampiric Touch Mana Mana 472.30 1922967.98 (76.32%) 4071.47 573316.66 22.97%
mp5_regen Mana 1803.14 433498.18 (17.20%) 240.41 107444.88 19.86%
Resource RPS-Gain RPS-Loss
Mana 5588.07 5659.27
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 267891.45 98100.00 300000.00
Shadow Orb 1.37 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 20.0%
shadowfiend-Mana Cap 20.0%
lightwell-Mana Cap 20.0%

Procs

Count Interval
Shadowy Recall Extra Tick 333.3 1.3sec
Shadowy Apparition Procced 118.0 3.8sec
FDCL Mind Spike proc 70.9 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 116208.38
Minimum 107861.37
Maximum 124447.25
Spread ( max - min ) 16585.88
Range [ ( max - min ) / 2 * 100% ] 7.14%
Standard Deviation 2324.2616
5th Percentile 112478.78
95th Percentile 120155.53
( 95th Percentile - 5th Percentile ) 7676.75
Mean Distribution
Standard Deviation 10.3952
95.00% Confidence Intervall ( 116188.00 - 116228.75 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1536
0.1 Scale Factor Error with Delta=300 46116
0.05 Scale Factor Error with Delta=300 184464
0.01 Scale Factor Error with Delta=300 4611621
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 116208.38
Distribution Chart

Damage

Sample Data
Count 49992
Mean 50732286.12
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 333.46
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.67 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.59 shadow_word_death,if=active_enemies<=5
F 47.76 mind_blast,if=active_enemies<=6&cooldown_react
G 44.66 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.74 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 16.99 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.85 halo,if=talent.halo.enabled
M 13.47 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.65 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.48 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 46.16 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 43.64 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.79 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTRTFTGGHHQFJMRTRWJRFJHHJGRTFRTLTGHFHMRTGRFWWWHHFTRTGQFHHJGMRLFTWWWGHFHTRRTRFHMHGRGQFRTGRFHHLTGFMTHGHTFTWGRWFHHTFTHGHGFLMJRBWFHHTGTFRTRHHGQFMRTGTRFWWHHLTFRTTGHHFGMRTGWJFGHHRTFRTLHGHFGMTWWWWFHHTGQFTRTHGHFMJRLGFHHJRTGFRTHHFGMTGWWWWFHHTGLTFTRHHTGFJMRGBFGHHTFTTREDEFGGHHLEEWWRFMHEEGHJFJREDEGHFHTPEE9GWFHMHEELRFRTREDEGFGHHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no2PT14 : 110082 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
110082.3 110082.3 17.33 / 0.02% 3256 / 3.0% 16.2 6180.4 6102.3 Mana 0.28% 39.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:315111|242157|133318|115475|105453|88431|46751&chds=0,630223&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++315111++devouring_plague,9482C9,0,0,15|t++242157++halo,9482C9,1,0,15|t++133318++vampiric_touch,9482C9,2,0,15|t++115475++shadow_word_pain,9482C9,3,0,15|t++105453++shadow_word_death,9482C9,4,0,15|t++88431++mind_blast,9482C9,5,0,15|t++46751++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,16,12,10,10,7,6,6,5,5,5,4,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|mindbender: melee|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no2PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:xz134322221z012z00121ywurqqponmooprstsrqonnnmnommnmlkjjigffggijlmnnooooooponqsqrponljihgffffghhhigeeedddefghhihgfeedfeijklnoqqrrrqppqrsrsrrnmkkihffdcccdefffgffgffeefikjjkjjihggghhgghijkkkkllllmmlmnnmmmmmlkjkhgihhiiiikiiiijiiijkjkkhhffedeeeddefgiikklnnopppqssrrsrqpommjiheeeeeeeddcccbbbdeeffffggggggiijklnoopqqrrrsqppqrrqpoonlkljjiihikllnnnooppppqssssrqpomlljjjjjjkkllmmnnoqqqrtuuuvuuutssrqppoopppqqpqppppppqqqqpoooononnmopprstvwxyz13333557876665343200yyxxxyxxxxxxxwwwwvwussssrsqpppqqrssuvwxx023334456654432310zyyxxxwxxyyyyyyxxyxxxwvvvuttsrprqqpppppopo&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6537,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=110082|max=168398&chxp=1,1,65,100&chtt=priest_90_tof_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,32,48,72,32,168,224,216,288,448,664,688,928,1032,1344,1648,2096,2072,2416,2488,2592,2776,2680,2816,2520,2920,2320,2184,1928,1824,1504,1448,1240,912,776,616,488,440,304,208,144,168,64,64,16,56,16,16,0,32&chds=0,2920&chbh=5&chxt=x&chxl=0:|min=103731|avg=110082|max=117457&chxp=0,1,46,100&chtt=priest_90_tof_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:34.3,20.9,15.5,11.4,4.4,3.9,2.9,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 154.6s|shadow_word_pain 94.3s|vampiric_touch 70.0s|mind_blast 51.5s|devouring_plague 19.7s|shadow_word_death 17.4s|halo 12.9s|mindbender 8.3s|waiting 1.3s&chtt=priest_90_tof_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no2PT14 110082
devouring_plague 5270 (13744) 4.8% (12.5%) 16.5 28.11sec 374905 315111 118058 244754 143668 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.54 0.00 0.00 1.1898 0.0000 2375827.86 2375827.86 0.00 315111.39 315111.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.19 79.79% 118057.92 102399 157653 118081.66 108504 129552 1557705 1557705 0.00
crit 3.34 20.21% 244753.98 210941 324765 237916.11 0 324765 818123 818123 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2018 1.8% 38.5 10.86sec 23661 0 19535 40515 23696 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.50 38.44 0.00 0.00 0.0000 0.0000 910880.55 910880.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.82 80.16% 19534.90 17006 26181 19535.29 18024 21724 601971 601971 0.00
crit 7.62 19.84% 40514.77 35032 53932 40502.37 0 51512 308909 308909 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6456 5.9% 16.5 28.11sec 176157 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.3 19486 40372 23623 19.8% 0.0% 20.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.54 123.32 123.32 0.0000 0.7546 2913108.27 2913108.27 0.00 31306.24 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.9 80.19% 19486.32 17006 26181 19487.04 18359 20553 1927075 1927075 0.00
crit 24.4 19.81% 40371.98 35032 53932 40371.54 36215 46158 986033 986033 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6921) 0.0% (6.3%) 10.9 43.01sec 286968 242157 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00 242157.02 242157.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.69 79.99% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.17 20.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6921 6.3% 10.9 43.01sec 286968 0 118338 244465 143487 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 21.73 0.00 0.00 0.0000 0.0000 3118255.99 3118255.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 80.06% 118338.36 104363 160794 118336.92 109008 129084 2059049 2059049 0.00
crit 4.33 19.94% 244464.85 214987 331235 242294.73 0 318528 1059207 1059207 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 43.01sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 227.19 0.00 0.00 0.0000 0.0000 0.00 45607567.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.10 77.07% 0.00 0 0 0.00 0 0 0 28228895 100.00
crit 52.10 22.93% 0.00 0 0 0.00 0 0 0 17378673 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10093 9.2% 40.5 11.10sec 112384 88431 92725 192022 112385 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.52 40.52 0.00 0.00 1.2709 0.0000 4553477.48 4553477.48 0.00 88430.78 88430.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.50 80.20% 92725.06 82079 126948 92738.66 88879 97654 3013148 3013148 0.00
crit 8.02 19.80% 192021.53 169082 261513 192068.59 169082 241145 1540329 1540329 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 12243 (16070) 11.1% (14.6%) 94.6 4.64sec 76387 46751 0 0 0 0.0% 0.0% 0.0% 0.0% 185.8 24395 50591 29640 20.0% 0.0% 30.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.65 94.65 185.84 185.84 1.6339 0.7354 5508140.32 5508140.32 0.00 46750.70 46750.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.6 79.98% 24395.22 21797 33558 24398.39 23751 25218 3625914 3625914 0.00
crit 37.2 20.02% 50590.99 44901 69130 50597.41 47203 54280 1882227 1882227 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3827 3.5% 58.1 7.39sec 29621 0 24409 50601 29631 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.12 58.10 0.00 0.00 0.0000 0.0000 1721528.76 1721528.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.51 80.06% 24408.73 21797 33558 24412.47 22963 26140 1135357 1135357 0.00
crit 11.58 19.94% 50601.18 44901 69130 50595.68 44901 57380 586172 586172 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 1.1983 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4063 3.7% 14.5 4.97sec 126006 105453 103539 214718 126007 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.53 14.53 0.00 0.00 1.1950 0.0000 1831289.08 1831289.08 0.00 105452.56 105452.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.60 79.79% 103538.62 79678 123491 103629.56 93912 111876 1200678 1200678 0.00
crit 2.94 20.21% 214717.84 164137 254391 206178.66 0 254391 630612 630612 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18500 (24162) 16.8% (22.0%) 79.9 5.62sec 136411 115475 0 0 0 0.0% 0.0% 0.0% 0.0% 468.3 14686 30411 17812 19.9% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.86 79.86 468.27 468.27 1.1813 1.8739 8340905.87 8340905.87 0.00 11209.69 115475.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 375.2 80.12% 14685.92 12783 20660 14686.54 14298 15080 5509787 5509787 0.00
crit 93.1 19.88% 30411.04 26333 42560 30411.21 29123 31708 2831119 2831119 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5662 5.1% 146.4 3.05sec 17434 0 14380 29791 17450 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.42 146.29 0.00 0.00 0.0000 0.0000 2552780.73 2552780.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.15 80.08% 14379.55 12783 19677 14381.04 13924 15053 1684510 1684510 0.00
crit 29.14 19.92% 29791.37 26333 40534 29794.99 27919 33149 868270 868270 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4604 4.2% 96.4 4.63sec 21536 0 18246 36698 21908 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.40 94.76 0.00 0.00 0.0000 0.0000 2075924.39 2075924.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.95 80.16% 18246.14 15875 25856 18248.12 17239 19053 1385853 1385853 0.00
crit 18.80 19.84% 36697.76 31750 51713 36707.87 33451 41514 690071 690071 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15844 (20700) 14.4% (18.8%) 59.0 7.54sec 158266 133318 0 0 0 0.0% 0.0% 0.0% 0.0% 357.1 16490 34171 20000 19.8% 0.0% 177.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.96 58.96 357.11 357.11 1.1871 2.2357 7142194.10 7142194.10 0.00 10745.22 133317.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.2 80.15% 16490.47 14287 23421 16490.74 15932 17077 4720050 4720050 0.00
crit 70.9 19.85% 34171.36 29431 48248 34170.33 32468 36609 2422144 2422144 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4856 4.4% 111.9 3.93sec 19568 0 16146 33461 19583 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.86 111.77 0.00 0.00 0.0000 0.0000 2188843.33 2188843.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.59 80.15% 16146.39 14287 22306 16148.23 15493 16871 1446562 1446562 0.00
crit 22.18 19.85% 33461.25 29431 45950 33465.01 30364 36977 742281 742281 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37592 / 9727
melee 37592 8.8% 105.1 4.17sec 41655 39086 36424 73383 41654 20.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.14 105.14 0.00 0.00 1.0657 0.0000 4379692.95 4379692.95 0.00 39085.91 39085.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.83 55.95% 36424.41 29063 44745 36434.42 34840 38496 2142706 2142706 0.00
crit 21.07 20.04% 73382.91 58126 89490 73401.19 66235 80652 1546413 1546413 0.00
glance 25.24 24.01% 27356.24 21797 33559 27364.09 25009 30134 690574 690574 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.1914 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.37%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.71%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.52% 43.82%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.52%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.31% 42.31%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.31%

    Trigger Attempt Success

    • trigger_pct:14.36%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.41% 49.53%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.41%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.2 134.6 15.7sec 0.7sec 19.81% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:19.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no2PT14
devouring_plague Shadow Orb 16.5 49.6 3.0 3.0 124968.9
halo Mana 10.9 440082.7 40500.0 40500.1 7.1
mind_blast Mana 40.5 364652.6 9000.0 8999.9 12.5
mind_flay Mana 94.6 283935.4 3000.0 3000.0 25.5
shadow_word_death Mana 14.5 113364.6 7800.0 7800.3 16.2
shadow_word_pain Mana 79.9 1054128.8 13200.0 13199.8 10.3
vampiric_touch Mana 59.0 530619.8 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.14 320402.90 (11.64%) 3047.29 140225.85 30.44%
Shadow Orbs from Mind Blast Shadow Orb 40.52 40.52 (84.67%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.33%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.76 0.00 (-nan%) 0.00 2246255.82 100.00%
Vampiric Touch Mana Mana 468.88 1986186.23 (72.18%) 4235.99 491794.09 19.85%
mp5_regen Mana 1803.14 444999.55 (16.17%) 246.79 95943.50 17.74%
Resource RPS-Gain RPS-Loss
Mana 6102.31 6180.36
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 264804.92 122352.38 300000.00
Shadow Orb 1.24 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 17.9%
shadowfiend-Mana Cap 17.9%
lightwell-Mana Cap 17.9%

