
SimulationCraft 504-11

for World of Warcraft 5.0.5 BETA (build level 16030)

Beta Release

Table of Contents

Raid Summary


DPS Chart
Raid Event List
0 movement,players_only=1,first=10,cooldown=10,duration=4

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 4.77 3.14 3.85 - - - 3.14 - 1.95 2.01 1.93 - - - - - - wowhead lootrank
priest_90_di_mb - - - 4.48 2.74 3.61 - - - 2.74 - 1.84 1.80 1.90 - - - - - - wowhead lootrank
priest_90_di_swi - - - 4.33 2.63 3.49 - - - 2.63 - 1.78 1.90 1.91 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 4.66 2.88 3.76 - - - 2.88 - 1.92 1.78 1.86 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 4.34 2.01 3.47 - - - 2.01 - 1.76 3.12 1.76 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 4.15 2.43 3.35 - - - 2.43 - 1.71 2.72 1.79 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 4.74 2.84 3.79 - - - 2.84 - 1.91 1.90 1.78 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 4.38 2.03 3.53 - - - 2.03 - 1.80 4.15 1.71 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 4.18 2.57 3.33 - - - 2.57 - 1.68 2.43 1.81 - - - - - - wowhead lootrank

priest_90_di_fdcl : 127830 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
127830.0 127830.0 18.63 / 0.01% 4946 / 3.9% 20.7 5927.5 5770.9 Mana 0.00% 48.6 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.77 3.14 3.85 3.14 1.95 2.01 1.93
Normalized 1.00 0.66 0.81 0.66 0.41 0.42 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.03 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Haste > Crit = Mastery