Procs

Count Interval
Shadowy Recall Extra Tick 354.6 1.3sec
Shadowy Apparition Procced 96.4 4.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no2PT14 Damage Per Second
Count 49992
Mean 110082.34
Minimum 103730.85
Maximum 117457.04
Spread ( max - min ) 13726.19
Range [ ( max - min ) / 2 * 100% ] 6.23%
Standard Deviation 1976.6886
5th Percentile 106900.04
95th Percentile 113412.54
( 95th Percentile - 5th Percentile ) 6512.50
Mean Distribution
Standard Deviation 8.8407
95.00% Confidence Intervall ( 110065.02 - 110099.67 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1238
0.1 Scale Factor Error with Delta=300 33354
0.05 Scale Factor Error with Delta=300 133419
0.01 Scale Factor Error with Delta=300 3335494
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 110082.34
Distribution Chart

Damage

Sample Data
Count 49992
Mean 45233156.75
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 294.28
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.90 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.53 shadow_word_death,if=active_enemies<=5
F 44.80 mind_blast,if=active_enemies<=6&cooldown_react
G 43.29 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.57 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 12.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.85 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.62 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.74 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.56 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTGGHFHTWWWWFHGHMTFLTHTHFGGTAWWFHHTFGMTHHGQFTLTWWWGFHHTFTHHGFGMTAGWFHHLTGTFTHHTGFMTGWWWFHHTQFTGHHFGLTWAWFHGHMTQFTHTHGFTGTWWWWFHHLMTFGTHHGQFTGWAFGHHMTFTHGHGFLTWWWWFHHMTGFTHGHQFTGWAFHHLMTQFTHGHGFTWWWWWFHHMGTQQFTHHLGQFTGGWWAFHHMTTFEEGHHGTFDEELWTHFGEDEHHTFHPEEGTFDE9EGHAFHTEDEGLFHTGEEHTFM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no4PT14 : 113300 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113299.7 113299.7 17.42 / 0.02% 3258 / 2.9% 16.8 6179.0 6100.6 Mana 0.28% 39.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:314671|242267|133315|125607|105608|88462|46742&chds=0,629343&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++314671++devouring_plague,9482C9,0,0,15|t++242267++halo,9482C9,1,0,15|t++133315++vampiric_touch,9482C9,2,0,15|t++125607++shadow_word_pain,9482C9,3,0,15|t++105608++shadow_word_death,9482C9,4,0,15|t++88462++mind_blast,9482C9,5,0,15|t++46742++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,15,12,10,9,7,6,6,6,5,5,4,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|mindbender: melee|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no4PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:xz134322221z112z00121zxvsrrqponopqrttsrqpoonnoonnonmkkjjhgfghiklnoooppppppooqsqrqpnmkihgffffghiijgefeeeeefhiijhhgeeegfjklmnpqqrrrrqqqrsssrrnmlkihfgedcdefggfggggfffffjkkkkkjiihhhhhghhikklkkllllmmmmnommnmmlljkihihiiijjkjjjjjjjjjkkklihgfeeeeeeeefhiiklloooppqqssrsssrqomnkjheeeffffedddccccdeefgggghggghijklmnpppqqrrssrqqqsrrqponmlmkkjiijklmnooopppqqrssttsqqonllkkjjjklllmmnnnpqrrrtuvvvvvutstsrqppppqpqqqqqpppppqqqqpopppoponnopqrtuvwxyz13333557776665343210zyyyyyyyyyyyxxxxwwwuttttssqppqqqrssuvwxx033334466665543321zzzxxxxyyyyyxyxxxxxxxwvvvvtuusrqqqpppoooon&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6617,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113300|max=171235&chxp=1,1,66,100&chtt=priest_90_tof_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,24,32,56,80,152,136,272,416,472,624,800,1144,1448,1552,1984,2056,2672,2824,2824,3152,2768,3000,2768,2608,2824,2216,2184,1704,1536,1336,928,792,656,544,336,264,216,168,96,128,72,32,16,40,8,0,0,8,8&chds=0,3152&chbh=5&chxt=x&chxl=0:|min=106744|avg=113300|max=121672&chxp=0,1,44,100&chtt=priest_90_tof_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:34.3,20.9,15.5,11.4,4.4,3.8,2.9,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 154.8s|shadow_word_pain 94.3s|vampiric_touch 70.0s|mind_blast 51.5s|devouring_plague 19.7s|shadow_word_death 17.3s|halo 12.9s|mindbender 8.3s|waiting 1.3s&chtt=priest_90_tof_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no4PT14 113300
devouring_plague 5256 (13722) 4.6% (12.1%) 16.5 28.12sec 374379 314671 118044 244447 143308 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.53 16.53 0.00 0.00 1.1898 0.0000 2369575.66 2369575.66 0.00 314671.42 314671.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.23 80.01% 118043.86 102399 157653 118073.48 109388 128326 1561679 1561679 0.00
crit 3.31 19.99% 244446.77 210941 324765 237699.56 0 324765 807896 807896 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2018 1.8% 38.5 10.85sec 23653 0 19526 40551 23694 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.51 38.44 0.00 0.00 0.0000 0.0000 910793.97 910793.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.82 80.17% 19525.95 17006 26181 19526.20 17940 21687 601761 601761 0.00
crit 7.62 19.83% 40551.34 35032 53932 40520.05 0 49426 309033 309033 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6448 5.7% 16.5 28.12sec 175985 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.2 19476 40368 23619 19.8% 0.0% 20.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.53 16.53 123.20 123.20 0.0000 0.7546 2909846.47 2909846.47 0.00 31299.78 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.8 80.17% 19475.90 17006 26181 19476.93 18441 20489 1923574 1923574 0.00
crit 24.4 19.83% 40367.89 35032 53932 40373.16 36043 45110 986273 986273 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6923) 0.0% (6.1%) 10.9 43.01sec 287057 242267 0 0 0 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1849 0.0000 0.00 0.00 0.00 242267.20 242267.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.68 79.90% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.18 20.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6923 6.1% 10.9 43.01sec 287057 0 118267 244884 143528 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 21.73 0.00 0.00 0.0000 0.0000 3118947.91 3118947.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 80.05% 118266.94 104363 160794 118273.23 110232 130802 2057262 2057262 0.00
crit 4.34 19.95% 244883.55 214987 331235 242678.49 0 315462 1061686 1061686 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 43.01sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 227.20 0.00 0.00 0.0000 0.0000 0.00 45618439.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.96 77.01% 0.00 0 0 0.00 0 0 0 28198600 100.00
crit 52.24 22.99% 0.00 0 0 0.00 0 0 0 17419840 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10093 8.9% 40.5 11.11sec 112451 88462 92721 192003 112452 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.50 40.50 0.00 0.00 1.2712 0.0000 4553831.37 4553831.37 0.00 88461.70 88461.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.45 80.13% 92721.14 82079 126948 92737.62 88791 97186 3008687 3008687 0.00
crit 8.05 19.87% 192003.44 169082 261513 192046.06 0 235175 1545144 1545144 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 12246 (16079) 10.8% (14.2%) 94.7 4.64sec 76418 46742 0 0 0 0.0% 0.0% 0.0% 0.0% 186.0 24395 50591 29625 20.0% 0.0% 30.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.66 94.66 185.96 185.96 1.6349 0.7354 5509046.10 5509046.10 0.00 46741.77 46741.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.8 80.03% 24394.53 21797 33558 24397.83 23786 25316 3630558 3630558 0.00
crit 37.1 19.97% 50590.86 44901 69130 50596.64 47245 55784 1878489 1878489 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3833 3.4% 58.2 7.38sec 29638 0 24411 50629 29649 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.18 58.16 0.00 0.00 0.0000 0.0000 1724476.86 1724476.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.54 80.02% 24410.69 21797 33558 24412.85 22870 26115 1136102 1136102 0.00
crit 11.62 19.98% 50629.15 44901 69130 50631.70 44901 60113 588375 588375 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 1.1984 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4064 3.6% 14.5 4.98sec 126209 105608 103531 214774 126206 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.51 14.51 0.00 0.00 1.1951 0.0000 1831673.32 1831673.32 0.00 105608.47 105608.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.55 79.61% 103530.80 79678 123491 103626.71 96196 117598 1196254 1196254 0.00
crit 2.96 20.39% 214774.35 164137 254391 207034.25 0 254391 635419 635419 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 20117 (26274) 17.8% (23.2%) 79.8 5.63sec 148381 125607 0 0 0 0.0% 0.0% 0.0% 0.0% 468.3 14688 30374 19370 29.8% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.83 79.83 468.27 468.27 1.1813 1.8739 9070329.37 9070329.37 0.00 12189.28 125606.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 328.5 70.15% 14687.96 12783 20660 14688.65 14235 15165 4825110 4825110 0.00
crit 139.8 29.85% 30373.81 26333 42560 30375.06 29312 31541 4245219 4245219 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6156 5.4% 146.5 3.05sec 18943 0 14375 29748 18960 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.52 146.39 0.00 0.00 0.0000 0.0000 2775519.48 2775519.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.73 70.17% 14374.91 12783 19677 14376.73 13805 14921 1476673 1476673 0.00
crit 43.66 29.83% 29747.83 26333 40534 29753.63 28061 32074 1298847 1298847 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5713 5.0% 119.6 3.74sec 21549 0 18247 36705 21919 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.56 117.54 0.00 0.00 0.0000 0.0000 2576298.88 2576298.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.15 80.10% 18246.64 15875 25856 18248.52 17668 18847 1717969 1717969 0.00
crit 23.38 19.90% 36705.24 31750 51713 36713.70 33140 40620 858330 858330 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15842 (20701) 14.0% (18.3%) 59.0 7.54sec 158258 133315 0 0 0 0.0% 0.0% 0.0% 0.0% 357.2 16494 34173 19994 19.8% 0.0% 177.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.97 58.97 357.17 357.17 1.1871 2.2354 7141463.82 7141463.82 0.00 10746.04 133315.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.4 80.20% 16493.78 14287 23421 16494.49 15946 17065 4724618 4724618 0.00
crit 70.7 19.80% 34172.52 29431 48248 34172.44 32401 36057 2416846 2416846 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4859 4.3% 111.9 3.93sec 19577 0 16150 33491 19593 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.90 111.81 0.00 0.00 0.0000 0.0000 2190609.06 2190609.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.61 80.15% 16150.11 14287 22306 16152.83 15497 17087 1447233 1447233 0.00
crit 22.20 19.85% 33491.46 29431 45950 33502.22 30897 37398 743376 743376 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37612 / 9731
melee 37612 8.6% 105.1 4.17sec 41675 39108 36421 73354 41675 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.14 105.14 0.00 0.00 1.0657 0.0000 4381714.86 4381714.86 0.00 39107.79 39107.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.77 55.90% 36421.40 29063 44745 36430.83 34609 38147 2140631 2140631 0.00
crit 21.13 20.10% 73353.54 58126 89490 73365.11 67588 80605 1550286 1550286 0.00
glance 25.23 24.00% 27379.18 21797 33559 27387.83 25278 29713 690798 690798 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.1916 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.37%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.64%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.7sec 20.8sec 43.43% 43.69%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.43%

    Trigger Attempt Success

    • trigger_pct:1.74%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.27% 42.27%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.27%

    Trigger Attempt Success

    • trigger_pct:14.30%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.40% 49.49%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.2 138.7 15.7sec 0.6sec 19.91% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:19.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.94%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no4PT14
devouring_plague Shadow Orb 16.5 49.6 3.0 3.0 124791.1
halo Mana 10.9 440043.8 40500.0 40500.1 7.1
mind_blast Mana 40.5 364468.3 9000.0 9000.1 12.5
mind_flay Mana 94.7 283969.4 3000.0 3000.0 25.5
shadow_word_death Mana 14.5 113206.1 7800.0 7800.3 16.2
shadow_word_pain Mana 79.8 1053797.2 13200.0 13199.9 11.2
vampiric_touch Mana 59.0 530706.2 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.14 320229.47 (11.64%) 3045.74 140383.86 30.48%
Shadow Orbs from Mind Blast Shadow Orb 40.50 40.50 (84.67%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.33%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.64 0.00 (-nan%) 0.00 2244633.86 100.00%
Vampiric Touch Mana Mana 468.98 1985763.52 (72.19%) 4234.23 492693.44 19.88%
mp5_regen Mana 1803.14 444814.30 (16.17%) 246.69 96128.76 17.77%
Resource RPS-Gain RPS-Loss
Mana 6100.57 6179.04
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 264614.88 113052.38 300000.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 17.9%
shadowfiend-Mana Cap 17.9%
lightwell-Mana Cap 17.9%