Charts,s,333333&chd=t:346128|244627|182045|108906|99865|98168|97552|42994&chds=0,692256&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9&chm=t++346128++devouring_plague,9482C9,0,0,15|t++244627++halo_damage,9482C9,1,0,15|t++182045++vampiric_touch,9482C9,2,0,15|t++108906++shadow_word_pain,9482C9,3,0,15|t++99865++mind_spike,000066,4,0,15|t++98168++shadow_word_death,9482C9,5,0,15|t++97552++mind_blast,9482C9,6,0,15|t++42994++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:18,14,12,12,8,6,6,6,5,4,4,4,3,2,1&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_spike|vampiric_touch|mind_blast|devouring_plague_tick|devouring_plague|halo_damage|shadow_word_pain_mastery|shadowy_apparition|mind_flay|shadowfiend: melee|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.77,3.85,3.14,3.14,2.01,1.95,1.93|4.74,3.82,3.12,3.12,1.98,1.92,1.91|4.80,3.87,3.17,3.17,2.03,1.97,1.96&chds=0,9.54&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.77++Int,FFFFFF,0,0,15,0.1|t++++3.85++SP,FFFFFF,0,1,15,0.1|t++++3.14++Spi,FFFFFF,0,2,15,0.1|t++++3.14++Hit,FFFFFF,0,3,15,0.1|t++++2.01++Haste,FFFFFF,0,4,15,0.1|t++++1.95++Crit,FFFFFF,0,5,15,0.1|t++++1.93++Mastery,FFFFFF,0,6,15,0.1&chtt=priest_90_di_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vxzz02345655767787720ywusronljhggffeeeeeffggggffffffeeeeeefffeddccccccbbbbaaaaZZZZaaabbabbabbbabbbbbcccbbbbbbccccccdddeeeeefffffffeeeeeeddddccccbbaaaaaaaaaaaaaaaaaabbbbbbbccccdddddeffgggghiijjjjiiiiiihhgfffeedddcddddddeeeeeeeeeeeeedddcccccccccccccccccccdddddddddddcccccccbbbaaaZZZZZZZZZZZZZZaaabbccccdddeeeeeeeeeddddcccccbbbbbbbccccdddeeefffgghhhhhhhhhggggggggggggghhhiijjkkkkkkkkkkkkkkjjiiihhhgggggggfffeeeeedddddccccdddddeefffggghhiijjjkkkkllkkkkkkkkjjiiiihhhggggggffffffggggghhhhiiiiiiiiijjiiiiiiihhhhhhhhhhhhhhhhhhhhhhiihiiiiiiiiiiiiiiiijjjjkkllmmnnooppppqqrr&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=127830|max=242011&chxp=1,1,53,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,3,3,16,28,63,143,237,351,578,934,1353,1874,2417,3246,4010,4857,5644,6177,6728,6928,6946,6773,6544,5985,5414,4796,4012,3357,2635,2153,1723,1249,835,675,474,313,191,116,79,55,37,17,13,8,3,3,0,0,1&chds=0,6946&chbh=5&chxt=x&chxl=0:|min=116296|avg=127830|max=142746&chxp=0,1,44,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:26.2,16.9,16.3,15.0,11.0,5.7,3.3,2.8,0.7,0.0,0.0&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=shadow_word_pain 118.2s|mind_spike 76.1s|mind_flay 73.5s|mind_blast 67.6s|vampiric_touch 49.7s|devouring_plague 25.7s|shadow_word_death 14.9s|halo_damage 12.8s|shadowfiend 3.1s|dispersion 0.0s|waiting 0.0s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl 127830
berserking 0 0.0% 3.0 180.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6997 (19710) 5.5% (15.4%) 21.8 21.47sec 407570 346128 119239 247073 144710 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.79 21.79 0.00 0.00 1.1775 0.0000 3153110.73 3153110.73 0.00 346127.78 346127.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.45 80.08% 119239.14 108362 152675 119272.45 109310 128101 2080445 2080445 0.00
crit 4.34 19.92% 247073.14 223226 314511 244893.75 0 314511 1072666 1072666 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3033 2.4% 56.7 7.94sec 24110 0 19867 41204 24132 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.68 56.63 0.00 0.00 0.0000 0.0000 1366556.53 1366556.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.31 80.01% 19866.99 17996 25354 19872.86 18703 21487 900138 900138 0.00
crit 11.32 19.99% 41204.14 37073 52228 41214.08 37073 52228 466419 466419 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9680 7.6% 21.8 21.47sec 200142 0 0 0 0 0.0% 0.0% 0.0% 0.0% 181.2 19825 41089 24068 20.0% 0.0% 29.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.79 21.79 181.19 181.19 0.0000 0.7455 4360933.17 4360933.17 0.00 32286.47 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 145.0 80.05% 19824.96 17996 38985 19829.53 18865 21222 2875335 2875335 0.00
crit 36.2 19.95% 41088.86 37073 80309 41095.28 38142 45444 1485598 1485598 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 6928 5.4% 10.8 43.09sec 289344 244627 119478 248067 145195 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.80 21.51 0.00 0.00 1.1828 0.0000 3123644.10 3123644.10 0.00 244627.15 244627.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.21 80.00% 119477.53 110281 147069 119474.78 110619 130098 2056310 2056310 0.00
crit 4.30 20.00% 248066.70 227179 302962 245506.91 0 302962 1067334 1067334 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 14619 11.4% 56.9 7.94sec 115770 97552 95402 197772 115770 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.92 56.92 0.00 0.00 1.1867 0.0000 6589754.94 6589754.94 0.00 97552.29 97552.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.60 80.10% 95401.92 86871 123035 95423.83 91376 100664 4349933 4349933 0.00
crit 11.33 19.90% 197771.67 178954 253451 197838.65 0 240704 2239822 2239822 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 5344 (7015) 4.2% (5.5%) 51.1 8.43sec 61885 42994 0 0 0 0.0% 0.0% 0.0% 0.0% 78.3 25313 52513 30736 19.9% 0.0% 12.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.06 51.06 78.32 78.32 1.4394 0.7271 2407288.83 2407288.83 0.00 42993.60 42993.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.7 80.06% 25313.10 23066 32499 25318.31 23982 27020 1587339 1587339 0.00
crit 15.6 19.94% 52512.76 47516 66947 52523.88 47516 63856 819950 819950 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 1671 1.3% 24.5 16.75sec 30715 0 25308 52508 30725 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.51 24.50 0.00 0.00 0.0000 0.0000 752697.52 752697.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.62 80.08% 25307.61 23066 32499 25313.21 23066 28936 496495 496495 0.00
crit 4.88 19.92% 52507.82 47516 66947 52027.36 0 66947 256202 256202 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 16854 13.2% 65.1 6.73sec 116706 99865 96173 199382 116706 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.08 65.08 0.00 0.00 1.1686 0.0000 7595201.55 7595201.55 0.00 99864.59 99864.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.13 80.11% 96173.47 87597 124496 96196.58 91510 102244 5013778 5013778 0.00
crit 12.95 19.89% 199381.94 180450 256462 199433.37 0 232281 2581424 2581424 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=6&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3244 2.5% 12.6 5.73sec 116258 98168 95452 198015 116258 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.60 12.60 0.00 0.00 1.1843 0.0000 1465055.50 1465055.50 0.00 98167.75 98167.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.05 79.71% 95452.24 84335 119725 95552.72 85375 111069 958857 958857 0.00
crit 2.56 20.29% 198015.39 173731 246635 185672.53 0 246635 506199 506199 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 21766 (28560) 17.0% (22.4%) 101.2 4.43sec 127208 108906 0 0 0 0.0% 0.0% 0.0% 0.0% 501.2 14832 30695 19577 29.9% 0.0% 196.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.21 101.21 501.24 501.24 1.1680 1.7680 9812519.55 9812519.55 0.00 12818.48 108906.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 351.3 70.09% 14832.49 13527 19055 14835.60 14526 15227 5211091 5211091 0.00
crit 149.9 29.91% 30695.04 27866 39252 30702.10 29742 32015 4601429 4601429 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6794 5.3% 156.8 2.85sec 19531 0 14809 30653 19543 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.81 156.72 0.00 0.00 0.0000 0.0000 3062692.03 3062692.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.90 70.12% 14808.96 13527 19055 14812.40 14364 15451 1627479 1627479 0.00
crit 46.82 29.88% 30653.05 27866 39252 30661.20 29068 33044 1435213 1435213 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 182.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 1.0628 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 5956 4.7% 123.2 3.64sec 21813 0 18466 37169 22188 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.15 121.07 0.00 0.00 0.0000 0.0000 2686287.09 2686287.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.97 80.10% 18465.82 16804 23878 18469.95 17942 19042 1790722 1790722 0.00
crit 24.09 19.90% 37169.03 33607 47756 37180.76 34488 40679 895566 895566 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15318 (20085) 12.0% (15.7%) 40.7 10.98sec 222465 182045 0 0 0 0.0% 0.0% 0.0% 0.0% 340.0 16715 34721 20303 19.9% 0.0% 166.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.69 40.69 340.02 340.02 1.2220 2.2066 6903476.54 6903476.54 0.00 11314.17 182044.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 272.3 80.07% 16714.78 15125 21652 16719.33 16057 17295 4550748 4550748 0.00
crit 67.8 19.93% 34720.59 31158 44604 34731.23 32661 37973 2352729 2352729 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4767 3.7% 106.4 4.15sec 20197 0 16654 34540 20208 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.36 106.30 0.00 0.00 0.0000 0.0000 2148143.27 2148143.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.18 80.13% 16653.71 15125 21652 16658.27 16018 17453 1418503 1418503 0.00
crit 21.12 19.87% 34539.72 31158 44604 34551.39 31596 38764 729641 729641 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 63455 / 4860
melee 63455 3.8% 36.7 10.00sec 59116 65881 51128 103484 59116 21.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.73 36.73 0.00 0.00 0.8973 0.0000 2171373.11 2171373.11 0.00 65881.04 65881.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.18 54.93% 51127.99 38296 61956 51185.85 43032 59028 1031609 1031609 0.00
crit 7.74 21.07% 103483.73 76592 123913 103537.73 0 123913 800689 800689 0.00
glance 8.82 24.00% 38460.54 28722 46467 38494.50 0 46467 339075 339075 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 74.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.76 5.76 0.00 0.00 1.1109 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 6.62% 9.07%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.12%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 30.2 2.7 14.5sec 13.3sec 10.23% 51.53%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:10.2%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.7sec 107.7sec 20.25% 20.25%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.3%
glyph_mind_spike 39.6 25.5 11.1sec 6.7sec 42.80% 56.16%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:27.8%
  • glyph_mind_spike_2:15.0%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_serpent_potion 2.0 0.0 422.0sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.8sec 53.8sec 23.10% 23.31%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.1%
light_of_the_cosmos 9.8 0.0 48.0sec 48.0sec 42.60% 42.60%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.6%
raid_movement 44.6 0.0 10.0sec 10.0sec 39.37% 39.37%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:39.4%
shadow_word_death_reset_cooldown 6.6 0.0 11.5sec 11.5sec 8.44% 47.37%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.4%
surge_of_darkness 52.7 14.2 8.4sec 6.6sec 23.24% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:20.3%
  • surge_of_darkness_2:3.0%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 8.0 0.0 60.7sec 60.7sec 17.44% 17.44%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 5.8 0.0 74.1sec 74.1sec 83.37% 80.17%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.4%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 21.8 65.4 3.0 3.0 135856.6
halo_damage Mana 10.8 485802.9 45000.0 45000.0 6.4
mind_blast Mana 56.9 234521.8 4120.1 4120.1 28.1
mind_flay Mana 51.1 153186.8 3000.0 3000.0 20.6
shadow_word_death Mana 12.6 98293.8 7800.0 7800.0 14.9
shadow_word_pain Mana 101.2 1336026.4 13200.0 13200.0 9.6
vampiric_touch Mana 40.7 366190.9 9000.0 9000.0 24.7
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.98 464605.37 257.55 76587.68 14.15%
dispersion Mana 0.00 61.56 18000.00 0.00 0.00%
shadowfiend Mana 36.73 169415.95 4612.40 161158.73 48.75%
Shadow Orbs from Mind Blast Shadow Orb 56.92 56.92 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.63 6.63 1.00 0.00 0.00%
Devouring Plague Health Health 237.82 0.00 0.00 3302510.67 100.00%
Vampiric Touch Mana Mana 446.32 1969260.65 4412.20 389766.61 16.52%
Resource RPS-Gain RPS-Loss
Mana 5770.85 5927.53
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 229352.75 300.00 300000.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.3%
shadowfiend-Mana Cap 9.3%
lightwell-Mana Cap 9.3%


Count Interval
Shadowy Recall Extra Tick 344.1 1.3sec
Shadowy Apparition Procced 123.2 3.6sec
Divine Insight Mind Blast CD Reset 32.9 13.3sec
FDCL Mind Spike proc 66.9 6.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 451.12
Minimum 341.64
Maximum 563.93
Spread ( max - min ) 222.29
Range [ ( max - min ) / 2 * 100% ] 24.64%