Procs

Count Interval
Shadowy Recall Extra Tick 354.8 1.3sec
Shadowy Apparition Procced 119.6 3.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no4PT14 Damage Per Second
Count 49992
Mean 113299.67
Minimum 106743.92
Maximum 121672.34
Spread ( max - min ) 14928.43
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 1987.2900
5th Percentile 110114.28
95th Percentile 116630.32
( 95th Percentile - 5th Percentile ) 6516.04
Mean Distribution
Standard Deviation 8.8881
95.00% Confidence Intervall ( 113282.25 - 113317.09 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1181
0.1 Scale Factor Error with Delta=300 33713
0.05 Scale Factor Error with Delta=300 134854
0.01 Scale Factor Error with Delta=300 3371368
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113299.67
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46682412.24
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 294.27
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.90 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.23 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.51 shadow_word_death,if=active_enemies<=5
F 44.79 mind_blast,if=active_enemies<=6&cooldown_react
G 43.29 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.58 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 12.31 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.83 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.65 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.75 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.54 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTGGHFHTWWWWWFHHGMTFLTHTHGFTGTAWWFHHMTGFTHHGTFLTWWWWGFHHMTQFTHHGGQFTGAWFHHLMTGTFTHHTGFTWGWWFHHMTQFTHGGHFLTWAWFHHGTQFMTHHTGFTGTWWWWFHHLTFMGTHHTGFTGWAFGHHTQFMTHGHFGLTWWWWFHHTFGTHHGFMTWGWAFHHLTTFTGHGHFMTWWWWWQFHTHTGTFTHLGHFMTGGWWFAHHTQQFTEDEGHGFHTEELWWFHDEEGHTFTEDEGHHFTGE9EWFHAMHEELFTGTEDEFGHHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no2PT14 : 109535 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
109535.0 109535.0 18.90 / 0.02% 3521 / 3.2% 16.2 6539.2 6401.6 Mana 0.22% 41.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311643|242093|147999|133745|106723|105645|87033|47113&chds=0,623287&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++311643++devouring_plague,9482C9,0,0,15|t++242093++halo,9482C9,1,0,15|t++147999++shadow_word_insanity,9482C9,2,0,15|t++133745++vampiric_touch,9482C9,3,0,15|t++106723++shadow_word_pain,9482C9,4,0,15|t++105645++shadow_word_death,9482C9,5,0,15|t++87033++mind_blast,9482C9,6,0,15|t++47113++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,10,9,9,7,6,5,5,5,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no2PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:45565457676355835346410zyxywtsrstuvwxvvusrqpoppooonmlkihddccddefggiiijijkjjknooqponmmkliiihijllmmjjihhhhijllmnmlkigfgffgiijkkkkkjihijjjlmlmmljjihghggfffgghggggggfggikllmlllklllmnmmnprrsqppooooppnnppoqponlmlmklmmnoopqrpponnnmmmnnoomljjighfeeeefghhjjjihijkkkooopppoonlljiihiijiiiggffffffhijjjjjjjjjjjijklmmnmmmmmlmnmmmoppqpponnmolmmmnoopqrqqqqqqqrtuuvwussqqqqqpppqrstssstsrstuvuvvvwvvutsrsqrqrrsstttstttttttuvvvvtttttstsrrrrssuuvvvvwxyyyy01244455445443333333433221100z0zz0ywwwwvvtsrrrqrsstuuuuwyyyyz011112211100zzzz000111111111011120zzzyxzyxwwwwxxxxxwvu&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6813,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=109535|max=160766&chxp=1,1,68,100&chtt=priest_90_tof_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,24,32,64,56,192,200,408,560,864,1032,1528,1648,2032,2320,2672,3200,2992,3088,3184,2976,3216,2912,2688,2432,2104,1512,1328,1168,920,704,464,424,344,216,152,80,72,56,24,40,16,0,8,0,8,0,0,8&chds=0,3216&chbh=5&chxt=x&chxl=0:|min=102212|avg=109535|max=119807&chxp=0,1,42,100&chtt=priest_90_tof_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.9,21.4,15.6,11.4,6.6,4.3,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 130.1s|shadow_word_pain 96.6s|vampiric_touch 70.4s|mind_blast 51.2s|shadow_word_insanity 29.9s|devouring_plague 19.4s|shadow_word_death 17.3s|halo 12.8s|shadowfiend 2.4s|waiting 1.0s&chtt=priest_90_tof_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no2PT14 109535
devouring_plague 5153 (13404) 4.7% (12.3%) 16.2 28.75sec 372564 311643 117913 244386 143141 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.23 16.23 0.00 0.00 1.1955 0.0000 2323176.11 2323176.11 0.00 311643.27 311643.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.99 80.05% 117913.42 102399 157653 117929.69 107417 129627 1532070 1532070 0.00
crit 3.24 19.95% 244386.39 210941 324765 237383.06 0 324765 791106 791106 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1969 1.8% 37.7 11.10sec 23586 0 19500 40419 23626 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.69 37.62 0.00 0.00 0.0000 0.0000 888879.75 888879.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.20 80.28% 19499.78 17006 26181 19501.28 18020 21658 588931 588931 0.00
crit 7.42 19.72% 40419.38 35032 53932 40372.85 0 50998 299949 299949 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6282 5.7% 16.2 28.75sec 174659 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.3 19449 40315 23571 19.8% 0.0% 20.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.23 16.23 120.27 120.27 0.0000 0.7581 2834758.51 2834758.51 0.00 31091.40 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.5 80.25% 19448.89 17006 26181 19447.50 18371 20635 1877011 1877011 0.00
crit 23.8 19.75% 40315.34 35032 53932 40313.75 36797 45649 957747 957747 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6890) 0.0% (6.3%) 10.8 43.20sec 286864 242093 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.82 10.82 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00 242092.97 242092.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.66 80.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.16 19.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6890 6.3% 10.8 43.20sec 286864 0 118371 244827 143434 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.82 21.64 0.00 0.00 0.0000 0.0000 3103631.92 3103631.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.35 80.18% 118371.50 104363 160794 118390.92 109600 128864 2053772 2053772 0.00
crit 4.29 19.82% 244827.25 214987 331235 242486.17 0 331235 1049860 1049860 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.20sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.82 227.15 0.00 0.00 0.0000 0.0000 0.00 45657028.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.85 76.98% 0.00 0 0 0.00 0 0 0 28197955 100.00
crit 52.30 23.02% 0.00 0 0 0.00 0 0 0 17459073 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9888 9.0% 39.6 11.36sec 112534 87033 92808 192130 112534 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.63 39.63 0.00 0.00 1.2930 0.0000 4460192.26 4460192.26 0.00 87033.24 87033.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.76 80.14% 92808.05 82079 126948 92820.92 88752 97024 2947866 2947866 0.00
crit 7.87 19.86% 192130.09 169082 261513 192107.98 0 247093 1512326 1512326 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10371 (13623) 9.5% (12.4%) 79.9 5.48sec 76737 47113 0 0 0 0.0% 0.0% 0.0% 0.0% 158.1 24321 50401 29517 19.9% 0.0% 25.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.89 79.89 158.10 158.10 1.6288 0.7319 4666721.92 4666721.92 0.00 47113.30 47113.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.6 80.08% 24320.60 21797 33558 24323.27 23511 25171 3079059 3079059 0.00
crit 31.5 19.92% 50400.89 44901 69130 50410.41 47291 54515 1587663 1587663 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3252 3.0% 49.6 8.59sec 29528 0 24341 50450 29540 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.56 49.54 0.00 0.00 0.0000 0.0000 1463518.73 1463518.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.68 80.09% 24340.80 21797 33558 24344.34 23045 26013 965807 965807 0.00
crit 9.87 19.91% 50449.55 44901 69130 50446.64 0 58708 497712 497712 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4061 3.7% 14.5 4.98sec 126235 105645 103551 214602 126234 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.51 14.51 0.00 0.00 1.1949 0.0000 1831046.49 1831046.49 0.00 105645.42 105645.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.54 79.57% 103550.78 79678 123491 103654.47 95837 114378 1195196 1195196 0.00
crit 2.96 20.43% 214602.41 164137 254391 205877.77 0 254391 635850 635850 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9805 9.0% 25.3 17.08sec 174724 147999 143586 297806 174727 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.33 25.33 0.00 0.00 1.1806 0.0000 4425905.22 4425905.22 0.00 147998.84 147998.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.22 79.81% 143585.56 122772 199962 143600.66 133536 158264 2902742 2902742 0.00
crit 5.11 20.19% 297806.33 252910 411923 296406.37 0 393026 1523163 1523163 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 17516 (22877) 16.0% (20.9%) 81.5 5.51sec 126481 106723 0 0 0 0.0% 0.0% 0.0% 0.0% 443.1 14688 30427 17817 19.9% 0.0% 180.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.53 81.53 443.15 443.15 1.1851 1.8391 7895615.02 7895615.02 0.00 11312.29 106722.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 355.1 80.12% 14688.46 12783 20660 14689.75 14280 15093 5215185 5215185 0.00
crit 88.1 19.88% 30427.16 26333 42560 30429.96 29056 32003 2680430 2680430 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5361 4.9% 138.7 3.22sec 17424 0 14379 29778 17440 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.70 138.57 0.00 0.00 0.0000 0.0000 2416697.99 2416697.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.03 80.13% 14379.46 12783 19677 14381.25 13747 15052 1596580 1596580 0.00
crit 27.54 19.87% 29778.45 26333 40534 29784.43 27677 32184 820118 820118 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2240 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4444 4.1% 93.0 4.79sec 21533 0 18239 36687 21906 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.04 91.46 0.00 0.00 0.0000 0.0000 2003540.28 2003540.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.28 80.12% 18239.05 15875 25856 18241.06 17421 19040 1336623 1336623 0.00
crit 18.18 19.88% 36687.39 31750 51713 36691.36 33516 41437 666917 666917 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15987 (20884) 14.6% (19.1%) 59.4 7.49sec 158462 133745 0 0 0 0.0% 0.0% 0.0% 0.0% 359.8 16514 34206 20031 19.9% 0.0% 178.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.41 59.41 359.79 359.79 1.1848 2.2345 7206672.53 7206672.53 0.00 10767.35 133745.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.3 80.12% 16513.91 14287 23421 16514.19 15958 17122 4760493 4760493 0.00
crit 71.5 19.88% 34206.15 29431 48248 34205.93 32147 36737 2446180 2446180 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4896 4.5% 112.7 3.90sec 19584 0 16161 33477 19599 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.72 112.63 0.00 0.00 0.0000 0.0000 2207385.71 2207385.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.26 80.14% 16160.78 14287 22306 16162.73 15436 16991 1458695 1458695 0.00
crit 22.36 19.86% 33476.50 29431 45950 33481.94 30323 37450 748691 748691 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46220 / 3660
melee 46220 3.3% 31.2 12.61sec 52322 51518 45646 92146 52322 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.17 31.17 0.00 0.00 1.0156 0.0000 1631052.92 1631052.92 0.00 51517.78 51517.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 55.82% 45645.97 36329 55931 45668.74 41100 51796 794333 794333 0.00
crit 6.30 20.20% 92145.95 72658 111863 92154.46 0 111863 580389 580389 0.00
glance 7.47 23.97% 34301.12 27247 41949 34301.09 28883 41949 256331 256331 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1996 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.45%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.56%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.7sec 20.7sec 43.50% 43.72%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.50%

    Trigger Attempt Success

    • trigger_pct:1.79%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.23% 42.23%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.23%

    Trigger Attempt Success

    • trigger_pct:14.52%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.40% 49.55%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.2 134.2 15.4sec 0.7sec 19.94% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:19.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no2PT14
devouring_plague Shadow Orb 16.2 48.7 3.0 3.0 124187.0
halo Mana 10.8 438177.6 40500.0 40500.1 7.1
mind_blast Mana 39.6 356709.6 9000.0 9000.0 12.5
mind_flay Mana 79.9 239656.8 3000.0 3000.0 25.6
shadow_word_death Mana 14.5 113143.7 7800.0 7800.3 16.2
shadow_word_insanity Mana 25.3 189980.4 7500.0 7500.0 23.3
shadow_word_pain Mana 81.5 1076226.6 13200.0 13200.0 9.6
vampiric_touch Mana 59.4 534679.2 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.17 184615.20 (6.40%) 5922.13 95948.64 34.20%
Shadow Orbs from Mind Blast Shadow Orb 39.63 39.63 (84.41%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.32 7.32 (15.59%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.89 0.00 (-nan%) 0.00 2192580.18 100.00%
Vampiric Touch Mana Mana 472.41 2214733.78 (76.73%) 4688.15 281854.70 11.29%
mp5_regen Mana 1803.14 487174.85 (16.88%) 270.18 53768.21 9.94%
Resource RPS-Gain RPS-Loss
Mana 6401.56 6539.17
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 237946.42 45000.00 300000.00
Shadow Orb 1.26 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.1%
shadowfiend-Mana Cap 10.1%
lightwell-Mana Cap 10.1%