Sample Data
Count 100000
Mean 127829.97
Minimum 116296.19
Maximum 142745.81
Spread ( max - min ) 26449.61
Range [ ( max - min ) / 2 * 100% ] 10.35%
Standard Deviation 3005.2225
5th Percentile 123027.49
95th Percentile 132919.12
( 95th Percentile - 5th Percentile ) 9891.62
Mean Distribution
Standard Deviation 9.5033
95.00% Confidence Intervall ( 127811.34 - 127848.60 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2123
0.1 Scale Factor Error with Delta=300 77096
0.05 Scale Factor Error with Delta=300 308387
0.01 Scale Factor Error with Delta=300 7709690
Distribution Chart


Sample Data
Count 100000
Mean 127829.97


Sample Data
Count 100000
Mean 55427361.34


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 365.22
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 7.95 use_item,name=guardian_serpent_gloves
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 21.79 devouring_plague,if=shadow_orb=3
B 3.01 berserking
C 58.41 mind_blast,if=num_targets<=6&cooldown_react
D 65.08 mind_spike,if=num_targets<=6&buff.surge_of_darkness.react
E 24.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<tick_time)&miss_react
F 12.60 shadow_word_death,if=num_targets<=5
G 44.46 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
H 10.80 halo_damage
I 2.90 shadowfiend,if=cooldown_react
J 0.00 mind_sear,chain=1,interrupt=1,if=num_targets>=3
K 36.00 mind_flay,chain=1,interrupt=1
L 0.00 shadow_word_death,moving=1
M 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N 76.89 shadow_word_pain,moving=1
O 0.00 dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34515 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo







# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_fdcl": Intellect=4.77, Spirit=3.14, SpellDamage=3.85, HitRating=3.14, CritRating=1.95, HasteRating=2.01, MasteryRating=1.93 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_fdcl": Intellect=4.77, Spirit=3.14, SpellDamage=3.85, HitRating=0.00, CritRating=1.95, HasteRating=2.01, MasteryRating=1.93 )
RhadaTip Standard ( RhadaTip: "priest_90_di_fdcl": Intellect=4.77, Spirit=3.14, SpellDamage=3.85, HitRating=3.14, CritRating=1.95, HasteRating=2.01, MasteryRating=1.93 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_fdcl": Intellect=4.77, Spirit=3.14, SpellDamage=3.85, HitRating=0.00, CritRating=1.95, HasteRating=2.01, MasteryRating=1.93 )

priest_90_di_mb : 120661 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
120661.5 120661.5 15.70 / 0.01% 4166 / 3.5% 16.2 6925.8 6848.9 Mana 0.00% 45.4 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.48 2.74 3.61 2.74 1.84 1.80 1.90
Normalized 1.00 0.61 0.81 0.61 0.41 0.40 0.42
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:346263|243623|186682|98253|96699|90202|44593&chds=0,692525&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++346263++devouring_plague,9482C9,0,0,15|t++243623++halo_damage,9482C9,1,0,15|t++186682++vampiric_touch,9482C9,2,0,15|t++98253++shadow_word_death,9482C9,3,0,15|t++96699++mind_blast,9482C9,4,0,15|t++90202++shadow_word_pain,9482C9,5,0,15|t++44593++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:21,15,12,8,8,7,6,6,6,5,5,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|devouring_plague_tick|mindbender: melee|mind_flay|shadow_word_pain_mastery|halo_damage|devouring_plague|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.48,3.61,2.74,2.74,1.90,1.84,1.80|4.46,3.59,2.72,2.72,1.88,1.81,1.78|4.50,3.63,2.76,2.76,1.92,1.86,1.83&chds=0,8.96&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.48++Int,FFFFFF,0,0,15,0.1|t++++3.61++SP,FFFFFF,0,1,15,0.1|t++++2.74++Spi,FFFFFF,0,2,15,0.1|t++++2.74++Hit,FFFFFF,0,3,15,0.1|t++++1.90++Mastery,FFFFFF,0,4,15,0.1|t++++1.84++Crit,FFFFFF,0,5,15,0.1|t++++1.80++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_di_mb Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:yz0002345666777877730zxvutrqomkjhhggfffghhhhhhhhhhggggggggggfeeeefgggggghhghhgggghhhgggfffeddccccccdddcbabcccdcddddeeeeeefgiijjjjjjjkkkkkkkkjjihffeeeeddccbbbbbbbbbddeeeeeeddddeeeefffffeeeefgghhiiiijjjiiiijjjjjjiihhgggfggffffeedddddcccccddddccdddeffgghhiiijjjkkkkkjjiihhgfedccbbbbaaaZZZaaabbccdddeeeffffffffffffffeeeefffgggghhiiiijjjkkklllllkkkkkkjjjjiiihgggggggggggggghhhhijkllllmmmmnmnnnnnnnmmlkkjjjihhgggffffeeeeffffggghhiijjjkkkllmmnnooppqqqqrrrrrrrrqqqqpoonnnmmmllllkkkjjjjjjjjjjjjjjjkkkkkllmmmnnnnoopqqqqqqqqqqqppppoonnmlllllkkkkklllllllmmmnnmmmlmnnoonnnnmnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=120661|max=211049&chxp=1,1,57,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,0,1,4,11,36,62,95,228,355,575,836,1349,1868,2619,3446,4274,5072,6062,6516,7113,7425,7349,7154,6596,5935,5251,4433,3681,2960,2347,1812,1406,971,690,488,330,226,160,114,55,36,22,16,10,1,4,1,2&chds=0,7425&chbh=5&chxt=x&chxl=0:|min=109764|avg=120661|max=133001&chxp=0,1,47,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18,s,333333&chd=t:33.7,23.8,14.3,11.5,5.4,3.6,2.9,2.0,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 152.0s|mind_flay 107.2s|mind_blast 64.3s|vampiric_touch 52.0s|devouring_plague 24.5s|shadow_word_death 16.2s|halo_damage 13.1s|mindbender 8.9s|waiting 0.0s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb 120661
berserking 0 0.0% 3.0 180.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6702 (18867) 5.6% (15.6%) 20.8 22.50sec 407693 346263 119319 247274 144841 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.85 20.85 0.00 0.00 1.1774 0.0000 3019806.18 3019806.18 0.00 346262.71 346262.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.69 80.05% 119319.47 108362 152675 119352.01 109965 129001 1991522 1991522 0.00
crit 4.16 19.95% 247274.08 223226 314511 244604.35 0 314511 1028284 1028284 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2903 2.4% 54.2 8.31sec 24133 0 19882 41240 24156 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.18 54.13 0.00 0.00 0.0000 0.0000 1307591.29 1307591.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.30 79.99% 19882.19 17996 25354 19888.12 18682 21912 860898 860898 0.00
crit 10.83 20.01% 41239.68 37073 52228 41251.56 0 52228 446693 446693 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9262 7.7% 20.8 22.50sec 200136 0 0 0 0 0.0% 0.0% 0.0% 0.0% 173.2 19838 41120 24091 20.0% 0.0% 28.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.85 20.85 173.20 173.20 0.0000 0.7457 4172659.46 4172659.46 0.00 32306.88 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.6 80.02% 19838.20 17996 38815 19842.53 18802 21461 2749427 2749427 0.00
crit 34.6 19.98% 41120.29 37073 79960 41125.38 38154 46103 1423232 1423232 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 7102 5.9% 11.1 41.93sec 289187 243623 119438 247831 145083 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 22.06 0.00 0.00 1.1870 0.0000 3199987.96 3199987.96 0.00 243622.99 243622.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.65 80.03% 119438.08 110281 147069 119502.12 111729 128000 2108164 2108164 0.00
crit 4.41 19.97% 247831.35 227179 302962 245793.17 0 302962 1091824 1091824 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 13800 11.4% 53.7 8.41sec 115757 96699 95418 197791 115757 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.74 53.74 0.00 0.00 1.1971 0.0000 6220757.73 6220757.73 0.00 96699.22 96699.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.06 80.13% 95418.04 86871 123035 95439.52 91547 100987 4109002 4109002 0.00
crit 10.68 19.87% 197791.21 178954 253451 197843.12 0 242490 2111755 2111755 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 8088 (10618) 6.7% (8.8%) 73.1 5.97sec 65433 44593 0 0 0 0.0% 0.0% 0.0% 0.0% 118.8 25261 52395 30658 19.9% 0.0% 19.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.08 73.08 118.83 118.83 1.4673 0.7292 3642900.98 3642900.98 0.00 44593.09 44593.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.2 80.11% 25260.86 23066 32499 25265.55 24316 26442 2404648 2404648 0.00
crit 23.6 19.89% 52395.46 47516 66947 52409.38 47834 57729 1238253 1238253 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2529 2.1% 37.2 11.37sec 30645 0 25259 52381 30655 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.16 0.00 0.00 0.0000 0.0000 1139083.92 1139083.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.77 80.10% 25258.70 23066 32499 25263.55 23660 28243 751825 751825 0.00
crit 7.39 19.90% 52381.26 47516 66947 52345.29 0 66947 387259 387259 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.6 62.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.61 7.61 0.00 0.00 1.1694 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:cooldown_react
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
shadow_word_death 3529 2.9% 13.7 5.32sec 116324 98253 95495 198080 116324 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 13.70 0.00 0.00 1.1839 0.0000 1593180.20 1593180.20 0.00 98253.48 98253.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.92 79.70% 95494.70 84335 119725 95596.92 86255 106933 1042334 1042334 0.00
crit 2.78 20.30% 198080.50 173731 246635 188528.19 0 246635 550846 550846 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 23184 (30421) 19.2% (25.2%) 130.3 3.44sec 105235 90202 0 0 0 0.0% 0.0% 0.0% 0.0% 533.8 14834 30698 19578 29.9% 0.0% 198.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.31 130.31 533.83 533.83 1.1667 1.6731 10451188.39 10451188.39 0.00 13120.56 90202.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 374.2 70.10% 14834.02 13527 19055 14837.13 14575 15196 5550936 5550936 0.00
crit 159.6 29.90% 30697.58 27866 39252 30704.47 29843 31851 4900252 4900252 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 7237 6.0% 167.0 2.68sec 19535 0 14812 30659 19546 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.99 166.89 0.00 0.00 0.0000 0.0000 3262018.10 3262018.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.04 70.13% 14812.46 13527 19055 14815.70 14354 15427 1733622 1733622 0.00
crit 49.85 29.87% 30658.70 27866 39252 30666.50 29061 32570 1528396 1528396 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 6098 5.1% 126.1 3.55sec 21818 0 18470 37180 22188 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.05 123.95 0.00 0.00 0.0000 0.0000 2750246.53 2750246.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.33 80.13% 18469.93 16804 23878 18473.87 18031 19077 1834531 1834531 0.00
crit 24.63 19.87% 37179.71 33607 47756 37190.72 34275 41565 915716 915716 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16438 (21540) 13.6% (17.9%) 43.7 10.26sec 222275 186682 0 0 0 0.0% 0.0% 0.0% 0.0% 364.0 16750 34784 20350 20.0% 0.0% 178.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.68 43.68 364.05 364.05 1.1907 2.2085 7408433.89 7408433.89 0.00 11341.04 186682.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.4 80.04% 16749.80 15125 21652 16754.35 16081 17353 4880453 4880453 0.00
crit 72.7 19.96% 34784.38 31158 44604 34795.17 32871 37069 2527980 2527980 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5103 4.2% 113.9 3.88sec 20188 0 16649 34522 20200 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.91 113.84 0.00 0.00 0.0000 0.0000 2299597.67 2299597.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.22 80.13% 16649.17 15125 21652 16653.69 16028 17455 1518781 1518781 0.00
crit 22.62 19.87% 34521.82 31158 44604 34533.27 31556 38524 780816 780816 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 34862 / 8686
melee 34862 7.2% 106.5 4.00sec 36749 35701 32076 64827 36749 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.51 106.51 0.00 0.00 1.0294 0.0000 3914326.67 3914326.67 0.00 35700.98 35700.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.54 55.90% 32076.18 25642 41546 32078.53 29892 34261 1909820 1909820 0.00
crit 21.41 20.10% 64827.26 51283 83092 64837.27 56559 73142 1387735 1387735 0.00
glance 25.57 24.00% 24122.90 19231 31160 24125.63 21391 26921 616771 616771 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.667000
  • base_dd_min:1398.75
  • base_dd_max:1398.75
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 22.5 19.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.54 22.54 0.00 0.00 1.1782 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 22.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 6.62% 6.98%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.12%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 31.7 3.4 13.8sec 12.5sec 11.72% 55.95%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:11.7%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.7sec 107.7sec 20.25% 20.25%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.3%
jade_serpent_potion 2.0 0.0 422.0sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.8sec 53.8sec 23.12% 23.20%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.1%
light_of_the_cosmos 9.9 0.0 47.8sec 47.8sec 42.81% 42.81%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.8%
raid_movement 44.6 0.0 10.0sec 10.0sec 39.37% 39.37%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:39.4%
shadow_word_death_reset_cooldown 7.0 0.0 11.1sec 11.1sec 8.83% 49.22%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.8%
synapse_springs_2 8.0 0.0 60.7sec 60.7sec 17.44% 17.44%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
mindbender-shadowcrawl 22.5 0.0 19.6sec 19.6sec 85.38% 83.62%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:21.3%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 20.8 62.5 3.0 3.0 135897.7
halo_damage Mana 11.1 497945.3 45000.0 45000.0 6.4
mind_blast Mana 53.7 187186.5 3483.2 3483.2 33.2
mind_flay Mana 73.1 219246.8 3000.0 3000.0 21.8
shadow_word_death Mana 13.7 106829.0 7800.0 7800.0 14.9
shadow_word_pain Mana 130.3 1720088.3 13200.0 13200.0 8.0
vampiric_touch Mana 43.7 393082.6 9000.0 9000.0 24.7
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.98 442945.61 245.54 98247.44 18.15%
mindbender Mana 106.51 656092.63 6159.65 622083.53 48.67%
Shadow Orbs from Mind Blast Shadow Orb 53.74 53.74 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.96 6.96 1.00 0.00 0.00%
Devouring Plague Health Health 227.34 0.00 0.00 3156920.95 100.00%
Vampiric Touch Mana Mana 477.89 1990629.67 4165.45 535189.31 21.19%
Resource RPS-Gain RPS-Loss
Mana 6848.89 6925.83
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 265270.20 18300.00 300000.00
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.2%
shadowfiend-Mana Cap 3.2%
lightwell-Mana Cap 3.2%