Procs

Count Interval
Shadowy Recall Extra Tick 338.4 1.3sec
Shadowy Apparition Procced 93.0 4.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no2PT14 Damage Per Second
Count 49992
Mean 109534.99
Minimum 102212.38
Maximum 119806.88
Spread ( max - min ) 17594.50
Range [ ( max - min ) / 2 * 100% ] 8.03%
Standard Deviation 2156.4486
5th Percentile 106115.11
95th Percentile 113157.39
( 95th Percentile - 5th Percentile ) 7042.28
Mean Distribution
Standard Deviation 9.6447
95.00% Confidence Intervall ( 109516.09 - 109553.89 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1488
0.1 Scale Factor Error with Delta=300 39697
0.05 Scale Factor Error with Delta=300 158789
0.01 Scale Factor Error with Delta=300 3969738
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 109534.99
Distribution Chart

Damage

Sample Data
Count 49992
Mean 47727742.46
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 309.03
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.38 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.51 shadow_word_death,if=active_enemies<=5
F 44.88 mind_blast,if=active_enemies<=6&cooldown_react
G 45.45 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.75 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.33 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.82 halo,if=talent.halo.enabled
M 11.85 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.40 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 45.05 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.08 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTIGIGHHFTWWWWIFGHHMTFLTIGHGHFTWWWFHHIGMTQQFTIGHHFIGLTWWWWFHHMTIGQFTIGHHQFTIGGWWFHHMLTIFGTHHIGQFTIGWFHHMTQFTIGHHGFLTBIGFHHIGTQFMTHHGTFIGTWWWWFHHIGLTFTIGHHFIGMTGWWFHHTIGTFTHHIGFLIGMWWWWFHHTIGFTHHGTFMTGWWFHHLTQFTHGHGQFMTWWWWWFHHIGTFTHHIGFIGLMGBWFHHTIGFTEDEHHGFTIEEGWWFHDEEHLTFIGEDEGHFHT9EEIFGMHHGEEQQFTEDEFGHHI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no4PT14 : 112643 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
112642.8 112642.8 19.27 / 0.02% 3632 / 3.2% 16.7 6537.7 6400.0 Mana 0.23% 41.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311814|241719|147817|133725|116114|105642|87055|47099&chds=0,623629&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++311814++devouring_plague,9482C9,0,0,15|t++241719++halo,9482C9,1,0,15|t++147817++shadow_word_insanity,9482C9,2,0,15|t++133725++vampiric_touch,9482C9,3,0,15|t++116114++shadow_word_pain,9482C9,4,0,15|t++105642++shadow_word_death,9482C9,5,0,15|t++87055++mind_blast,9482C9,6,0,15|t++47099++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,9,9,9,6,6,5,5,5,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no4PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:355544466753457354564200zxywttrstvwwxwvusrrppppoooomlkjheddddeefhgiijjjjkkjknooqpoonmlljjiijklmmmjkjiiiiikllmnmlkigfgfggjjkklkkkkjiijjklmmnmmjjihghhgggggghhghhhggggikmlmmlllmmmnnmnnprrsqpppooopponpppqppnmmlmklmmnopqqrpponnnnmmonoomlkkihhgfeefggiijjjjhijkkloooqppoonlmjjiijjjjiigggfffffhijjjjjjjkjjkjkklmmnmnnmmmmnnmmopprpponnnommmnnoopqrrqqqqqrrtuuvwussqqqqqpppqrstststsrstuvuwvvwvvuutrsrrrrsstttutuutttttuvvvvuttttstsssrsstuuvvvwwxyyzy11244555546544333333443322100z0zz0ywwwwvvtsssrrsssuuvvuwyzzy0011112211110z000011222221111112221000zz00yy22334455544&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6863,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=112643|max=164131&chxp=1,1,69,100&chtt=priest_90_tof_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,8,24,48,32,64,152,120,304,336,440,592,768,1024,1256,1448,1696,2152,2288,2480,2664,2712,2768,2792,2632,2528,2648,2360,2312,1824,1720,1560,1280,1008,712,712,528,496,352,328,208,176,160,88,48,32,40,32,24&chds=0,2792&chbh=5&chxt=x&chxl=0:|min=104995|avg=112643|max=120403&chxp=0,1,50,100&chtt=priest_90_tof_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.9,21.4,15.6,11.4,6.6,4.3,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 130.2s|shadow_word_pain 96.6s|vampiric_touch 70.4s|mind_blast 51.2s|shadow_word_insanity 29.9s|devouring_plague 19.4s|shadow_word_death 17.3s|halo 12.8s|shadowfiend 2.4s|waiting 1.0s&chtt=priest_90_tof_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no4PT14 112643
devouring_plague 5146 (13404) 4.6% (11.9%) 16.2 28.78sec 372839 311814 117925 244418 143043 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 0.00 0.00 1.1957 0.0000 2319763.27 2319763.27 0.00 311814.42 311814.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.00 80.14% 117924.94 102399 157653 117941.56 105804 129971 1532648 1532648 0.00
crit 3.22 19.86% 244417.99 210941 324765 238335.07 0 324765 787115 787115 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1973 1.8% 37.7 11.10sec 23627 0 19513 40453 23662 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.68 37.62 0.00 0.00 0.0000 0.0000 890215.95 890215.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.17 80.18% 19513.30 17006 26181 19511.75 17792 21095 588647 588647 0.00
crit 7.45 19.82% 40453.14 35032 53932 40412.82 0 49054 301569 301569 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6286 5.6% 16.2 28.78sec 174902 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.2 19451 40327 23590 19.8% 0.0% 20.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 120.24 120.24 0.0000 0.7582 2836414.21 2836414.21 0.00 31112.29 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.4 80.17% 19451.31 17006 26181 19449.40 18236 20608 1875094 1875094 0.00
crit 23.8 19.83% 40327.16 35032 53932 40323.45 36404 44684 961320 961320 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6880) 0.0% (6.1%) 10.8 43.20sec 286480 241719 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.82 10.82 0.00 0.00 1.1852 0.0000 0.00 0.00 0.00 241718.63 241718.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.69 80.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.13 19.72% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6880 6.1% 10.8 43.20sec 286480 0 118397 244932 143237 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.82 21.64 0.00 0.00 0.0000 0.0000 3099799.75 3099799.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.39 80.37% 118396.94 104363 160794 118401.05 109343 128395 2059153 2059153 0.00
crit 4.25 19.63% 244932.31 214987 331235 242286.70 0 331235 1040647 1040647 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.20sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.82 227.16 0.00 0.00 0.0000 0.0000 0.00 45651871.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.93 77.01% 0.00 0 0 0.00 0 0 0 28217573 100.00
crit 52.23 22.99% 0.00 0 0 0.00 0 0 0 17434298 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9889 8.8% 39.6 11.36sec 112618 87055 92804 192346 112618 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.61 39.61 0.00 0.00 1.2936 0.0000 4461131.87 4461131.87 0.00 87054.97 87054.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.73 80.09% 92803.63 82079 126948 92821.00 88026 98041 2944476 2944476 0.00
crit 7.89 19.91% 192346.49 169082 261513 192402.32 169082 249617 1516656 1516656 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10370 (13624) 9.2% (12.1%) 79.9 5.48sec 76719 47099 0 0 0 0.0% 0.0% 0.0% 0.0% 158.2 24319 50416 29506 19.9% 0.0% 25.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.90 79.90 158.15 158.15 1.6289 0.7319 4666368.49 4666368.49 0.00 47098.61 47098.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 80.13% 24319.00 21797 33558 24322.18 23613 25192 3081745 3081745 0.00
crit 31.4 19.87% 50416.22 44901 69130 50423.93 47009 54226 1584624 1584624 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3254 2.9% 49.5 8.59sec 29577 0 24341 50466 29587 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.49 49.47 0.00 0.00 0.0000 0.0000 1463845.72 1463845.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.54 79.92% 24341.11 21797 33558 24344.06 22925 26444 962432 962432 0.00
crit 9.94 20.08% 50465.53 44901 69130 50477.64 0 60089 501414 501414 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4064 3.6% 14.5 4.98sec 126267 105642 103510 214769 126267 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.51 14.51 0.00 0.00 1.1953 0.0000 1831827.37 1831827.37 0.00 105641.72 105641.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.54 79.55% 103509.94 79678 123491 103611.85 96064 112562 1194537 1194537 0.00
crit 2.97 20.45% 214769.45 164137 254391 205761.04 0 254391 637291 637291 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9789 8.7% 25.3 17.08sec 174467 147817 143605 297742 174465 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.33 25.33 0.00 0.00 1.1803 0.0000 4419139.36 4419139.36 0.00 147817.08 147817.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.26 79.98% 143605.39 122772 199962 143631.82 134326 159343 2909125 2909125 0.00
crit 5.07 20.02% 297741.70 252910 411923 296078.84 0 411923 1510014 1510014 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 19050 (24880) 16.9% (22.1%) 81.5 5.51sec 137615 116114 0 0 0 0.0% 0.0% 0.0% 0.0% 443.1 14687 30382 19377 29.9% 0.0% 180.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.49 81.49 443.11 443.11 1.1852 1.8393 8586228.84 8586228.84 0.00 12301.42 116113.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 310.7 70.12% 14687.07 12783 20660 14688.32 14293 15095 4563240 4563240 0.00
crit 132.4 29.88% 30382.42 26333 42560 30384.23 29259 31990 4022989 4022989 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5830 5.2% 138.7 3.22sec 18948 0 14377 29746 18964 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.68 138.56 0.00 0.00 0.0000 0.0000 2627680.19 2627680.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.20 70.15% 14377.43 12783 19677 14379.48 13854 14952 1397520 1397520 0.00
crit 41.36 29.85% 29745.64 26333 40534 29752.41 27851 31829 1230160 1230160 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2242 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5569 4.9% 116.5 3.84sec 21546 0 18243 36687 21915 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.52 114.55 0.00 0.00 0.0000 0.0000 2510458.51 2510458.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.75 80.09% 18243.03 15875 25856 18245.00 17677 18940 1673762 1673762 0.00
crit 22.81 19.91% 36686.79 31750 51713 36697.65 33928 40299 836697 836697 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15990 (20883) 14.2% (18.5%) 59.4 7.49sec 158444 133725 0 0 0 0.0% 0.0% 0.0% 0.0% 359.7 16515 34215 20037 19.9% 0.0% 178.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.41 59.41 359.73 359.73 1.1849 2.2344 7207953.22 7207953.22 0.00 10768.39 133725.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.1 80.10% 16514.81 14287 23421 16515.49 15953 17140 4758705 4758705 0.00
crit 71.6 19.90% 34214.99 29431 48248 34215.43 32626 36125 2449248 2449248 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4893 4.3% 112.5 3.91sec 19610 0 16163 33491 19626 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.46 112.37 0.00 0.00 0.0000 0.0000 2205377.64 2205377.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.92 80.02% 16162.90 14287 22306 16164.41 15612 16843 1453302 1453302 0.00
crit 22.46 19.98% 33490.88 29431 45950 33495.31 30320 37663 752076 752076 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46240 / 3662
melee 46240 3.2% 31.2 12.61sec 52342 51535 45615 92262 52342 20.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.17 31.17 0.00 0.00 1.0157 0.0000 1631713.38 1631713.38 0.00 51535.39 51535.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 55.71% 45614.50 36329 55931 45634.75 41226 51180 792173 792173 0.00
crit 6.31 20.24% 92261.73 72658 111863 92117.87 0 111863 582129 582129 0.00
glance 7.50 24.05% 34331.56 27247 41949 34347.04 27247 41949 257412 257412 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1996 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.45%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.50%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.5sec 20.7sec 43.52% 43.76%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.52%

    Trigger Attempt Success

    • trigger_pct:1.79%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.19% 42.19%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.19%