Count Interval
Shadowy Recall Extra Tick 372.0 1.2sec
Shadowy Apparition Procced 126.1 3.6sec
Divine Insight Mind Blast CD Reset 35.1 12.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 451.12
Minimum 341.64
Maximum 563.93
Spread ( max - min ) 222.29
Range [ ( max - min ) / 2 * 100% ] 24.64%


Sample Data
Count 100000
Mean 120661.46
Minimum 109763.96
Maximum 133001.41
Spread ( max - min ) 23237.45
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 2533.7834
5th Percentile 116645.77
95th Percentile 124977.68
( 95th Percentile - 5th Percentile ) 8331.91
Mean Distribution
Standard Deviation 8.0125
95.00% Confidence Intervall ( 120645.76 - 120677.16 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1693
0.1 Scale Factor Error with Delta=300 54805
0.05 Scale Factor Error with Delta=300 219221
0.01 Scale Factor Error with Delta=300 5480531
Distribution Chart


Sample Data
Count 100000
Mean 120661.46


Sample Data
Count 100000
Mean 50467452.29


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 341.60
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 7.95 use_item,name=guardian_serpent_gloves
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 20.85 devouring_plague,if=shadow_orb=3
B 3.01 berserking
C 56.44 mind_blast,if=num_targets<=6&cooldown_react
D 23.11 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<tick_time)&miss_react
E 13.70 shadow_word_death,if=num_targets<=5
F 45.66 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
G 11.07 halo_damage
H 7.61 mindbender,if=cooldown_react
I 0.00 mind_sear,chain=1,interrupt=1,if=num_targets>=3
J 44.01 mind_flay,chain=1,interrupt=1
K 0.00 shadow_word_death,moving=1
L 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
M 107.20 shadow_word_pain,moving=1
N 0.00 dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34515 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo







# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_mb": Intellect=4.48, Spirit=2.74, SpellDamage=3.61, HitRating=2.74, CritRating=1.84, HasteRating=1.80, MasteryRating=1.90 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_mb": Intellect=4.48, Spirit=2.74, SpellDamage=3.61, HitRating=0.00, CritRating=1.84, HasteRating=1.80, MasteryRating=1.90 )
RhadaTip Standard ( RhadaTip: "priest_90_di_mb": Intellect=4.48, Spirit=2.74, SpellDamage=3.61, HitRating=2.74, CritRating=1.84, HasteRating=1.80, MasteryRating=1.90 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_mb": Intellect=4.48, Spirit=2.74, SpellDamage=3.61, HitRating=0.00, CritRating=1.84, HasteRating=1.80, MasteryRating=1.90 )

priest_90_di_swi : 116366 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
116366.0 116366.0 16.42 / 0.01% 4360 / 3.7% 15.8 7061.0 6858.2 Mana 0.00% 45.5 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.33 2.63 3.49 2.63 1.78 1.90 1.91
Normalized 1.00 0.61 0.81 0.61 0.41 0.44 0.44
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery = Haste > Crit

Charts,s,333333&chd=t:346330|242704|186547|143085|98125|96666|86062|44362&chds=0,692659&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++346330++devouring_plague,9482C9,0,0,15|t++242704++halo_damage,9482C9,1,0,15|t++186547++vampiric_touch,9482C9,2,0,15|t++143085++shadow_word_insanity,9482C9,3,0,15|t++98125++shadow_word_death,9482C9,4,0,15|t++96666++mind_blast,9482C9,5,0,15|t++86062++shadow_word_pain,9482C9,6,0,15|t++44362++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:21,15,12,8,7,6,6,6,5,5,4,3,3,2,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|devouring_plague_tick|mind_flay|shadow_word_pain_mastery|halo_damage|devouring_plague|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|devouring_plague_mastery|mind_flay_mastery|shadow_word_insanity&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.33,3.49,2.63,2.63,1.91,1.90,1.78|4.30,3.46,2.60,2.60,1.89,1.88,1.76|4.35,3.51,2.65,2.65,1.94,1.92,1.80&chds=0,8.66&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.33++Int,FFFFFF,0,0,15,0.1|t++++3.49++SP,FFFFFF,0,1,15,0.1|t++++2.63++Spi,FFFFFF,0,2,15,0.1|t++++2.63++Hit,FFFFFF,0,3,15,0.1|t++++1.91++Mastery,FFFFFF,0,4,15,0.1|t++++1.90++Haste,FFFFFF,0,5,15,0.1|t++++1.78++Crit,FFFFFF,0,6,15,0.1&chtt=priest_90_di_swi Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:y0111345777687777772zxvtrqnmkhgfeeddddddeefffffeeeeeeeddddeeddcbabbbbbaaaaZZZZZZZZaaabbbbbaaaaaabbbbbbbaaaaabbbbccccddddddeffgffffeeeeddddcccbbaZZZZZZZZZZYZZZZZZZZabcccccccccccccddeffgfggghiiiiiiiiiihhgfffffeeeddcccddddeddddddccccbbbbbbbbbbbbbbbcccddddddddddddddcccbbaaaZZYYYYYYYYYYYYYZZZZaabbcccccdddddddddddccbbaaaaaaaaaaaabbbccddeffggghhhhhhhhhhhhggfeeeeeeeeefgghiijkklmnnnnnnnnmmlkkkjjihhgfeeeeeeedddddddddccdddeeeeffffgghhhhiiiiiiiijjjjjjjjjjjjjjjjjjkjjjjjjjjijiiiiiiihhhhhhhhhhhghhhhiiiiiijjjjjjjjjjkkkkjjjjjjjiiiiiiihhhhhhhhhhhhiiijjjkklmnnnoopqrrssstttuuu&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=116366|max=222517&chxp=1,1,52,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,0,0,0,1,1,1,1,0,6,6,18,40,101,211,406,724,1314,2162,3196,4459,5619,6942,8098,8977,8965,8952,8257,7265,6194,5070,4021,2869,2154,1531,965,599,376,241,115,69,36,17,10,3,3,2,2&chds=0,8977&chbh=5&chxt=x&chxl=0:|min=99515|avg=116366|max=129610&chxp=0,1,56,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18,s,333333&chd=t:34.8,23.9,14.1,11.5,5.4,3.5,2.9,0.7,0.2,0.0,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=shadow_word_pain 157.0s|mind_flay 108.0s|mind_blast 63.8s|vampiric_touch 51.9s|devouring_plague 24.3s|shadow_word_death 16.0s|halo_damage 13.2s|shadowfiend 3.0s|shadow_word_insanity 0.9s|dispersion 0.0s|waiting 0.0s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi 116366
berserking 0 0.0% 3.0 180.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6643 (18704) 5.7% (16.1%) 20.7 22.71sec 407664 346330 119306 247186 144816 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.67 20.67 0.00 0.00 1.1771 0.0000 2993280.40 2993280.40 0.00 346329.55 346329.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.55 80.05% 119306.18 108362 152675 119339.14 110697 129098 1974065 1974065 0.00
crit 4.12 19.95% 247185.55 223226 314511 244397.84 0 314511 1019215 1019215 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2879 2.5% 53.7 8.37sec 24132 0 19880 41241 24154 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.75 53.70 0.00 0.00 0.0000 0.0000 1296994.98 1296994.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.95 79.99% 19880.32 17996 25354 19886.49 18612 21431 853896 853896 0.00
crit 10.74 20.01% 41240.83 37073 52228 41249.01 0 52228 443099 443099 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9181 7.9% 20.7 22.71sec 200098 0 0 0 0 0.0% 0.0% 0.0% 0.0% 171.8 19833 41109 24077 19.9% 0.0% 28.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.67 20.67 171.78 171.78 0.0000 0.7454 4135922.58 4135922.58 0.00 32301.04 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.5 80.06% 19833.43 17996 40640 19837.73 18759 21326 2727481 2727481 0.00
crit 34.3 19.94% 41109.20 37073 83718 41114.09 37818 50575 1408442 1408442 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 7089 6.1% 11.1 41.86sec 288193 242704 119125 247227 144619 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.08 22.09 0.00 0.00 1.1874 0.0000 3194222.29 3194222.29 0.00 242703.62 242703.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.69 80.10% 119124.89 110281 147069 119190.97 110957 128056 2107498 2107498 0.00
crit 4.40 19.90% 247226.65 227179 302962 245155.86 0 302962 1086724 1086724 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 13683 11.8% 53.3 8.49sec 115773 96666 95418 197767 115773 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.28 53.28 0.00 0.00 1.1977 0.0000 6167880.05 6167880.05 0.00 96666.15 96666.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.68 80.11% 95417.60 86871 123035 95439.05 91393 100292 4072395 4072395 0.00
crit 10.60 19.89% 197767.35 178954 253451 197823.82 0 235228 2095486 2095486 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 8102 (10637) 7.0% (9.1%) 73.8 5.92sec 64973 44362 0 0 0 0.0% 0.0% 0.0% 0.0% 118.9 25291 52457 30691 19.9% 0.0% 19.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.76 73.76 118.95 118.95 1.4646 0.7319 3650661.28 3650661.28 0.00 44362.19 44362.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.3 80.12% 25291.05 23066 32499 25295.69 24382 26422 2410390 2410390 0.00
crit 23.6 19.88% 52457.45 47516 66947 52470.59 48172 58307 1240271 1240271 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2534 2.2% 37.2 11.37sec 30679 0 25287 52441 30689 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.22 37.20 0.00 0.00 0.0000 0.0000 1141785.69 1141785.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.80 80.10% 25286.75 23066 32499 25291.47 23572 27591 753611 753611 0.00
crit 7.40 19.90% 52440.62 47516 66947 52408.11 0 66947 388175 388175 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3478 3.0% 13.5 5.39sec 116205 98125 95452 198012 116205 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.51 13.51 0.00 0.00 1.1843 0.0000 1569810.51 1569810.51 0.00 98125.42 98125.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.78 79.76% 95451.83 84335 119725 95549.46 86314 110115 1028529 1028529 0.00
crit 2.73 20.24% 198012.02 173731 246635 187834.45 0 246635 541282 541282 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 271 0.2% 0.7 136.19sec 171323 143085 141095 292082 171323 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.71 0.71 0.00 0.00 1.1974 0.0000 122480.75 122480.75 0.00 143084.99 143084.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.57 79.98% 141094.68 125225 177942 67223.58 0 177942 80675 80675 0.00
crit 0.14 20.02% 292081.59 257963 366561 39948.19 0 366561 41806 41806 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=5
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:(null)
  • description:Consumes your Shadow Word: Pain to deal $s1 Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.430000
  • base_dd_min:2481.02
  • base_dd_max:2618.71
shadow_word_pain 22842 (29978) 19.6% (25.8%) 134.5 3.33sec 100494 86062 0 0 0 0.0% 0.0% 0.0% 0.0% 526.4 14822 30676 19561 29.9% 0.0% 193.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.48 134.48 526.43 526.43 1.1677 1.6579 10297445.11 10297445.11 0.00 13122.91 86061.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 369.1 70.11% 14821.68 13527 19055 14824.39 14544 15177 5470120 5470120 0.00
crit 157.4 29.89% 30675.75 27866 39252 30681.76 29797 31841 4827325 4827325 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|ticks_remain<1)&miss_react
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 7136 6.1% 164.6 2.71sec 19537 0 14814 30663 19549 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.65 164.55 0.00 0.00 0.0000 0.0000 3216792.93 3216792.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.39 70.13% 14814.42 13527 19055 14817.70 14345 15424 1709469 1709469 0.00
crit 49.16 29.87% 30663.37 27866 39252 30671.35 29126 32901 1507324 1507324 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 1.0417 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 6066 5.2% 125.4 3.57sec 21824 0 18472 37182 22194 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.37 123.28 0.00 0.00 0.0000 0.0000 2736112.16 2736112.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.76 80.11% 18472.39 16804 23878 18476.35 18010 19041 1824360 1824360 0.00
crit 24.52 19.89% 37181.86 33607 47756 37192.40 34548 40674 911752 911752 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16402 (21497) 14.1% (18.5%) 43.6 10.27sec 222249 186547 0 0 0 0.0% 0.0% 0.0% 0.0% 363.6 16736 34754 20331 20.0% 0.0% 177.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.59 43.59 363.59 363.59 1.1914 2.2077 7392153.71 7392153.71 0.00 11337.01 186547.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.0 80.05% 16736.00 15125 21652 16740.55 16099 17510 4870908 4870908 0.00
crit 72.5 19.95% 34754.17 31158 44604 34765.20 32842 37135 2521246 2521246 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5096 4.4% 113.7 3.88sec 20191 0 16649 34523 20203 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.75 113.68 0.00 0.00 0.0000 0.0000 2296726.29 2296726.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.07 80.11% 16648.65 15125 21652 16653.14 16042 17436 1516213 1516213 0.00
crit 22.61 19.89% 34522.63 31158 44604 34534.11 31644 38030 780513 780513 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 64280 / 4964
melee 64280 4.2% 37.5 9.85sec 59173 66380 51160 103549 59173 21.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.45 37.45 0.00 0.00 0.8914 0.0000 2216278.76 2216278.76 0.00 66379.50 66379.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.56 54.89% 51160.20 38296 61956 51211.86 44083 57223 1051700 1051700 0.00
crit 7.90 21.10% 103549.28 76592 123913 103615.88 0 123913 818369 818369 0.00
glance 8.99 24.01% 38492.88 28722 46467 38523.97 0 46467 346210 346210 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 73.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.80 5.80 0.00 0.00 1.1007 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 6.62% 9.31%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.49%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 31.2 3.3 14.0sec 12.6sec 11.60% 55.54%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:11.6%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.6sec 107.6sec 20.26% 20.26%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.3%
jade_serpent_potion 2.0 0.0 422.0sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.8sec 53.8sec 23.12% 23.32%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.1%
light_of_the_cosmos 9.9 0.0 47.8sec 47.8sec 42.78% 42.78%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.8%
raid_movement 44.6 0.0 10.0sec 10.0sec 39.37% 39.37%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:39.4%
shadow_word_death_reset_cooldown 6.9 0.0 11.2sec 11.2sec 8.74% 49.07%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.7%
synapse_springs_2 8.0 0.0 60.7sec 60.7sec 17.44% 17.44%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 5.8 0.0 73.8sec 73.8sec 83.37% 80.14%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.4%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 20.7 62.0 3.0 3.0 135887.9
halo_damage Mana 11.1 498762.5 45000.0 45000.0 6.4
mind_blast Mana 53.3 187142.5 3512.7 3512.7 33.0
mind_flay Mana 73.8 221281.3 3000.0 3000.0 21.7
shadow_word_death Mana 13.5 105369.8 7800.0 7800.0 14.9
shadow_word_insanity Mana 0.7 5361.8 7500.0 7500.0 22.8
shadow_word_pain Mana 134.5 1775102.2 13200.0 13200.0 7.6
vampiric_touch Mana 43.6 392352.0 9000.0 9000.0 24.7
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.98 511846.82 283.73 29346.23 5.42%
dispersion Mana 0.01 200.16 18000.00 0.00 0.00%
shadowfiend Mana 37.45 224701.21 5999.34 112387.58 33.34%
Shadow Orbs from Mind Blast Shadow Orb 53.28 53.28 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.88 6.88 1.00 0.00 0.00%
Devouring Plague Health Health 225.48 0.00 0.00 3131101.86 100.00%
Vampiric Touch Mana Mana 477.27 2357118.91 4938.77 165454.46 6.56%
Resource RPS-Gain RPS-Loss
Mana 6858.20 7061.04
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 208560.20 0.00 300000.00
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.3%
shadowfiend-Mana Cap 3.3%
lightwell-Mana Cap 3.3%