    Trigger Attempt Success

    • trigger_pct:14.41%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.40% 49.50%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.2 138.6 15.5sec 0.6sec 20.01% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:20.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no4PT14
devouring_plague Shadow Orb 16.2 48.7 3.0 3.0 124278.8
halo Mana 10.8 438223.0 40500.0 40500.1 7.1
mind_blast Mana 39.6 356518.1 9000.0 9000.0 12.5
mind_flay Mana 79.9 239713.9 3000.0 3000.0 25.6
shadow_word_death Mana 14.5 113163.6 7800.0 7800.3 16.2
shadow_word_insanity Mana 25.3 189967.2 7500.0 7499.9 23.3
shadow_word_pain Mana 81.5 1075631.0 13200.0 13200.0 10.4
vampiric_touch Mana 59.4 534699.4 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.17 184801.82 (6.40%) 5928.06 95764.90 34.13%
Shadow Orbs from Mind Blast Shadow Orb 39.61 39.61 (84.39%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.61%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.86 0.00 (-nan%) 0.00 2192142.48 100.00%
Vampiric Touch Mana Mana 472.10 2213742.67 (76.71%) 4689.15 281744.21 11.29%
mp5_regen Mana 1803.14 487260.77 (16.88%) 270.23 53682.29 9.92%
Resource RPS-Gain RPS-Loss
Mana 6399.96 6537.71
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 237894.96 66000.00 300000.00
Shadow Orb 1.29 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.1%
shadowfiend-Mana Cap 10.1%
lightwell-Mana Cap 10.1%

Procs

Count Interval
Shadowy Recall Extra Tick 338.0 1.3sec
Shadowy Apparition Procced 116.5 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no4PT14 Damage Per Second
Count 49992
Mean 112642.78
Minimum 104995.28
Maximum 120403.33
Spread ( max - min ) 15408.06
Range [ ( max - min ) / 2 * 100% ] 6.84%
Standard Deviation 2198.7262
5th Percentile 109147.42
95th Percentile 116412.12
( 95th Percentile - 5th Percentile ) 7264.70
Mean Distribution
Standard Deviation 9.8338
95.00% Confidence Intervall ( 112623.50 - 112662.05 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1463
0.1 Scale Factor Error with Delta=300 41269
0.05 Scale Factor Error with Delta=300 165076
0.01 Scale Factor Error with Delta=300 4126919
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 112642.78
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49126204.38
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 309.03
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.39 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.51 shadow_word_death,if=active_enemies<=5
F 44.88 mind_blast,if=active_enemies<=6&cooldown_react
G 45.45 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.74 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.33 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.82 halo,if=talent.halo.enabled
M 11.83 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.56 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.49 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 45.02 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.04 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTIGIGHHFTWWWWIFGHHMTFLTIGHHGFTWWWFHHIGMTQFTHHIGFIGLTWWWWFHHMTIGQFTHHGTFTIGGWFHHMLTFTIGHHFGTWWWWFHGHTQFTHHGFIGLMTBWWFHHTIGTFTHHGTFMIGWWWWFHHLTIFGTHHIGFMTGGWFHHTQFTHHGIFGLMTWWWWFHHIGTFTHHGTFIGMWWWFHHLTIFGTHHIGQFMTWIGWWFHHTQFTIGHHIFGLTBGIFGHHMTQFTEEGHHGFDEEWWWWFHEDEHIGFLTEEGHHFMTE9EGFHHIGEDEFTIGHEEFHIGL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 351 - 552 ( 450.9 )

Performance:
Total Events Processed: 2635856384
Max Event Queue: 351
Sim Seconds: 22545485
CPU Seconds: 6796.5500
Speed Up: 3317

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Standard Deviation 54.8321
5th Percentile 367.59
95th Percentile 536.48
( 95th Percentile - 5th Percentile ) 168.89
Mean Distribution
Standard Deviation 0.2452
95.00% Confidence Intervall ( 450.43 - 451.39 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 568
0.1% Error 56805
0.1 Scale Factor Error with Delta=300 25
0.05 Scale Factor Error with Delta=300 102
0.01 Scale Factor Error with Delta=300 2566
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague 2944 3046655 6757 2.98 112371 232493 22.4 22.4 19.8% 0.0% 0.0% 0.0% 20.59sec 3046655 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_mastery 124467 1201116 2664 7.09 18597 38484 53.3 53.3 19.9% 0.0% 0.0% 0.0% 8.00sec 1201116 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_tick ticks -2944 3837812 8528 22.72 18574 38467 22.4 170.4 19.8% 0.0% 0.0% 0.0% 20.59sec 3837812 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo 120644 0 0 1.43 0 0 10.8 10.8 19.6% 0.0% 0.0% 0.0% 43.22sec 0 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_damage 120696 3011116 6678 2.87 115130 238232 10.8 21.6 19.9% 0.0% 0.0% 0.0% 43.22sec 3011116 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_heal 120696 0 0 30.39 0 0 10.8 228.4 23.0% 0.0% 0.0% 0.0% 43.22sec 44691379 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_blast 8092 6352296 14088 7.74 89953 186304 58.2 58.2 19.9% 0.0% 0.0% 0.0% 7.69sec 6352296 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay ticks -15407 2939875 6533 13.39 24104 50003 55.6 100.4 20.0% 0.0% 0.0% 0.0% 7.73sec 2939875 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay_mastery 124468 921017 2043 4.18 24129 50029 31.4 31.4 20.0% 0.0% 0.0% 0.0% 13.14sec 921017 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_spike 73510 5573797 12361 8.11 75426 156154 61.0 61.0 19.8% 0.0% 0.0% 0.0% 7.10sec 5573797 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_death 32379 1594542 3536 1.94 90041 186573 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.96sec 1594542 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain ticks -589 7807930 17351 59.90 14331 29666 62.8 449.3 19.9% 0.0% 0.0% 0.0% 7.17sec 7807930 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain_mastery 124464 2382442 5284 18.70 13980 28940 140.7 140.5 19.9% 0.0% 0.0% 0.0% 3.17sec 2382442 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowy_apparition 87532 1975346 4381 12.32 17766 35714 94.2 92.6 19.9% 0.0% 0.0% 0.0% 4.74sec 1975346 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch ticks -34914 6979288 15510 47.66 16105 33351 59.0 357.4 19.8% 0.0% 0.0% 0.0% 7.54sec 6979288 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch_mastery 124465 2130635 4725 14.88 15707 32536 111.9 111.8 19.9% 0.0% 0.0% 0.0% 3.93sec 2130635 450.91sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend melee 0 1630457 46161 52.94 45636 92197 31.2 31.2 20.2% 0.0% 24.1% 0.0% 12.61sec 1630457 35.32sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.45sec 0 35.32sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague 2944 3047819 6759 2.98 112351 232540 22.4 22.4 19.9% 0.0% 0.0% 0.0% 20.60sec 3047819 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_mastery 124467 1199923 2661 7.08 18594 38466 53.3 53.2 19.9% 0.0% 0.0% 0.0% 8.01sec 1199923 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_tick ticks -2944 3834429 8521 22.70 18575 38441 22.4 170.2 19.9% 0.0% 0.0% 0.0% 20.60sec 3834429 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo 120644 0 0 1.43 0 0 10.8 10.8 19.7% 0.0% 0.0% 0.0% 43.22sec 0 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_damage 120696 3008426 6672 2.87 115114 238046 10.8 21.6 19.9% 0.0% 0.0% 0.0% 43.22sec 3008426 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_heal 120696 0 0 30.40 0 0 10.8 228.5 23.0% 0.0% 0.0% 0.0% 43.22sec 44687041 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_blast 8092 6339375 14059 7.74 89936 186297 58.2 58.2 19.8% 0.0% 0.0% 0.0% 7.70sec 6339375 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay ticks -15407 2938629 6530 13.38 24107 49973 55.7 100.4 20.0% 0.0% 0.0% 0.0% 7.73sec 2938629 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay_mastery 124468 918955 2038 4.17 24130 50044 31.4 31.4 20.0% 0.0% 0.0% 0.0% 13.17sec 918955 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_spike 73510 5574080 12362 8.11 75434 156093 61.0 61.0 19.8% 0.0% 0.0% 0.0% 7.10sec 5574080 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_death 32379 1595238 3538 1.94 90059 186706 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.96sec 1595238 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain ticks -589 8489339 18865 59.90 14328 29627 62.8 449.2 29.9% 0.0% 0.0% 0.0% 7.17sec 8489339 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain_mastery 124464 2589325 5742 18.69 13975 28897 140.6 140.5 29.9% 0.0% 0.0% 0.0% 3.17sec 2589325 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowy_apparition 87532 2464886 5466 15.38 17763 35714 117.6 115.6 19.8% 0.0% 0.0% 0.0% 3.81sec 2464886 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch ticks -34914 6976735 15504 47.65 16104 33349 59.0 357.3 19.8% 0.0% 0.0% 0.0% 7.54sec 6976735 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch_mastery 124465 2126596 4716 14.87 15704 32519 111.8 111.7 19.8% 0.0% 0.0% 0.0% 3.93sec 2126596 450.91sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend melee 0 1631822 46198 52.94 45632 92217 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.61sec 1631822 35.32sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.44sec 0 35.32sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague 2944 2860066 6343 2.79 112439 232929 21.0 21.0 20.0% 0.0% 0.0% 0.0% 22.08sec 2860066 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_mastery 124467 1116310 2476 6.59 18609 38528 49.6 49.5 19.7% 0.0% 0.0% 0.0% 8.59sec 1116310 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_tick ticks -2944 3570589 7935 21.14 18588 38481 21.0 158.5 19.8% 0.0% 0.0% 0.0% 22.08sec 3570589 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.9% 0.0% 0.0% 0.0% 42.98sec 0 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_damage 120696 3031843 6724 2.89 115096 238194 10.9 21.7 20.0% 0.0% 0.0% 0.0% 42.98sec 3031843 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_heal 120696 0 0 30.42 0 0 10.9 228.6 23.0% 0.0% 0.0% 0.0% 42.98sec 44727785 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_blast 8092 5876324 13032 7.17 89958 186304 53.9 53.9 19.9% 0.0% 0.0% 0.0% 8.32sec 5876324 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay ticks -15407 4911785 10915 22.45 24024 49793 88.9 168.4 20.0% 0.0% 0.0% 0.0% 4.93sec 4911785 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay_mastery 124468 1535228 3405 7.00 24041 49823 52.6 52.6 20.0% 0.0% 0.0% 0.0% 8.14sec 1535228 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.85sec 0 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_death 32379 1589392 3525 1.93 90030 186970 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.99sec 1589392 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain ticks -589 8001082 17780 61.45 14319 29641 73.7 460.9 19.8% 0.0% 0.0% 0.0% 6.10sec 8001082 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain_mastery 124464 2443048 5418 19.17 13979 28942 144.2 144.1 19.9% 0.0% 0.0% 0.0% 3.10sec 2443048 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadowy_apparition 87532 2000029 4436 12.48 17760 35701 95.4 93.8 19.9% 0.0% 0.0% 0.0% 4.68sec 2000029 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch ticks -34914 6928557 15397 47.35 16093 33326 58.7 355.1 19.8% 0.0% 0.0% 0.0% 7.58sec 6928557 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch_mastery 124465 2114119 4689 14.76 15709 32542 111.0 110.9 19.9% 0.0% 0.0% 0.0% 3.96sec 2114119 450.91sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender melee 0 4388858 37630 54.11 36412 73375 105.2 105.2 20.2% 0.0% 23.9% 0.0% 4.17sec 4388858 116.63sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.63sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague 2944 2858471 6339 2.79 112438 232863 21.0 21.0 19.9% 0.0% 0.0% 0.0% 22.08sec 2858471 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_mastery 124467 1118680 2481 6.60 18604 38523 49.7 49.6 19.8% 0.0% 0.0% 0.0% 8.57sec 1118680 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_tick ticks -2944 3573815 7942 21.15 18584 38481 21.0 158.6 19.8% 0.0% 0.0% 0.0% 22.08sec 3573815 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 42.96sec 0 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_damage 120696 3028104 6716 2.89 115089 238200 10.9 21.7 19.8% 0.0% 0.0% 0.0% 42.96sec 3028104 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_heal 120696 0 0 30.43 0 0 10.9 228.7 22.9% 0.0% 0.0% 0.0% 42.96sec 44719181 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_blast 8092 5880370 13041 7.16 89964 186260 53.8 53.8 20.0% 0.0% 0.0% 0.0% 8.32sec 5880370 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay ticks -15407 4908719 10908 22.45 24020 49782 88.9 168.4 19.9% 0.0% 0.0% 0.0% 4.93sec 4908719 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay_mastery 124468 1536458 3407 7.00 24037 49857 52.7 52.6 20.0% 0.0% 0.0% 0.0% 8.13sec 1536458 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.85sec 0 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_death 32379 1587628 3521 1.93 90078 186670 14.5 14.5 20.2% 0.0% 0.0% 0.0% 4.99sec 1587628 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain ticks -589 8705441 19345 61.48 14316 29599 73.8 461.1 29.9% 0.0% 0.0% 0.0% 6.09sec 8705441 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain_mastery 124464 2655692 5890 19.18 13974 28885 144.3 144.2 29.8% 0.0% 0.0% 0.0% 3.09sec 2655692 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadowy_apparition 87532 2489247 5520 15.53 17758 35707 118.7 116.7 19.9% 0.0% 0.0% 0.0% 3.77sec 2489247 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch ticks -34914 6927087 15394 47.33 16092 33333 58.6 355.0 19.9% 0.0% 0.0% 0.0% 7.58sec 6927087 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch_mastery 124465 2117021 4695 14.78 15710 32537 111.2 111.1 19.9% 0.0% 0.0% 0.0% 3.95sec 2117021 450.91sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender melee 0 4382698 37578 54.11 36421 73374 105.2 105.2 20.1% 0.0% 24.0% 0.0% 4.17sec 4382698 116.63sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.63sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague 2944 2826104 6268 2.75 112392 232718 20.7 20.7 20.1% 0.0% 0.0% 0.0% 22.36sec 2826104 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_mastery 124467 1102682 2445 6.50 18599 38516 48.9 48.9 19.9% 0.0% 0.0% 0.0% 8.70sec 1102682 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_tick ticks -2944 3527382 7839 20.89 18572 38447 20.7 156.7 19.8% 0.0% 0.0% 0.0% 22.36sec 3527382 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo 120644 0 0 1.43 0 0 10.7 10.7 19.8% 0.0% 0.0% 0.0% 43.55sec 0 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_damage 120696 2992511 6637 2.85 115132 238183 10.7 21.4 19.9% 0.0% 0.0% 0.0% 43.55sec 2992511 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_heal 120696 0 0 30.29 0 0 10.7 227.7 22.9% 0.0% 0.0% 0.0% 43.55sec 44490613 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_blast 8092 5791520 12844 7.07 89975 186321 53.1 53.1 19.8% 0.0% 0.0% 0.0% 8.44sec 5791520 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay ticks -15407 4130166 9178 18.95 23957 49633 75.2 142.1 19.9% 0.0% 0.0% 0.0% 5.80sec 4130166 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay_mastery 124468 1293710 2869 5.92 23965 49690 44.5 44.5 19.9% 0.0% 0.0% 0.0% 9.51sec 1293710 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_death 32379 1584974 3515 1.93 90014 186501 14.5 14.5 20.1% 0.0% 0.0% 0.0% 4.99sec 1584974 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_insanity 129249 4175140 9259 3.27 139846 289621 24.6 24.6 19.9% 0.0% 0.0% 0.0% 17.52sec 4175140 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain ticks -589 7577321 16838 58.19 14316 29647 74.9 436.4 19.9% 0.0% 0.0% 0.0% 6.00sec 7577321 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain_mastery 124464 2310032 5123 18.13 13978 28937 136.4 136.3 19.9% 0.0% 0.0% 0.0% 3.27sec 2310032 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.89sec 0 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowy_apparition 87532 1935481 4292 12.07 17757 35699 92.3 90.7 20.0% 0.0% 0.0% 0.0% 4.84sec 1935481 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch ticks -34914 7003460 15563 47.78 16109 33352 59.2 358.3 19.9% 0.0% 0.0% 0.0% 7.52sec 7003460 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch_mastery 124465 2131790 4728 14.89 15712 32528 112.0 111.9 19.9% 0.0% 0.0% 0.0% 3.93sec 2131790 450.91sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend melee 0 1632733 46221 52.92 45642 92170 31.2 31.2 20.4% 0.0% 23.9% 0.0% 12.62sec 1632733 35.32sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.43sec 0 35.32sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague 2944 2818402 6250 2.75 112378 232602 20.7 20.7 19.8% 0.0% 0.0% 0.0% 22.38sec 2818402 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_mastery 124467 1100873 2441 6.50 18594 38496 48.9 48.8 19.8% 0.0% 0.0% 0.0% 8.70sec 1100873 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_tick ticks -2944 3520281 7823 20.85 18567 38436 20.7 156.4 19.8% 0.0% 0.0% 0.0% 22.38sec 3520281 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo 120644 0 0 1.43 0 0 10.7 10.7 19.7% 0.0% 0.0% 0.0% 43.54sec 0 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_damage 120696 2988458 6628 2.85 115109 238316 10.7 21.4 19.8% 0.0% 0.0% 0.0% 43.54sec 2988458 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_heal 120696 0 0 30.27 0 0 10.7 227.5 23.0% 0.0% 0.0% 0.0% 43.54sec 44508156 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_blast 8092 5794575 12851 7.06 89958 186376 53.1 53.1 20.0% 0.0% 0.0% 0.0% 8.45sec 5794575 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay ticks -15407 4129563 9177 18.94 23953 49648 75.2 142.0 19.9% 0.0% 0.0% 0.0% 5.80sec 4129563 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay_mastery 124468 1292467 2866 5.92 23969 49673 44.5 44.5 19.9% 0.0% 0.0% 0.0% 9.52sec 1292467 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_death 32379 1587474 3521 1.93 90020 186827 14.5 14.5 20.2% 0.0% 0.0% 0.0% 4.99sec 1587474 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_insanity 129249 4185775 9283 3.28 139824 290002 24.6 24.6 20.0% 0.0% 0.0% 0.0% 17.48sec 4185775 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain ticks -589 8242232 18316 58.20 14314 29600 75.0 436.5 29.9% 0.0% 0.0% 0.0% 5.99sec 8242232 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain_mastery 124464 2515446 5579 18.16 13978 28897 136.6 136.5 29.9% 0.0% 0.0% 0.0% 3.27sec 2515446 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowy_apparition 87532 2428883 5387 15.17 17749 35703 115.9 114.0 19.8% 0.0% 0.0% 0.0% 3.86sec 2428883 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch ticks -34914 6999819 15555 47.78 16107 33361 59.2 358.4 19.9% 0.0% 0.0% 0.0% 7.52sec 6999819 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch_mastery 124465 2133189 4731 14.90 15706 32545 112.1 112.0 19.9% 0.0% 0.0% 0.0% 3.92sec 2133189 450.91sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend melee 0 1631328 46179 52.92 45614 92178 31.2 31.2 20.3% 0.0% 24.1% 0.0% 12.61sec 1631328 35.33sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.44sec 0 35.33sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague 2944 2502564 5550 2.44 112486 233119 18.3 18.3 19.8% 0.0% 0.0% 0.0% 25.42sec 2502564 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_mastery 124467 987459 2190 5.82 18615 38549 43.8 43.7 19.9% 0.0% 0.0% 0.0% 9.68sec 987459 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_tick ticks -2944 3142030 6982 18.62 18567 38431 18.3 139.7 19.8% 0.0% 0.0% 0.0% 25.42sec 3142030 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo 120644 0 0 1.46 0 0 10.9 10.9 19.9% 0.0% 0.0% 0.0% 42.71sec 0 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_damage 120696 3050860 6766 2.91 115097 238155 10.9 21.9 19.8% 0.0% 0.0% 0.0% 42.71sec 3050860 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_heal 120696 0 0 30.66 0 0 10.9 230.4 23.0% 0.0% 0.0% 0.0% 42.71sec 45067016 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_blast 8092 5008273 11107 6.11 89953 186213 45.9 45.9 19.8% 0.0% 0.0% 0.0% 9.78sec 5008273 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay ticks -15407 3732880 8295 16.96 24165 50116 67.0 127.2 20.0% 0.0% 0.0% 0.0% 6.50sec 3732880 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay_mastery 124468 1170478 2596 5.30 24190 50162 39.9 39.8 20.0% 0.0% 0.0% 0.0% 10.63sec 1170478 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_spike 73510 6088098 13502 8.85 75567 156373 66.5 66.5 19.8% 0.0% 0.0% 0.0% 6.56sec 6088098 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.09sec 0 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_death 32379 1611951 3575 1.95 90113 186898 14.7 14.7 20.4% 0.0% 0.0% 0.0% 4.92sec 1611951 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain ticks -589 8256005 18347 63.08 14383 29790 65.9 473.1 19.9% 0.0% 0.0% 0.0% 6.83sec 8256005 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain_mastery 124464 2511259 5569 19.68 13999 28992 148.0 147.9 19.9% 0.0% 0.0% 0.0% 3.02sec 2511259 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowy_apparition 87532 2039595 4523 12.70 17792 35787 97.1 95.4 19.9% 0.0% 0.0% 0.0% 4.60sec 2039595 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch ticks -34914 7430166 16511 50.67 16126 33401 59.2 380.0 19.8% 0.0% 0.0% 0.0% 7.52sec 7430166 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch_mastery 124465 2266740 5027 15.79 15745 32629 118.8 118.7 19.9% 0.0% 0.0% 0.0% 3.71sec 2266740 450.91sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend melee 0 1636120 46320 52.96 45718 92376 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.60sec 1636120 35.32sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.46sec 0 35.32sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague 2944 2506317 5558 2.44 112513 232961 18.4 18.4 20.0% 0.0% 0.0% 0.0% 25.42sec 2506317 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_mastery 124467 987423 2190 5.82 18617 38550 43.8 43.7 19.9% 0.0% 0.0% 0.0% 9.69sec 987423 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_tick ticks -2944 3143839 6986 18.63 18570 38430 18.4 139.7 19.8% 0.0% 0.0% 0.0% 25.42sec 3143839 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo 120644 0 0 1.46 0 0 10.9 10.9 19.8% 0.0% 0.0% 0.0% 42.68sec 0 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_damage 120696 3044574 6752 2.91 115072 238049 10.9 21.9 19.5% 0.0% 0.0% 0.0% 42.68sec 3044574 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_heal 120696 0 0 30.68 0 0 10.9 230.6 22.9% 0.0% 0.0% 0.0% 42.68sec 45065304 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_blast 8092 5008549 11108 6.11 89967 186346 45.9 45.9 19.8% 0.0% 0.0% 0.0% 9.78sec 5008549 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay ticks -15407 3725391 8279 16.91 24162 50099 66.9 126.8 20.1% 0.0% 0.0% 0.0% 6.51sec 3725391 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay_mastery 124468 1162252 2578 5.26 24181 50154 39.6 39.6 20.0% 0.0% 0.0% 0.0% 10.70sec 1162252 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_spike 73510 6114231 13560 8.88 75590 156572 66.7 66.7 19.8% 0.0% 0.0% 0.0% 6.54sec 6114231 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.09sec 0 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_death 32379 1611246 3573 1.95 90079 186826 14.7 14.7 20.3% 0.0% 0.0% 0.0% 4.91sec 1611246 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain ticks -589 8977384 19950 63.06 14381 29747 65.8 472.9 29.9% 0.0% 0.0% 0.0% 6.84sec 8977384 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain_mastery 124464 2726477 6047 19.66 14001 28947 147.9 147.7 29.8% 0.0% 0.0% 0.0% 3.02sec 2726477 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowy_apparition 87532 2527580 5606 15.74 17786 35765 120.3 118.3 19.9% 0.0% 0.0% 0.0% 3.72sec 2527580 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch ticks -34914 7435508 16523 50.68 16127 33403 59.2 380.1 19.9% 0.0% 0.0% 0.0% 7.52sec 7435508 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch_mastery 124465 2269791 5034 15.80 15748 32641 118.9 118.8 19.9% 0.0% 0.0% 0.0% 3.71sec 2269791 450.91sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend melee 0 1637159 46350 52.97 45746 92317 31.2 31.2 20.4% 0.0% 23.9% 0.0% 12.60sec 1637159 35.32sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.45sec 0 35.32sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague 2944 2208138 4897 2.15 112420 232790 16.2 16.2 20.0% 0.0% 0.0% 0.0% 28.55sec 2208138 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_mastery 124467 848959 1883 5.02 18550 38379 37.8 37.7 19.9% 0.0% 0.0% 0.0% 10.97sec 848959 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_tick ticks -2944 2717847 6040 16.12 18536 38361 16.2 120.9 19.9% 0.0% 0.0% 0.0% 28.55sec 2717847 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo 120644 0 0 1.47 0 0 11.0 11.0 19.7% 0.0% 0.0% 0.0% 42.36sec 0 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_damage 120696 3078953 6828 2.94 115066 238136 11.0 22.1 19.9% 0.0% 0.0% 0.0% 42.36sec 3078953 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_heal 120696 0 0 30.98 0 0 11.0 232.8 22.9% 0.0% 0.0% 0.0% 42.36sec 45500602 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_blast 8092 4288349 9510 5.24 89856 185954 39.4 39.4 19.8% 0.0% 0.0% 0.0% 11.45sec 4288349 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay ticks -15407 5984379 13299 27.26 24092 49980 100.2 204.4 20.0% 0.0% 0.0% 0.0% 4.39sec 5984379 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay_mastery 124468 1867337 4141 8.49 24113 49968 63.8 63.8 19.9% 0.0% 0.0% 0.0% 6.78sec 1867337 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.71sec 0 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.08sec 0 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_death 32379 1601951 3553 1.94 90140 186824 14.6 14.6 20.3% 0.0% 0.0% 0.0% 4.94sec 1601951 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain ticks -589 8507722 18906 65.02 14372 29770 80.1 487.7 20.0% 0.0% 0.0% 0.0% 5.61sec 8507722 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain_mastery 124464 2584842 5733 20.25 13999 28986 152.3 152.2 19.9% 0.0% 0.0% 0.0% 2.93sec 2584842 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadowy_apparition 87532 2077286 4607 12.93 17787 35749 98.8 97.2 20.0% 0.0% 0.0% 0.0% 4.52sec 2077286 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch ticks -34914 7355115 16345 50.12 16131 33411 58.8 375.9 19.9% 0.0% 0.0% 0.0% 7.57sec 7355115 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch_mastery 124465 2247575 4985 15.64 15753 32647 117.6 117.5 19.9% 0.0% 0.0% 0.0% 3.75sec 2247575 450.91sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender melee 0 4401070 37659 54.09 36484 73510 105.3 105.3 20.2% 0.0% 24.0% 0.0% 4.17sec 4401070 116.87sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.27sec 0 116.87sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague 2944 2206901 4894 2.15 112409 232645 16.2 16.2 19.9% 0.0% 0.0% 0.0% 28.52sec 2206901 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_mastery 124467 849380 1884 5.03 18546 38403 37.9 37.8 19.7% 0.0% 0.0% 0.0% 10.93sec 849380 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_tick ticks -2944 2716657 6037 16.12 18529 38371 16.2 120.9 19.8% 0.0% 0.0% 0.0% 28.52sec 2716657 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo 120644 0 0 1.47 0 0 11.0 11.0 19.9% 0.0% 0.0% 0.0% 42.34sec 0 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_damage 120696 3077679 6825 2.94 115079 237958 11.0 22.1 19.9% 0.0% 0.0% 0.0% 42.34sec 3077679 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_heal 120696 0 0 30.99 0 0 11.0 232.9 23.0% 0.0% 0.0% 0.0% 42.34sec 45524766 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_blast 8092 4291927 9518 5.24 89850 185997 39.4 39.4 19.8% 0.0% 0.0% 0.0% 11.44sec 4291927 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay ticks -15407 5983757 13297 27.26 24094 49949 100.2 204.4 20.0% 0.0% 0.0% 0.0% 4.39sec 5983757 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay_mastery 124468 1874265 4157 8.51 24106 49987 64.0 64.0 20.0% 0.0% 0.0% 0.0% 6.77sec 1874265 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.71sec 0 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.10sec 0 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_death 32379 1598725 3546 1.94 90114 186797 14.6 14.6 20.1% 0.0% 0.0% 0.0% 4.94sec 1598725 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain ticks -589 9244579 20544 65.02 14369 29723 80.1 487.7 29.9% 0.0% 0.0% 0.0% 5.61sec 9244579 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain_mastery 124464 2811899 6236 20.26 13993 28944 152.4 152.3 29.9% 0.0% 0.0% 0.0% 2.93sec 2811899 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadowy_apparition 87532 2552624 5661 15.91 17779 35751 121.6 119.6 19.9% 0.0% 0.0% 0.0% 3.68sec 2552624 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch ticks -34914 7357365 16350 50.13 16133 33411 58.8 376.0 19.9% 0.0% 0.0% 0.0% 7.57sec 7357365 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch_mastery 124465 2246587 4982 15.64 15751 32641 117.6 117.5 19.9% 0.0% 0.0% 0.0% 3.75sec 2246587 450.91sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender melee 0 4397592 37629 54.09 36473 73497 105.3 105.3 20.1% 0.0% 24.0% 0.0% 4.17sec 4397592 116.87sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.26sec 0 116.87sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague 2944 2194216 4866 2.14 112439 232784 16.1 16.1 19.9% 0.0% 0.0% 0.0% 28.73sec 2194216 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_mastery 124467 854366 1895 5.04 18585 38469 38.0 37.9 19.9% 0.0% 0.0% 0.0% 10.91sec 854366 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_tick ticks -2944 2719391 6043 16.15 18531 38365 16.1 121.1 19.7% 0.0% 0.0% 0.0% 28.73sec 2719391 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 20.0% 0.0% 0.0% 0.0% 43.40sec 0 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_damage 120696 3014696 6686 2.87 115117 238453 10.8 21.6 19.8% 0.0% 0.0% 0.0% 43.40sec 3014696 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_heal 120696 0 0 29.96 0 0 10.8 225.2 23.0% 0.0% 0.0% 0.0% 43.40sec 44071147 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_blast 8092 4264321 9457 5.21 89858 185936 39.1 39.1 19.9% 0.0% 0.0% 0.0% 11.52sec 4264321 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay ticks -15407 5165949 11480 23.51 24117 50016 86.7 176.3 20.0% 0.0% 0.0% 0.0% 5.06sec 5165949 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay_mastery 124468 1619078 3591 7.35 24130 50034 55.2 55.2 20.1% 0.0% 0.0% 0.0% 7.78sec 1619078 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.13sec 0 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_death 32379 1601696 3552 1.94 90135 186923 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.95sec 1601696 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_insanity 129249 4211319 9340 3.34 138442 286636 25.1 25.1 19.8% 0.0% 0.0% 0.0% 16.05sec 4211319 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain ticks -589 8103115 18007 61.84 14393 29830 80.8 463.8 19.9% 0.0% 0.0% 0.0% 5.56sec 8103115 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain_mastery 124464 2462413 5461 19.29 14002 29002 145.1 145.0 19.9% 0.0% 0.0% 0.0% 3.08sec 2462413 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.03sec 0 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowy_apparition 87532 2005796 4448 12.49 17789 35772 95.5 93.9 19.9% 0.0% 0.0% 0.0% 4.68sec 2005796 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch ticks -34914 7432305 16516 50.68 16123 33400 59.2 380.1 19.9% 0.0% 0.0% 0.0% 7.53sec 7432305 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch_mastery 124465 2271325 5037 15.81 15747 32630 118.9 118.8 19.9% 0.0% 0.0% 0.0% 3.70sec 2271325 450.91sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend melee 0 1635823 46321 52.97 45733 92441 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.60sec 1635823 35.32sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.48sec 0 35.32sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague 2944 2192412 4862 2.14 112423 232534 16.1 16.1 19.8% 0.0% 0.0% 0.0% 28.72sec 2192412 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_mastery 124467 855200 1897 5.05 18581 38474 38.0 38.0 19.8% 0.0% 0.0% 0.0% 10.89sec 855200 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_tick ticks -2944 2721664 6048 16.17 18528 38335 16.1 121.2 19.8% 0.0% 0.0% 0.0% 28.72sec 2721664 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.9% 0.0% 0.0% 0.0% 43.40sec 0 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_damage 120696 3018232 6694 2.87 115134 238321 10.8 21.6 20.0% 0.0% 0.0% 0.0% 43.40sec 3018232 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_heal 120696 0 0 29.95 0 0 10.8 225.0 23.0% 0.0% 0.0% 0.0% 43.40sec 44028626 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_blast 8092 4262129 9452 5.21 89834 186080 39.2 39.2 19.7% 0.0% 0.0% 0.0% 11.52sec 4262129 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay ticks -15407 5170236 11489 23.52 24119 50009 86.7 176.4 20.0% 0.0% 0.0% 0.0% 5.06sec 5170236 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay_mastery 124468 1619974 3593 7.35 24138 50074 55.2 55.2 20.1% 0.0% 0.0% 0.0% 7.78sec 1619974 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.13sec 0 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_death 32379 1603776 3557 1.94 90118 186860 14.6 14.6 20.5% 0.0% 0.0% 0.0% 4.95sec 1603776 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_insanity 129249 4209833 9336 3.34 138396 286263 25.1 25.1 19.8% 0.0% 0.0% 0.0% 16.04sec 4209833 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain ticks -589 8810235 19578 61.83 14390 29774 80.8 463.7 30.0% 0.0% 0.0% 0.0% 5.56sec 8810235 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain_mastery 124464 2674553 5931 19.27 14002 28958 144.9 144.8 29.9% 0.0% 0.0% 0.0% 3.08sec 2674553 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.03sec 0 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowy_apparition 87532 2493158 5529 15.54 17778 35746 118.8 116.8 19.9% 0.0% 0.0% 0.0% 3.77sec 2493158 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch ticks -34914 7436462 16525 50.68 16127 33399 59.2 380.1 19.9% 0.0% 0.0% 0.0% 7.52sec 7436462 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch_mastery 124465 2269345 5033 15.80 15749 32631 118.8 118.7 19.9% 0.0% 0.0% 0.0% 3.71sec 2269345 450.91sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend melee 0 1636471 46339 52.99 45769 92394 31.2 31.2 20.2% 0.0% 23.9% 0.0% 12.61sec 1636471 35.31sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.48sec 0 35.31sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague 2944 2584099 5731 2.41 117402 243248 18.1 18.1 19.9% 0.0% 0.0% 0.0% 25.64sec 2584099 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_mastery 124467 1000520 2219 5.64 19453 40322 42.5 42.4 19.9% 0.0% 0.0% 0.0% 9.95sec 1000520 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_tick ticks -2944 3186909 7082 18.09 19386 40146 18.1 135.7 19.8% 0.0% 0.0% 0.0% 25.64sec 3186909 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 42.99sec 0 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_damage 120696 3118239 6915 2.89 118358 244934 10.9 21.7 19.8% 0.0% 0.0% 0.0% 42.99sec 3118239 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_heal 120696 0 0 30.46 0 0 10.9 228.9 22.9% 0.0% 0.0% 0.0% 42.99sec 45984406 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_blast 8092 5089898 11288 6.05 92425 191321 45.4 45.4 19.8% 0.0% 0.0% 0.0% 9.88sec 5089898 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay ticks -15407 3477548 7728 15.63 24418 50618 63.8 117.3 20.0% 0.0% 0.0% 0.0% 6.79sec 3477548 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay_mastery 124468 1088050 2413 4.88 24438 50681 36.7 36.7 19.9% 0.0% 0.0% 0.0% 11.38sec 1088050 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_spike 73510 5903157 13092 8.38 77309 160301 63.0 63.0 19.8% 0.0% 0.0% 0.0% 6.89sec 5903157 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_death 32379 1838032 4076 1.94 103546 214600 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.95sec 1838032 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain ticks -589 8075417 17945 60.39 14698 30437 65.5 452.9 19.9% 0.0% 0.0% 0.0% 6.87sec 8075417 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain_mastery 124464 2467668 5473 18.84 14377 29790 141.7 141.6 19.8% 0.0% 0.0% 0.0% 3.15sec 2467668 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowy_apparition 87532 2038148 4520 12.37 18251 36712 94.6 93.0 19.9% 0.0% 0.0% 0.0% 4.72sec 2038148 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch ticks -34914 7203265 16007 47.97 16510 34206 59.4 359.8 19.8% 0.0% 0.0% 0.0% 7.49sec 7203265 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch_mastery 124465 2197279 4873 14.93 16147 33466 112.3 112.2 19.8% 0.0% 0.0% 0.0% 3.91sec 2197279 450.91sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend melee 0 1632252 46213 52.96 45662 92251 31.2 31.2 20.2% 0.0% 23.9% 0.0% 12.61sec 1632252 35.32sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.44sec 0 35.32sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague 2944 2584244 5731 2.41 117397 243433 18.1 18.1 19.9% 0.0% 0.0% 0.0% 25.65sec 2584244 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_mastery 124467 1002527 2223 5.65 19465 40332 42.5 42.5 19.9% 0.0% 0.0% 0.0% 9.94sec 1002527 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_tick ticks -2944 3189974 7089 18.10 19387 40172 18.1 135.7 19.8% 0.0% 0.0% 0.0% 25.65sec 3189974 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 43.01sec 0 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_damage 120696 3114544 6907 2.89 118325 244928 10.9 21.7 19.9% 0.0% 0.0% 0.0% 43.01sec 3114544 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_heal 120696 0 0 30.42 0 0 10.9 228.6 22.9% 0.0% 0.0% 0.0% 43.01sec 45914796 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_blast 8092 5094031 11297 6.05 92433 191380 45.4 45.4 19.9% 0.0% 0.0% 0.0% 9.88sec 5094031 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay ticks -15407 3471576 7715 15.61 24416 50615 63.7 117.1 20.0% 0.0% 0.0% 0.0% 6.80sec 3471576 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay_mastery 124468 1087927 2413 4.88 24442 50684 36.7 36.7 19.9% 0.0% 0.0% 0.0% 11.38sec 1087927 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_spike 73510 5921427 13132 8.40 77345 160267 63.1 63.1 19.8% 0.0% 0.0% 0.0% 6.88sec 5921427 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_death 32379 1840102 4081 1.94 103559 214492 14.6 14.6 20.4% 0.0% 0.0% 0.0% 4.95sec 1840102 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain ticks -589 8783433 19519 60.39 14701 30410 65.5 452.9 29.9% 0.0% 0.0% 0.0% 6.88sec 8783433 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain_mastery 124464 2686642 5958 18.85 14377 29742 141.8 141.7 29.8% 0.0% 0.0% 0.0% 3.15sec 2686642 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowy_apparition 87532 2543238 5640 15.43 18256 36734 118.0 116.0 19.9% 0.0% 0.0% 0.0% 3.79sec 2543238 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch ticks -34914 7208105 16018 47.97 16515 34209 59.4 359.8 19.9% 0.0% 0.0% 0.0% 7.49sec 7208105 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch_mastery 124465 2204517 4889 14.97 16153 33480 112.6 112.5 19.9% 0.0% 0.0% 0.0% 3.91sec 2204517 450.91sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend melee 0 1630396 46158 52.96 45640 92149 31.2 31.2 20.2% 0.0% 24.1% 0.0% 12.61sec 1630396 35.32sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.45sec 0 35.32sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague 2944 2375828 5269 2.20 118058 244754 16.5 16.5 20.2% 0.0% 0.0% 0.0% 28.11sec 2375828 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_mastery 124467 910881 2020 5.11 19535 40515 38.5 38.4 19.8% 0.0% 0.0% 0.0% 10.86sec 910881 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_tick ticks -2944 2913108 6474 16.44 19486 40372 16.5 123.3 19.8% 0.0% 0.0% 0.0% 28.11sec 2913108 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 20.0% 0.0% 0.0% 0.0% 43.01sec 0 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_damage 120696 3118256 6915 2.89 118338 244465 10.9 21.7 19.9% 0.0% 0.0% 0.0% 43.01sec 3118256 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_heal 120696 0 0 30.23 0 0 10.9 227.2 22.9% 0.0% 0.0% 0.0% 43.01sec 45607568 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_blast 8092 4553477 10098 5.39 92725 192022 40.5 40.5 19.8% 0.0% 0.0% 0.0% 11.10sec 4553477 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay ticks -15407 5508140 12240 24.78 24395 50591 94.6 185.8 20.0% 0.0% 0.0% 0.0% 4.64sec 5508140 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay_mastery 124468 1721529 3818 7.73 24409 50601 58.1 58.1 19.9% 0.0% 0.0% 0.0% 7.39sec 1721529 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.87sec 0 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_death 32379 1831289 4061 1.93 103539 214718 14.5 14.5 20.2% 0.0% 0.0% 0.0% 4.97sec 1831289 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain ticks -589 8340906 18535 62.44 14686 30411 79.9 468.3 19.9% 0.0% 0.0% 0.0% 5.62sec 8340906 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain_mastery 124464 2552781 5661 19.47 14380 29791 146.4 146.3 19.9% 0.0% 0.0% 0.0% 3.05sec 2552781 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadowy_apparition 87532 2075924 4604 12.61 18246 36698 96.4 94.8 19.8% 0.0% 0.0% 0.0% 4.63sec 2075924 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch ticks -34914 7142194 15872 47.61 16490 34171 59.0 357.1 19.8% 0.0% 0.0% 0.0% 7.54sec 7142194 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch_mastery 124465 2188843 4854 14.87 16146 33461 111.9 111.8 19.8% 0.0% 0.0% 0.0% 3.93sec 2188843 450.91sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender melee 0 4379693 37569 54.12 36424 73383 105.1 105.1 20.0% 0.0% 24.0% 0.0% 4.17sec 4379693 116.58sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.30sec 0 116.58sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague 2944 2369576 5255 2.20 118044 244447 16.5 16.5 20.0% 0.0% 0.0% 0.0% 28.12sec 2369576 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_mastery 124467 910794 2020 5.11 19526 40551 38.5 38.4 19.8% 0.0% 0.0% 0.0% 10.85sec 910794 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_tick ticks -2944 2909846 6466 16.43 19476 40368 16.5 123.2 19.8% 0.0% 0.0% 0.0% 28.12sec 2909846 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 20.1% 0.0% 0.0% 0.0% 43.01sec 0 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_damage 120696 3118948 6917 2.89 118267 244884 10.9 21.7 20.0% 0.0% 0.0% 0.0% 43.01sec 3118948 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_heal 120696 0 0 30.23 0 0 10.9 227.2 23.0% 0.0% 0.0% 0.0% 43.01sec 45618439 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_blast 8092 4553831 10099 5.39 92721 192003 40.5 40.5 19.9% 0.0% 0.0% 0.0% 11.11sec 4553831 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay ticks -15407 5509046 12242 24.79 24395 50591 94.7 186.0 20.0% 0.0% 0.0% 0.0% 4.64sec 5509046 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay_mastery 124468 1724477 3824 7.74 24411 50629 58.2 58.2 20.0% 0.0% 0.0% 0.0% 7.38sec 1724477 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.87sec 0 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_death 32379 1831673 4062 1.93 103531 214774 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.98sec 1831673 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain ticks -589 9070329 20156 62.44 14688 30374 79.8 468.3 29.8% 0.0% 0.0% 0.0% 5.63sec 9070329 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain_mastery 124464 2775519 6155 19.48 14375 29748 146.5 146.4 29.8% 0.0% 0.0% 0.0% 3.05sec 2775519 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadowy_apparition 87532 2576299 5714 15.64 18247 36705 119.6 117.5 19.9% 0.0% 0.0% 0.0% 3.74sec 2576299 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch ticks -34914 7141464 15870 47.62 16494 34173 59.0 357.2 19.8% 0.0% 0.0% 0.0% 7.54sec 7141464 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch_mastery 124465 2190609 4858 14.88 16150 33491 111.9 111.8 19.9% 0.0% 0.0% 0.0% 3.93sec 2190609 450.91sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender melee 0 4381715 37589 54.12 36421 73354 105.1 105.1 20.1% 0.0% 24.0% 0.0% 4.17sec 4381715 116.57sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.30sec 0 116.57sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague 2944 2323176 5152 2.16 117913 244386 16.2 16.2 19.9% 0.0% 0.0% 0.0% 28.75sec 2323176 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_mastery 124467 888880 1971 5.01 19500 40419 37.7 37.6 19.7% 0.0% 0.0% 0.0% 11.10sec 888880 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_tick ticks -2944 2834759 6299 16.04 19449 40315 16.2 120.3 19.8% 0.0% 0.0% 0.0% 28.75sec 2834759 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 20.0% 0.0% 0.0% 0.0% 43.20sec 0 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_damage 120696 3103632 6883 2.88 118371 244827 10.8 21.6 19.8% 0.0% 0.0% 0.0% 43.20sec 3103632 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_heal 120696 0 0 30.23 0 0 10.8 227.2 23.0% 0.0% 0.0% 0.0% 43.20sec 45657028 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_blast 8092 4460192 9892 5.27 92808 192130 39.6 39.6 19.9% 0.0% 0.0% 0.0% 11.36sec 4460192 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay ticks -15407 4666722 10370 21.08 24321 50401 79.9 158.1 19.9% 0.0% 0.0% 0.0% 5.48sec 4666722 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay_mastery 124468 1463519 3246 6.59 24341 50450 49.6 49.5 19.9% 0.0% 0.0% 0.0% 8.59sec 1463519 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_death 32379 1831046 4061 1.93 103551 214602 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.98sec 1831046 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_insanity 129249 4425905 9816 3.37 143586 297806 25.3 25.3 20.2% 0.0% 0.0% 0.0% 17.08sec 4425905 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain ticks -589 7895615 17546 59.09 14688 30427 81.5 443.1 19.9% 0.0% 0.0% 0.0% 5.51sec 7895615 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain_mastery 124464 2416698 5360 18.44 14379 29778 138.7 138.6 19.9% 0.0% 0.0% 0.0% 3.22sec 2416698 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowy_apparition 87532 2003540 4443 12.17 18239 36687 93.0 91.5 19.9% 0.0% 0.0% 0.0% 4.79sec 2003540 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch ticks -34914 7206673 16015 47.97 16514 34206 59.4 359.8 19.9% 0.0% 0.0% 0.0% 7.49sec 7206673 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch_mastery 124465 2207386 4895 14.99 16161 33477 112.7 112.6 19.9% 0.0% 0.0% 0.0% 3.90sec 2207386 450.91sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend melee 0 1631053 46183 52.96 45646 92146 31.2 31.2 20.2% 0.0% 24.0% 0.0% 12.61sec 1631053 35.32sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.46sec 0 35.32sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague 2944 2319763 5145 2.16 117925 244418 16.2 16.2 19.9% 0.0% 0.0% 0.0% 28.78sec 2319763 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_mastery 124467 890216 1974 5.01 19513 40453 37.7 37.6 19.8% 0.0% 0.0% 0.0% 11.10sec 890216 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_tick ticks -2944 2836414 6303 16.03 19451 40327 16.2 120.2 19.8% 0.0% 0.0% 0.0% 28.78sec 2836414 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.7% 0.0% 0.0% 0.0% 43.20sec 0 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_damage 120696 3099800 6875 2.88 118397 244932 10.8 21.6 19.6% 0.0% 0.0% 0.0% 43.20sec 3099800 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_heal 120696 0 0 30.23 0 0 10.8 227.2 23.0% 0.0% 0.0% 0.0% 43.20sec 45651871 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_blast 8092 4461132 9894 5.27 92804 192346 39.6 39.6 19.9% 0.0% 0.0% 0.0% 11.36sec 4461132 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay ticks -15407 4666368 10370 21.09 24319 50416 79.9 158.2 19.9% 0.0% 0.0% 0.0% 5.48sec 4666368 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay_mastery 124468 1463846 3246 6.58 24341 50466 49.5 49.5 20.1% 0.0% 0.0% 0.0% 8.59sec 1463846 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_death 32379 1831827 4063 1.93 103510 214769 14.5 14.5 20.5% 0.0% 0.0% 0.0% 4.98sec 1831827 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_insanity 129249 4419139 9800 3.37 143605 297742 25.3 25.3 20.0% 0.0% 0.0% 0.0% 17.08sec 4419139 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain ticks -589 8586229 19081 59.08 14687 30382 81.5 443.1 29.9% 0.0% 0.0% 0.0% 5.51sec 8586229 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain_mastery 124464 2627680 5828 18.44 14377 29746 138.7 138.6 29.8% 0.0% 0.0% 0.0% 3.22sec 2627680 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowy_apparition 87532 2510459 5568 15.24 18243 36687 116.5 114.6 19.9% 0.0% 0.0% 0.0% 3.84sec 2510459 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch ticks -34914 7207953 16018 47.96 16515 34215 59.4 359.7 19.9% 0.0% 0.0% 0.0% 7.49sec 7207953 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch_mastery 124465 2205378 4891 14.95 16163 33491 112.5 112.4 20.0% 0.0% 0.0% 0.0% 3.91sec 2205378 450.91sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend melee 0 1631713 46201 52.96 45615 92262 31.2 31.2 20.2% 0.0% 24.1% 0.0% 12.61sec 1631713 35.32sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.47sec 0 35.32sec

enemy1 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-nan,100&chtt=enemy1 DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy1 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.66% 7.66%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.66%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.31% 8.31%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.88% 10.88%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.07% 11.07%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.16% 11.16%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.85% 10.85%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.97% 10.97%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.33% 11.33%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.44% 10.44%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.44%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1581447.85
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data enemy1 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy1 Damage Taken Per Second
Count 49992
Mean 1583026.35
Distribution Chart

HPS

Sample Data enemy1 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy1 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 854715576 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy1"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

enemy2 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-nan,100&chtt=enemy2 DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy2 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.41% 10.41%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.34% 10.34%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.26% 10.26%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.26%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.17% 10.17%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.27% 10.27%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.28% 10.28%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.18% 10.18%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.64% 9.64%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 449810.68
Combat End Resource Mean Min Max
Health 487326.80 0.00 7637696.69
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.91
Minimum 350.94
Maximum 551.50
Spread ( max - min ) 200.57
Range [ ( max - min ) / 2 * 100% ] 22.24%
Distribution Chart

DPS

Sample Data enemy2 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy2 Damage Taken Per Second
Count 49992
Mean 453216.74
Distribution Chart

HPS

Sample Data enemy2 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy2 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 243690484 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy2"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.