Count Interval
Shadowy Recall Extra Tick 369.1 1.2sec
Shadowy Apparition Procced 125.4 3.6sec
Divine Insight Mind Blast CD Reset 34.6 12.6sec
Shadow Word: Insanity removed DoTs 0.7 115.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 451.12
Minimum 341.64
Maximum 563.93
Spread ( max - min ) 222.29
Range [ ( max - min ) / 2 * 100% ] 24.64%


Sample Data
Count 100000
Mean 116366.04
Minimum 99515.38
Maximum 129609.74
Spread ( max - min ) 30094.36
Range [ ( max - min ) / 2 * 100% ] 12.93%
Standard Deviation 2648.9712
5th Percentile 112156.28
95th Percentile 120875.57
( 95th Percentile - 5th Percentile ) 8719.29
Mean Distribution
Standard Deviation 8.3768
95.00% Confidence Intervall ( 116349.62 - 116382.46 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1990
0.1 Scale Factor Error with Delta=300 59901
0.05 Scale Factor Error with Delta=300 239606
0.01 Scale Factor Error with Delta=300 5990155
Distribution Chart


Sample Data
Count 100000
Mean 116366.04


Sample Data
Count 100000
Mean 50212268.75


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 341.92
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 7.95 use_item,name=guardian_serpent_gloves
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 20.67 devouring_plague,if=shadow_orb=3
B 0.71 shadow_word_insanity,if=num_targets<=5
C 3.01 berserking
D 56.06 mind_blast,if=num_targets<=6&cooldown_react
E 22.38 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=(!ticking|ticks_remain<1)&miss_react
F 13.51 shadow_word_death,if=num_targets<=5
G 45.60 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
H 11.08 halo_damage
I 2.92 shadowfiend,if=cooldown_react
J 0.00 mind_sear,chain=1,interrupt=1,if=num_targets>=3
K 44.92 mind_flay,chain=1,interrupt=1
L 0.00 shadow_word_death,moving=1
M 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N 112.09 shadow_word_pain,moving=1
O 0.00 dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34515 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo







# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_swi": Intellect=4.33, Spirit=2.63, SpellDamage=3.49, HitRating=2.63, CritRating=1.78, HasteRating=1.90, MasteryRating=1.91 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_swi": Intellect=4.33, Spirit=2.63, SpellDamage=3.49, HitRating=0.00, CritRating=1.78, HasteRating=1.90, MasteryRating=1.91 )
RhadaTip Standard ( RhadaTip: "priest_90_di_swi": Intellect=4.33, Spirit=2.63, SpellDamage=3.49, HitRating=2.63, CritRating=1.78, HasteRating=1.90, MasteryRating=1.91 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_swi": Intellect=4.33, Spirit=2.63, SpellDamage=3.49, HitRating=0.00, CritRating=1.78, HasteRating=1.90, MasteryRating=1.91 )

priest_90_pi_fdcl : 124453 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
124453.2 124453.2 17.36 / 0.01% 4567 / 3.7% 18.1 6586.9 6343.3 Mana 0.01% 49.6 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.66 2.88 3.76 2.88 1.92 1.78 1.86
Normalized 1.00 0.62 0.81 0.62 0.41 0.38 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery > Haste

Charts,s,333333&chd=t:343450|248896|188779|101383|101023|99905|99349|43606&chds=0,686901&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9&chm=t++343450++devouring_plague,9482C9,0,0,15|t++248896++halo_damage,9482C9,1,0,15|t++188779++vampiric_touch,9482C9,2,0,15|t++101383++mind_spike,000066,3,0,15|t++101023++shadow_word_pain,9482C9,4,0,15|t++99905++shadow_word_death,9482C9,5,0,15|t++99349++mind_blast,9482C9,6,0,15|t++43606++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:19,14,13,10,7,6,6,5,5,5,4,4,3,2,1&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_spike|vampiric_touch|mind_blast|devouring_plague_tick|shadow_word_pain_mastery|halo_damage|shadowy_apparition|devouring_plague|mind_flay|shadowfiend: melee|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.66,3.76,2.88,2.88,1.92,1.86,1.78|4.63,3.74,2.85,2.85,1.89,1.84,1.76|4.68,3.79,2.90,2.90,1.94,1.88,1.81&chds=0,9.32&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.66++Int,FFFFFF,0,0,15,0.1|t++++3.76++SP,FFFFFF,0,1,15,0.1|t++++2.88++Spi,FFFFFF,0,2,15,0.1|t++++2.88++Hit,FFFFFF,0,3,15,0.1|t++++1.92++Crit,FFFFFF,0,4,15,0.1|t++++1.86++Mastery,FFFFFF,0,5,15,0.1|t++++1.78++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_pi_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:yz111344554465678771ywusqqnlkigffedcbbbbbccccddddeeeeeeeeeeeedcbbbbaZZZYYXXYYYYYYZababbaaaZZZZZaZZZZZZZYXYZZabbbcccdddddddefghgfffffeeefffffeffedcbbaaZZZZYZZYYYYYXYYaaabbbccccdccccddeeefeeffgggffgggggggffefedcccbbccccbbccbbbbcccccccccbcbbbbbbbccdcccdddeefffggffffffeddccbaaZYYYXXXXXWWWXXYYYZZabbccccccccccddcccbbbaZaaaaaaaaaabaaabbbbcceedeeeefffggggggggfffeeeeefffghhijjkllmmnnnnnnnnnmmlkjihhgfffeeeedddcccccccccccbcccccccdddfffffggghhiiiijjjjjijiiiiiiihhhhhgggffffgfffffffffgggggghhhhiiijjjkkkkllkkkkkkkkkjjjiiiiihihhhhhhhhggggggggggghgggghhhiijjkklmnooopppqqrrs&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=124453|max=241665&chxp=1,1,51,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,1,0,0,0,2,0,0,0,2,3,1,1,5,10,6,15,30,34,61,88,200,402,837,1711,2871,4582,6664,8530,10359,11209,11034,10292,8807,7159,5355,3712,2434,1601,951,510,285,133,63,26,6,2,3,1&chds=0,11209&chbh=5&chxt=x&chxl=0:|min=99333|avg=124453|max=138208&chxp=0,1,65,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:29.9,17.1,16.4,11.7,10.9,4.7,3.4,2.8,0.7,0.0,0.0&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=shadow_word_pain 135.0s|mind_spike 77.0s|mind_flay 73.9s|mind_blast 52.7s|vampiric_touch 49.2s|devouring_plague 21.2s|shadow_word_death 15.3s|halo_damage 12.7s|shadowfiend 3.0s|dispersion 0.1s|waiting 0.1s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl 124453
berserking 0 0.0% 3.0 180.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5737 (16118) 4.6% (13.0%) 18.0 26.17sec 403213 343450 118404 245167 143546 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.02 18.02 0.00 0.00 1.1740 0.0000 2586022.12 2586022.12 0.00 343450.36 343450.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.44 80.17% 118403.78 108362 152675 118432.46 110857 127594 1709990 1709990 0.00
crit 3.57 19.83% 245166.78 223226 314511 240030.46 0 314511 876032 876032 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2487 2.0% 46.7 9.66sec 23995 0 19783 41028 24020 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.70 46.65 0.00 0.00 0.0000 0.0000 1120477.47 1120477.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.34 80.06% 19783.38 17996 25354 19790.03 18647 21235 738800 738800 0.00
crit 9.30 19.94% 41027.66 37073 52228 41036.25 0 52228 381677 381677 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7894 6.3% 18.0 26.17sec 197470 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.3 19655 40701 23831 19.8% 0.0% 24.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.02 18.02 149.28 149.28 0.0000 0.7464 3557475.59 3557475.59 0.00 31926.51 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.7 80.16% 19655.16 17996 25354 19659.33 18831 20725 2352052 2352052 0.00
crit 29.6 19.84% 40701.03 37073 52228 40708.17 37680 45591 1205423 1205423 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 6995 5.6% 10.9 42.63sec 289277 248896 119466 247954 145133 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.90 21.72 0.00 0.00 1.1622 0.0000 3153017.98 3153017.98 0.00 248896.27 248896.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.39 80.02% 119466.49 110281 147069 119493.74 110281 129244 2076949 2076949 0.00
crit 4.34 19.98% 247954.19 227179 302962 245868.37 0 302962 1076069 1076069 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 11614 9.3% 45.3 10.02sec 115565 99349 95263 197451 115565 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.32 45.32 0.00 0.00 1.1632 0.0000 5237082.26 5237082.26 0.00 99348.98 99348.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.31 80.13% 95262.60 86871 123035 95281.93 91055 98707 3459347 3459347 0.00
crit 9.00 19.87% 197450.67 178954 253451 197497.40 0 242490 1777735 1777735 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 5451 (7155) 4.4% (5.7%) 54.3 7.98sec 59406 43606 0 0 0 0.0% 0.0% 0.0% 0.0% 79.5 25429 52778 30885 20.0% 0.0% 12.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.26 54.26 79.52 79.52 1.3623 0.6999 2455949.29 2455949.29 0.00 43605.98 43605.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.7 80.05% 25429.01 23066 32499 25435.79 24160 27033 1618667 1618667 0.00
crit 15.9 19.95% 52777.91 47516 66947 52792.63 47516 63644 837282 837282 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 1704 1.4% 24.9 16.71sec 30867 0 25420 52762 30879 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.87 24.86 0.00 0.00 0.0000 0.0000 767666.36 767666.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.90 80.03% 25419.73 23066 32499 25426.32 23182 28336 505755 505755 0.00
crit 4.96 19.97% 52761.50 47516 66947 52361.13 0 66947 261911 261911 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 17314 13.9% 66.8 6.57sec 116845 101383 96287 199621 116845 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.79 66.79 0.00 0.00 1.1525 0.0000 7803767.97 7803767.97 0.00 101383.19 101383.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.50 80.11% 96287.31 87597 124496 96310.93 91228 102877 5151428 5151428 0.00
crit 13.29 19.89% 199620.53 180450 256462 199683.26 180450 235215 2652340 2652340 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=6&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.26 4.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the Priest with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
shadow_word_death 3383 2.7% 13.1 5.50sec 116224 99905 95457 198024 116224 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.15 13.15 0.00 0.00 1.1633 0.0000 1527954.05 1527954.05 0.00 99905.46 99905.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.48 79.75% 95457.20 84335 119725 95551.20 85635 108467 1000853 1000853 0.00
crit 2.66 20.25% 198024.48 173731 246635 187058.06 0 246635 527102 527102 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:num_targets<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 23049 (30242) 18.5% (24.3%) 116.8 3.84sec 116716 101023 0 0 0 0.0% 0.0% 0.0% 0.0% 530.2 14848 30729 19600 29.9% 0.0% 196.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.81 116.81 530.16 530.16 1.1553 1.6758 10391046.69 10391046.69 0.00 13321.38 101022.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 371.5 70.08% 14848.10 13527 19055 14850.95 14549 15226 5516595 5516595 0.00
crit 158.6 29.92% 30729.24 27866 39252 30735.62 29877 31916 4874451 4874451 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 7193 5.8% 165.8 2.70sec 19551 0 14822 30686 19562 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.84 165.74 0.00 0.00 0.0000 0.0000 3242186.78 3242186.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.22 70.12% 14822.47 13527 19055 14826.04 14355 15403 1722620 1722620 0.00
crit 49.52 29.88% 30685.78 27866 39252 30694.04 29222 32962 1519566 1519566 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 1.0393 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 6088 4.9% 125.8 3.56sec 21820 0 18471 37185 22195 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.84 123.72 0.00 0.00 0.0000 0.0000 2745832.02 2745832.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.10 80.10% 18470.92 16804 23878 18475.03 18025 19051 1830485 1830485 0.00
crit 24.62 19.90% 37185.22 33607 47756 37196.73 34236 40678 915347 915347 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15715 (20602) 12.6% (16.6%) 40.6 11.00sec 228432 188779 0 0 0 0.0% 0.0% 0.0% 0.0% 347.9 16753 34809 20357 20.0% 0.0% 165.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.65 40.65 347.91 347.91 1.2100 2.1429 7082430.34 7082430.34 0.00 11683.13 188778.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.4 80.04% 16752.63 15125 21652 16757.57 16155 17469 4664763 4664763 0.00
crit 69.5 19.96% 34808.60 31158 44604 34820.70 32737 37505 2417668 2417668 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4887 3.9% 108.8 4.06sec 20233 0 16676 34593 20244 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.85 108.79 0.00 0.00 0.0000 0.0000 2202284.04 2202284.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.12 80.08% 16675.73 15125 21652 16680.34 16027 17472 1452795 1452795 0.00
crit 21.67 19.92% 34593.45 31158 44604 34603.66 31517 38501 749489 749489 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 64169 / 4942
melee 64169 3.9% 37.3 9.88sec 59120 66403 51108 103514 59120 21.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.33 37.33 0.00 0.00 0.8903 0.0000 2207220.10 2207220.10 0.00 66402.53 66402.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.50 54.91% 51107.65 38296 61956 51161.52 44931 58020 1047712 1047712 0.00
crit 7.87 21.08% 103513.62 76592 123913 103585.52 0 123913 814643 814643 0.00
glance 8.96 24.01% 38470.40 28722 46467 38507.57 0 46467 344865 344865 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 73.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.79 5.79 0.00 0.00 1.0728 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean M