close

SimulationCraft 530-8

for World of Warcraft 5.4.0 PTR (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 movement,players_only=1,first=10,cooldown=10,duration=4
1 adds,count=3,first=45,cooldown=45,duration=10

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 6.64 - 5.09 - - - 7.57 - 4.52 -3.21 6.80 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 5.78 - 4.43 - - - 5.54 - 3.73 -9.30 4.66 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 5.55 - 4.18 - - - 5.40 - 3.69 -7.64 4.54 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 7.03 - 5.20 - - - 6.96 - 4.43 0.14 5.44 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 6.45 - 4.99 - - - 5.89 - 4.42 -0.23 4.42 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 6.30 - 4.50 - - - 5.58 - 4.03 -1.32 4.18 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 5.93 - 4.58 - - - 6.73 - 4.07 1.67 5.33 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 5.37 - 3.82 - - - 6.14 - 3.54 -2.08 3.74 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 5.10 - 3.93 - - - 5.59 - 3.29 -1.07 3.76 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 268956 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
268956.0 268956.0 300.05 / 0.11% 39416 / 14.7% 45.9 5631.9 5036.9 Mana 8.82% 68.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.64 5.09 7.57 4.52 -3.21 6.80
Normalized 1.00 0.77 1.14 0.68 -0.48 1.02
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.42 0.42 0.43 0.42 0.41 0.43
Gear Ranking
Optimizers
Ranking
  • Hit > Mastery ~= Int > SP > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=6.64, SpellDamage=5.09, HitRating=7.57, CritRating=4.52, HasteRating=-3.21, MasteryRating=6.80 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=6.64, SpellDamage=5.09, HitRating=0.00, CritRating=4.52, HasteRating=-3.21, MasteryRating=6.80 )

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:891968|411145|364730|255439|241872|214132|186973|121803|85262&chds=0,1783936&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++891968++devouring_plague,9482C9,0,0,15|t++411145++halo,9482C9,1,0,15|t++364730++vampiric_touch,9482C9,2,0,15|t++255439++shadow_word_death,9482C9,3,0,15|t++241872++shadow_word_pain,9482C9,4,0,15|t++214132++mind_blast,9482C9,5,0,15|t++186973++mind_spike,4A79D3,6,0,15|t++121803++mind_flay,9482C9,7,0,15|t++85262++mind_sear,9482C9,8,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,8,8,7,7,7,4,4,4,4,4,3,3,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,7BC29D,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,336600,9482C9&chl=shadow_word_pain|mind_blast|essence_of_yulon|mind_spike|shadow_word_pain_mastery|vampiric_touch|devouring_plague_tick|mind_flay|devouring_plague|vampiric_touch_mastery|devouring_plague_mastery|multistrike_spell|shadow_word_death|shadowfiend: melee|mind_flay_mastery|halo_damage|shadowy_apparition|stormlash|mind_sear|shadowfiend: stormlash|mind_sear_mastery&
http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.57,6.80,6.64,5.09,4.52,-3.21|7.14,6.37,6.22,4.67,4.10,-3.62|8.00,7.22,7.06,5.52,4.94,-2.81&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.57++Hit,FFFFFF,0,0,15,0.1,e|t++++6.80++Mastery,FFFFFF,0,1,15,0.1,e|t++++6.64++Int,FFFFFF,0,2,15,0.1,e|t++++5.09++SP,FFFFFF,0,3,15,0.1,e|t++++4.52++Crit,FFFFFF,0,4,15,0.1,e|t++++-3.21++Haste,FFFFFF,0,5,15,0.1,s&chds=-3.631,9.095& http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fjloquxz1457676765210zyywvttttssrrrqpponqtvxyyyxxwwwvvuuttssoligeeeeeeeeeddddddddddghhiijllmmnnnnnnnnnnkkjjihffeedddddddeeeeeffffgiknpqrrrrrrrrsssssssqnljhhhgggggggggffffeffghjklnprstuuvvvvvvvuusrqonkjhgffeeeeeeeeeeeeeeefhjlmmmmmmmmmmmlmlllkigeddccccdcdddddddddddefghhikkklllllllllmlkjjihgffeedddddddddddddeeeeffghiiiihhhhhhhggggfedcbaaaaaaZZZZZYYYYYYYZabcefhklnprrstuuvvwvvutsrqonmlkjjjjjjjjjjjjjjjkklmnooooooooooonnnmmlkjhggffffeeeedddddddddddeeeeffffffffeeeeeeddcbbaaZZZZZZZYYYYYXXXYYYZZZZaaaaaabbbbbbbbaaZYYXXXWWWWWVVVUUTTUUTTUUVXYZbcegiloqstuvwwxyxxxxwwvutrponmlmmmmmmlkjihggjklmnonljhfdbaZXW&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6066,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=268956|max=443355&chxp=1,1,61,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,5,2,7,7,18,24,31,46,48,78,110,167,206,276,324,341,452,531,614,671,735,851,957,1018,1049,1174,1202,1220,1336,1400,1452,1394,1407,1357,1179,991,715,547,422,265,161,100,50,32,12,3,2,1&chds=0,1452&chbh=5&chxt=x&chxl=0:|min=167487|avg=268956|max=339918&chxp=0,1,59,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:23.7,21.6,12.2,11.6,7.9,4.5,3.6,2.0,1.0,0.7,0.0,8.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 107.5s|mind_flay 97.8s|mind_blast 55.4s|mind_spike 52.7s|vampiric_touch 35.9s|devouring_plague 20.3s|shadow_word_death 16.3s|halo 9.2s|dispersion 4.5s|shadowfiend 3.2s|mind_sear 0.2s|waiting 40.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 268956
devouring_plague 11414 (40039) 4.2% (14.9%) 19.6 22.66sec 924489 891968 195468 425039 263587 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.56 19.56 0.00 0.00 1.0365 0.0000 5156432.14 5156432.14 0.00 891968.18 891968.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.75 70.30% 195468.28 173797 311890 195488.12 173797 238605 2688307 2688307 0.00
crit 5.81 29.68% 425038.78 362119 779817 424656.51 0 762941 2468125 2468125 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9874 3.7% 91.1 4.70sec 48976 0 32953 86501 49030 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.08 90.97 0.00 0.00 0.0000 0.0000 4460527.75 4460527.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.64 69.96% 32952.54 28967 51982 32966.39 29600 38032 2097162 2097162 0.00
crit 27.32 30.03% 86501.12 72910 161167 86482.20 74400 111599 2363366 2363366 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 18750 7.0% 19.6 22.66sec 432894 0 0 0 0 0.0% 0.0% 0.0% 0.0% 191.9 32743 70881 44120 29.8% 0.0% 25.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.56 19.56 191.94 191.94 0.0000 0.6068 8468586.89 8468586.89 0.00 72706.71 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.7 70.17% 32742.94 28967 80080 32751.64 29405 56551 4409936 4409936 0.00
crit 57.3 29.83% 70881.32 60355 188249 70847.43 61487 116641 4058651 4058651 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.3 163.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 6.7 0 0 0 0.0% 0.0% 0.9%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.30 1.30 6.70 6.70 3.4752 0.6177 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.7 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 22842 8.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 182.4 25728 56091 34794 29.9% 0.0% 31.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 37.64 182.39 296.95 0.0000 0.7937 10332011.70 10332011.70 0.00 71376.35 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 208.2 70.13% 25727.69 21627 41449 25741.39 23544 29181 5357694 5357694 0.00
crit 88.7 29.86% 56091.34 45062 103635 56086.91 49839 66775 4974318 4974318 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8378) 0.0% (3.1%) 8.8 49.93sec 426110 411145 0 0 0 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.83 8.83 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 411144.77 411144.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.20 70.14% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.64 29.85% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8378 3.1% 8.8 49.93sec 426110 0 179162 389207 241921 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.83 15.56 0.00 0.00 0.0000 0.0000 3764030.34 3764030.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.91 70.11% 179162.49 157064 279122 180059.58 0 232118 1954400 1954400 0.00
crit 4.65 29.88% 389207.01 327255 697887 384490.49 0 664021 1809630 1809630 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26295 9.8% 52.7 8.55sec 225445 214132 167625 363357 225447 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.66 52.66 0.00 0.00 1.0528 0.0000 11871493.96 11871493.96 0.00 214132.29 214132.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.09 70.44% 167624.80 139099 401435 167556.70 142318 193915 6217455 6217455 0.00
crit 15.56 29.55% 363357.24 289823 1003706 363380.85 291450 549010 5654039 5654039 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 17316 (26323) 6.5% (9.8%) 71.9 6.11sec 165793 121803 0 0 0 0.0% 0.0% 0.0% 0.0% 137.8 41975 91529 56885 30.1% 0.0% 18.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.86 71.86 137.78 137.78 1.3612 0.5962 7837420.63 7837420.63 0.00 121802.63 121802.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.85 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.3 69.91% 41975.06 36858 66140 42004.02 38614 46879 4043095 4043095 0.00
crit 41.5 30.09% 91528.80 76796 165368 91588.83 80031 112488 3794325 3794325 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9006 3.4% 65.3 6.64sec 62394 0 41842 110403 62426 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.33 65.30 0.00 0.00 0.0000 0.0000 4076338.57 4076338.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.68 69.96% 41841.89 36858 66140 41870.61 37684 49167 1911470 1911470 0.00
crit 19.61 30.03% 110403.48 92771 205060 110495.16 93286 151215 2164869 2164869 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 35 0.0% 0.2 156.05sec 91434 85262 0 0 0 0.0% 0.0% 0.0% 0.0% 0.1 23681 51786 32114 30.0% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.17 0.17 0.12 0.50 1.0743 0.6224 15943.91 15943.91 0.00 85261.55 85261.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.17 99.95% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.3 69.98% 23680.62 21702 37187 1799.18 0 37187 8227 8227 0.00
crit 0.1 30.01% 51786.07 45218 92979 3387.65 0 92979 7717 7717 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 19 0.0% 0.2 10.82sec 35157 0 23690 62468 35157 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.24 0.24 0.00 0.00 0.0000 0.0000 8334.76 8334.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.17 70.43% 23690.18 21702 37187 1625.12 0 37187 3956 3956 0.00
crit 0.07 29.57% 62467.59 54624 115296 2858.83 0 115296 4379 4379 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (19) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 21897 8.1% 50.9 8.13sec 193796 186973 142982 312149 193796 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.88 50.88 0.00 0.00 1.0365 0.0000 9860397.69 9860397.69 0.00 186973.05 186973.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.58 69.94% 142982.36 113151 327667 143153.95 122329 178828 5087798 5087798 0.00
crit 15.29 30.05% 312149.38 235760 819264 312579.23 235760 435009 4772600 4772600 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 9474 3.5% 182.7 2.44sec 23393 0 23393 0 23393 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.67 182.67 0.00 0.00 0.0000 0.0000 4273180.40 4273180.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.67 100.00% 23393.23 8570 376952 23396.68 16359 33502 4273180 4273180 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:162533.00
  • base_dd_max:162533.00
shadow_word_death 9228 3.4% 15.7 5.77sec 264743 255439 196317 424805 264747 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.73 15.73 0.00 0.00 1.0365 0.0000 4163918.85 4163918.85 0.00 255439.47 255439.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.02 70.04% 196317.14 156358 452288 196793.24 156358 317545 2162540 2162540 0.00
crit 4.71 29.95% 424805.50 325785 1130856 423165.41 0 1046219 2001379 2001379 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37644 (57633) 14.0% (21.4%) 103.7 4.21sec 250699 241872 0 0 0 0.0% 0.0% 0.0% 0.0% 420.3 29938 65073 40397 29.8% 0.0% 126.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.69 103.69 420.35 420.35 1.0365 1.3660 16980566.94 16980566.94 0.00 38133.93 241872.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.68 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 295.2 70.23% 29938.13 25710 48430 29948.33 27775 33023 8838439 8838439 0.00
crit 125.1 29.77% 65073.48 53569 121089 65085.18 59545 73525 8142128 8142128 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19989 7.4% 199.5 2.20sec 45175 0 30386 80062 45202 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.54 199.43 0.00 0.00 0.0000 0.0000 9014418.48 9014418.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.90 70.15% 30385.68 26996 48430 30394.12 28294 33380 4251056 4251056 0.00
crit 59.50 29.83% 80062.32 67948 150153 80085.76 72260 92874 4763362 4763362 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.1 180.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 3.09 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 7331 2.7% 184.6 2.37sec 17909 0 15815 34509 21457 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 184.62 154.09 0.00 0.00 0.0000 0.0000 3306328.06 3306328.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.55 69.80% 15815.12 13769 25133 15818.65 14579 17871 1700924 1700924 0.00
crit 46.52 30.19% 34509.02 28689 62840 34512.00 30556 42672 1605404 1605404 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1243 0.5% 17.2 19.00sec 32117 0 21706 53750 32118 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.18 17.18 0.00 0.00 0.0000 0.0000 551746.57 551746.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.59 67.48% 21706.26 17031 31086 21811.55 17031 31086 251628 251628 0.00
crit 5.58 32.50% 53749.74 35485 77725 53326.74 0 77725 300118 300118 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 19114 (29073) 7.1% (10.8%) 30.5 14.03sec 428679 364730 0 0 0 0.0% 0.0% 0.0% 0.0% 188.1 33729 73709 45753 30.1% 0.0% 74.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.53 30.53 188.08 188.08 1.1753 1.8064 8605311.80 8605311.80 0.00 34843.47 364729.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.53 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.5 69.93% 33728.52 28140 53851 33757.78 30534 38462 4435933 4435933 0.00
crit 56.6 30.07% 73708.77 58633 134645 73756.05 64462 89902 4169379 4169379 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 9959 3.7% 89.2 4.71sec 50249 0 33649 89120 50276 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.22 89.17 0.00 0.00 0.0000 0.0000 4483012.03 4483012.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.42 70.01% 33648.96 29548 53851 33671.90 30720 38367 2100443 2100443 0.00
crit 26.73 29.98% 89119.81 74371 166962 89207.01 76441 110379 2382569 2382569 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 113285 / 9147
melee 112916 3.4% 39.3 10.34sec 104195 117393 77353 179126 104195 30.7% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.29 39.29 0.00 0.00 0.8876 0.0000 4093500.99 4093500.99 0.00 117393.20 117393.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.75 45.18% 77353.16 58973 121698 77519.30 66146 106650 1373054 1373054 0.00
crit 12.07 30.73% 179125.96 117946 292075 178655.76 133994 265497 2162599 2162599 0.00
glance 9.46 24.08% 58971.87 44230 91273 59008.27 0 91273 557849 557849 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 6.12 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 369 0.0% 8.0 0.73sec 1643 0 1089 2697 1643 34.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 13145.36 13145.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.24 65.48% 1088.50 895 1434 1098.84 0 1434 5701 5701 0.00
crit 2.76 34.51% 2696.78 2147 3442 2551.42 0 3442 7444 7444 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 28.1 2.9 14.9sec 13.5sec 8.17% 51.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.17%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.6 0.0 22.7sec 22.7sec 14.06% 15.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:14.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.7 0.0 134.7sec 134.7sec 16.01% 16.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.01%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 413.9sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.8 6.6 36.4sec 23.5sec 41.76% 41.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.76%

    Trigger Attempt Success

    • trigger_pct:99.51%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 11.8sec 11.8sec 15.23% 48.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.23%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 8.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 39.5 16.0 10.6sec 7.5sec 26.61% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:21.10%
  • surge_of_darkness_2:5.51%

Trigger Attempt Success

  • trigger_pct:19.97%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.9 2.4 47.1sec 37.2sec 24.50% 53.90%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.50%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 56.9sec 56.8sec 17.19% 17.19%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.19%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-shadowcrawl 6.1 0.0 74.8sec 74.8sec 83.43% 82.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 51.85% 63.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:51.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.14% 16.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 19.6 58.7 3.0 3.0 308184.3
halo Mana 8.8 357757.6 40500.0 40500.2 10.5
mind_blast Mana 52.7 212024.9 4026.4 4026.5 56.0
mind_flay Mana 71.9 215579.6 3000.0 3000.0 55.3
mind_sear Mana 0.2 1569.6 9000.0 9001.2 10.2
shadow_word_death Mana 15.7 122686.8 7800.0 7800.5 33.9
shadow_word_pain Mana 103.7 1368712.8 13200.0 13200.0 19.0
vampiric_touch Mana 30.5 274791.2 9000.0 9000.2 47.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 6.70 120622.32 (5.28%) 18000.00 0.00 0.00%
shadowfiend Mana 39.28 288018.28 (12.61%) 7331.89 65528.36 18.53%
Shadow Orbs from Mind Blast Shadow Orb 52.65 51.95 (86.58%) 0.99 0.70 1.33%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.05 8.05 (13.42%) 1.00 0.00 0.00%
Devouring Plague Health Health 282.93 0.00 (0.00%) 0.00 6023114.54 100.00%
Vampiric Touch Mana Mana 277.26 1344443.96 (58.88%) 4849.02 51606.88 3.70%
halo_heal Health 8.83 0.00 (0.00%) 0.00 2832613.17 100.00%
external_healing Health 56.20 0.00 (0.00%) 0.00 18198194.03 100.00%
mp5_regen Mana 1812.85 530290.60 (23.22%) 292.52 13564.31 2.49%
pet - shadowfiend
external_healing Health 16.81 0.00 (0.00%) 0.00 5805030.35 100.00%
Resource RPS-Gain RPS-Loss
Mana 5036.89 5631.92
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 30558.32 0.00 226800.00
Shadow Orb 1.34 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.6%
shadowfiend-Mana Cap 2.6%
mindbender-Mana Cap 2.6%

Procs

Count Interval
Shadowy Recall Extra Tick 445.1 1.0sec
Shadowy Apparition Procced 184.6 2.4sec
Divine Insight Mind Blast CD Reset 52.0 13.5sec
FDCL Mind Spike proc 55.5 7.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 268956.02
Minimum 167487.47
Maximum 339918.32
Spread ( max - min ) 172430.86
Range [ ( max - min ) / 2 * 100% ] 32.06%
Standard Deviation 24201.6214
5th Percentile 225213.23
95th Percentile 304044.43
( 95th Percentile - 5th Percentile ) 78831.19
Mean Distribution
Standard Deviation 153.0890
95.00% Confidence Intervall ( 268655.97 - 269256.07 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 311
0.1% Error 31104
0.1 Scale Factor Error with Delta=300 5000029
0.05 Scale Factor Error with Delta=300 20000119
0.01 Scale Factor Error with Delta=300 500002983
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 268956.02
Minimum 167487.47
Maximum 339918.32
Spread ( max - min ) 172430.86
Range [ ( max - min ) / 2 * 100% ] 32.06%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 117230001.48
Minimum 63921240.96
Maximum 169915438.30
Spread ( max - min ) 105994197.34
Range [ ( max - min ) / 2 * 100% ] 45.21%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.09 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 7.68 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 4.30 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 54.24 mind_blast,if=active_enemies<=5&cooldown_react
F 8.05 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 28.06 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 29.78 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 4.46 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 9.08 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.27 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 8.73 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.83 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 77.04 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 101.57 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 42.15 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.17 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 41.62 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 71.17 shadow_word_pain,moving=1
a 1.30 dispersion

Sample Sequence

AEIJPWZZZEUWULUWUUZENETTTTEWZZZJTTTTENWUWZEZUIIIJJOPOUEJWKZZENWLZZZEJWZZZZEUTTTTENLIIIOJEJJJOKPOUEWLWZUZENUWZZZZELOUWZZEWIIIJJUPZEJNOUWZZZUEUUWLUZZZEJWUZZZENWLAIIIEJJEJEKNOPUWEUZZZJWEWZZUZTTEUWLZZEJIIIJJDOUZEPWLWUUZZEUWZZZEJNWZZZUEWUWTEIIIOJEJJDEIOOPTTTTTTTTTEUWLZZZZEJNWZZUZEUWEZZZJWJJaIIIOENOLOOKPUEWUWUZEOUJWTEUZZZWTELIAIIJJDEJJKOPUWEWFCNZZJTEWSFCZZZZTENUFCZZZZEIWEDEFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSEDCEWSSSSSS8SSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTEDSSSSSSSSSSSSSSSSSSSSSSSSSFaCIPZEJWFCNZZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 237976 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
237975.9 237975.9 279.72 / 0.12% 37145 / 15.6% 44.1 5164.2 4567.2 Mana 18.50% 84.3 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 5.78 4.43 5.54 3.73 -9.30 4.66
Normalized 1.00 0.77 0.96 0.65 -1.61 0.81
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.39 0.39 0.40 0.39 0.40 0.39
Gear Ranking
Optimizers
Ranking
  • Int ~= Hit > Mastery ~= SP > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=5.78, SpellDamage=4.43, HitRating=5.54, CritRating=3.73, HasteRating=-9.30, MasteryRating=4.66 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=5.78, SpellDamage=4.43, HitRating=0.00, CritRating=3.73, HasteRating=-9.30, MasteryRating=4.66 )

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:892082|459165|374877|259173|245863|209949|189151|129217|48144&chds=0,1784164&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++892082++devouring_plague,9482C9,0,0,15|t++459165++halo,9482C9,1,0,15|t++374877++vampiric_touch,9482C9,2,0,15|t++259173++shadow_word_death,9482C9,3,0,15|t++245863++shadow_word_pain,9482C9,4,0,15|t++209949++mind_blast,9482C9,5,0,15|t++189151++mind_spike,4A79D3,6,0,15|t++129217++mind_flay,9482C9,7,0,15|t++48144++mind_sear,9482C9,8,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,8,8,8,8,7,6,4,4,4,4,4,4,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,7BC29D,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,C79C6E,336600,9482C9,336600,9482C9&chl=shadow_word_pain|essence_of_yulon|mind_spike|mind_blast|shadow_word_pain_mastery|mind_flay|vampiric_touch|devouring_plague_tick|mind_flay_mastery|shadowfiend: melee|shadow_word_death|devouring_plague|vampiric_touch_mastery|multistrike_spell|halo_damage|devouring_plague_mastery|shadowy_apparition|stormlash|mind_sear|shadowfiend: stormlash|mind_sear_mastery&
http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:5.78,5.54,4.66,4.43,3.73,-9.30|5.39,5.14,4.27,4.04,3.34,-9.70|6.17,5.94,5.05,4.82,4.13,-8.90&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++5.78++Int,FFFFFF,0,0,15,0.1,e|t++++5.54++Hit,FFFFFF,0,1,15,0.1,e|t++++4.66++Mastery,FFFFFF,0,2,15,0.1,e|t++++4.43++SP,FFFFFF,0,3,15,0.1,e|t++++3.73++Crit,FFFFFF,0,4,15,0.1,e|t++++-9.30++Haste,FFFFFF,0,5,15,0.1,s&chds=-9.706,6.949& http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:imoqswz24677776753110zzyyvutttssrrrqoomkmppqqqrrrrsstsssrrqqmigfeeccbaZZYYYYZaabcccghjkkkmmmmmmlkjjiihhdcbbbcbbccccddddeeeeffgffffghhijkkkllmnnnnmmllkihfedcbaZYXXWWVVWWWXXYZabdefhkmnppqrqqqqqqponmlkigfeddcccbbbbbbbbbaaZZZZZaaaZZZZZZZZZZZZZZZYYXXWXXXXXWWWWWWWWWWXXYYYZZaaaaaaaaaZZZYYYXWWVUUTTTTTTTUUUUUUUUUUVVWWWWWWXXWWWWWWWWVVUUTTSSSRRRRRRRQQQQPPPPPQQRSTUWYacfiknpqsuvwxyyyyxwvusrpnmlkjjiiiihhhhhhhhgggghihggffeeeeedccbbaZZYXXXXWWWWVVVVVUUUUVVVVVVWWWWWWWWWWWWWWWWWVVUUTUUUUVVVVVVVVUUVVWXYZZZabbbcccccddddedccbaZZYYXXXXXWWVVUUUUUUUUVWXXZabcehkmopqrsstuutttstssqpnmlkjjjjjjjiihgfeeeffffhgfecaYWVUTSR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5183,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=237976|max=459161&chxp=1,1,52,100 http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,0,0,7,20,29,57,82,124,185,250,367,481,599,720,867,1007,1155,1185,1335,1372,1445,1460,1377,1347,1220,1253,1085,1056,899,772,665,575,448,397,354,222,181,114,89,73,50,30,19,8,7,1,1,1&chds=0,1460&chbh=5&chxt=x&chxl=0:|min=157973|avg=237976|max=324036&chxp=0,1,48,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:21.8,21.6,9.9,8.9,6.5,3.4,3.3,1.7,1.5,0.7,0.1,18.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 98.7s|mind_flay 98.1s|mind_spike 44.8s|mind_blast 40.1s|vampiric_touch 29.7s|devouring_plague 15.2s|shadow_word_death 14.9s|halo 7.6s|dispersion 7.0s|shadowfiend 3.2s|mind_sear 0.3s|waiting 83.8s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 237976
devouring_plague 8438 (29950) 3.6% (12.6%) 14.7 30.36sec 924591 892082 194044 419933 260484 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.66 14.66 0.00 0.00 1.0365 0.0000 3818626.30 3818626.30 0.00 892082.22 892082.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.35 70.57% 194044.04 173797 327485 194018.66 173797 264640 2007502 2007502 0.00
crit 4.31 29.42% 419932.70 362119 818808 416735.28 0 801088 1811124 1811124 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 7502 3.2% 69.2 6.10sec 49088 0 33097 86570 49156 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.18 69.09 0.00 0.00 0.0000 0.0000 3396022.20 3396022.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.33 69.95% 33097.13 28967 54581 33110.08 29154 39438 1599451 1599451 0.00
crit 20.75 30.04% 86570.48 72910 169225 86548.71 73476 115678 1796572 1796572 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 14010 5.9% 14.7 30.36sec 432452 0 0 0 0 0.0% 0.0% 0.0% 0.0% 145.8 32425 69889 43491 29.5% 0.0% 19.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.66 14.66 145.77 145.77 0.0000 0.5980 6339648.75 6339648.75 0.00 72730.75 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.7 70.46% 32424.56 28967 128846 32437.69 29128 52964 3330452 3330452 0.00
crit 43.1 29.54% 69889.26 60355 268462 69854.66 60689 103635 3009197 3009197 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 2.1 150.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 10.5 0 0 0 0.0% 0.0% 1.4%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.14 2.14 10.48 10.48 3.2592 0.5990 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.5 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 22136 9.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 178.3 26029 57059 35290 29.9% 0.0% 31.3%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.68 178.35 283.71 0.0000 0.7944 10012321.23 10012321.23 0.00 70672.05 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 199.0 70.14% 26029.44 21627 43522 26045.61 23860 29514 5179939 5179939 0.00
crit 84.7 29.85% 57058.78 45062 108817 57061.24 50265 74725 4832382 4832382 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7742) 0.0% (3.2%) 7.3 62.10sec 475910 459165 0 0 0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 459165.32 459165.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.10 70.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.18 29.96% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7742 3.2% 7.3 62.10sec 475910 0 179094 392164 242091 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 14.33 0.00 0.00 0.0000 0.0000 3468534.79 3468534.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.09 70.42% 179093.88 157064 293078 179879.31 0 253650 1806959 1806959 0.00
crit 4.24 29.57% 392164.45 327255 732781 385927.22 0 732781 1661576 1661576 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18640 7.8% 38.1 11.85sec 221005 209949 164410 356086 221006 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.13 38.13 0.00 0.00 1.0527 0.0000 8427355.59 8427355.59 0.00 209949.07 209949.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.86 70.45% 164410.28 139099 421507 164393.73 145001 192333 4416886 4416886 0.00
crit 11.26 29.54% 356085.51 289823 1053892 356235.49 289823 530111 4010470 4010470 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18404 (28004) 7.8% (11.8%) 72.7 6.00sec 174299 129217 0 0 0 0.0% 0.0% 0.0% 0.0% 144.3 42519 93058 57729 30.1% 0.0% 18.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.71 72.71 144.30 144.30 1.3489 0.5712 8330097.78 8330097.78 0.00 129217.37 129217.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.71 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.9 69.90% 42518.88 36858 69446 42555.92 39150 48298 4288779 4288779 0.00
crit 43.4 30.10% 93058.04 76796 173637 93134.80 80645 116714 4041319 4041319 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9600 4.0% 68.4 6.30sec 63473 0 42455 112542 63505 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.44 68.40 0.00 0.00 0.0000 0.0000 4343800.79 4343800.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.85 69.95% 42454.79 36858 69446 42488.92 38173 51328 2031281 2031281 0.00
crit 20.55 30.04% 112541.71 92771 215313 112640.73 93595 157104 2312520 2312520 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 32 0.0% 0.3 143.75sec 46716 48144 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 23549 52445 32145 29.8% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.31 0.31 0.11 0.45 0.9724 0.6090 14395.14 14395.14 0.00 48144.28 48144.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.31 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.3 70.24% 23549.22 21702 38145 1770.29 0 38145 7407 7407 0.00
crit 0.1 29.75% 52445.33 45218 95374 3260.22 0 95374 6988 6988 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 17 0.0% 0.2 8.87sec 35294 0 23560 63694 35294 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.21 0.21 0.00 0.00 0.0000 0.0000 7505.96 7505.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.15 70.76% 23559.73 21702 38145 1548.13 0 38145 3545 3545 0.00
crit 0.06 29.24% 63694.25 54624 118265 2709.87 0 118265 3961 3961 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (17) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 18845 7.9% 43.2 9.42sec 196053 189151 144057 316473 196052 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.24 43.24 0.00 0.00 1.0365 0.0000 8476818.91 8476818.91 0.00 189151.38 189151.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.19 69.82% 144057.07 113151 344050 144294.44 121817 178165 4348792 4348792 0.00
crit 13.04 30.17% 316473.03 235760 860227 317106.20 0 468864 4128027 4128027 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 8135 3.4% 159.9 2.80sec 22950 0 22950 0 22950 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.92 159.92 0.00 0.00 0.0000 0.0000 3670212.48 3670212.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.92 100.00% 22950.39 8570 387154 22954.82 15861 32642 3670212 3670212 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:470624.00
  • base_dd_max:470624.00
power_infusion 0 0.0% 4.3 120.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 8532 3.6% 14.4 6.31sec 268621 259173 198867 431553 268614 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 14.39 0.00 0.00 1.0365 0.0000 3866084.75 3866084.75 0.00 259173.07 259173.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.08 70.01% 198867.19 156358 474903 199374.11 156358 309804 2003693 2003693 0.00
crit 4.32 29.98% 431553.45 325785 1187398 428516.74 0 1161462 1862392 1862392 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 35195 (53836) 14.8% (22.6%) 95.2 4.57sec 254837 245863 0 0 0 0.0% 0.0% 0.0% 0.0% 386.8 30339 66194 41021 29.8% 0.0% 111.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.24 95.24 386.78 386.78 1.0365 1.3071 15866460.78 15866460.78 0.00 40162.02 245862.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.23 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 271.5 70.21% 30339.13 25710 50852 30351.02 28146 33959 8238546 8238546 0.00
crit 115.2 29.79% 66194.09 53569 127144 66213.85 59796 74945 7627915 7627915 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18641 7.8% 183.6 2.39sec 45779 0 30718 81368 45807 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.56 183.45 0.00 0.00 0.0000 0.0000 8403166.36 8403166.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.76 70.19% 30717.65 26996 50852 30726.05 28145 34288 3955279 3955279 0.00
crit 54.66 29.80% 81368.49 67948 157661 81394.47 71962 99555 4447887 4447887 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.1 180.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 3.09 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6829 2.9% 169.9 2.57sec 18120 0 15818 34640 21494 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.90 143.23 0.00 0.00 0.0000 0.0000 3078629.69 3078629.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.01 69.82% 15818.40 13769 25133 15820.76 14587 17559 1581939 1581939 0.00
crit 43.21 30.17% 34639.98 28689 62840 34640.86 30473 42062 1496691 1496691 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1352 0.6% 17.6 18.49sec 34106 0 22840 57262 34106 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.61 17.61 0.00 0.00 0.0000 0.0000 600446.43 600446.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.84 67.25% 22839.97 17031 32641 22980.05 17981 32641 270395 270395 0.00
crit 5.76 32.74% 57262.34 35485 81611 56798.11 0 81611 330051 330051 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 16276 (24741) 6.8% (10.4%) 25.3 16.90sec 439486 374877 0 0 0 0.0% 0.0% 0.0% 0.0% 155.6 34508 76003 47047 30.2% 0.0% 58.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.32 25.32 155.58 155.58 1.1724 1.6955 7319693.37 7319693.37 0.00 37914.87 374876.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.32 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.6 69.78% 34507.57 28140 56544 34555.52 31190 40420 3746390 3746390 0.00
crit 47.0 30.22% 76002.64 58633 141377 76096.19 65118 93749 3573303 3573303 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 8465 3.5% 73.8 5.63sec 51617 0 34307 91816 51647 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.76 73.71 0.00 0.00 0.0000 0.0000 3807030.49 3807030.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.47 69.83% 34306.83 29548 56544 34342.31 30525 39238 1765836 1765836 0.00
crit 22.23 30.16% 91815.52 74371 175310 91960.60 76799 120682 2041195 2041195 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 113677 / 9186
melee 113309 3.8% 39.3 10.35sec 104546 117781 77612 179241 104547 30.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.32 39.32 0.00 0.00 0.8877 0.0000 4110925.18 4110925.18 0.00 117781.43 117781.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.75 45.13% 77612.14 58973 121698 77802.13 65197 109447 1377353 1377353 0.00
crit 12.14 30.86% 179241.06 117946 292075 178802.85 133994 292075 2175264 2175264 0.00
glance 9.43 23.99% 59176.76 44230 91273 59227.27 0 91273 558309 558309 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 6.12 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 367 0.0% 8.0 0.73sec 1639 0 1085 2691 1639 34.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 13107.86 13107.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.24 65.48% 1084.86 895 1434 1095.80 0 1434 5682 5682 0.00
crit 2.76 34.50% 2691.05 2147 3442 2540.64 0 3442 7426 7426 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1366.43
  • base_dd_max:1366.43

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.7 0.0 30.4sec 30.4sec 15.99% 13.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:15.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.5 0.0 143.5sec 143.5sec 15.27% 15.27%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.27%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 413.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.8 6.5 36.3sec 23.5sec 41.91% 41.91%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.91%

    Trigger Attempt Success

    • trigger_pct:99.51%
power_infusion 4.3 0.0 120.4sec 120.4sec 18.59% 18.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 12.8sec 12.8sec 13.97% 48.16%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:13.97%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 10.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 34.0 11.9 12.1sec 8.9sec 19.24% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:16.03%
  • surge_of_darkness_2:3.21%

Trigger Attempt Success

  • trigger_pct:19.92%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.9 2.3 46.9sec 37.3sec 24.51% 44.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.51%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.6 0.0 59.5sec 59.3sec 16.57% 16.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.57%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.1 0.0 74.8sec 74.8sec 83.43% 82.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 50.85% 62.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:50.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.13% 16.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 14.7 44.0 3.0 3.0 308211.4
halo Mana 7.3 273783.2 37565.3 37565.2 12.7
mind_blast Mana 38.1 329625.1 8644.2 8644.3 25.6
mind_flay Mana 72.7 208291.9 2864.5 2864.5 60.8
mind_sear Mana 0.3 2761.4 8962.1 8961.6 5.2
shadow_word_death Mana 14.4 107674.1 7481.0 7481.3 35.9
shadow_word_pain Mana 95.2 1201209.2 12613.1 12613.0 20.2
vampiric_touch Mana 25.3 217745.3 8600.5 8600.6 51.1
Resource Gains Type Count Total Average Overflow
dispersion Mana 10.48 188703.36 (9.11%) 18000.00 0.00 0.00%
shadowfiend Mana 39.32 273916.47 (13.23%) 6966.85 79937.61 22.59%
Shadow Orbs from Mind Blast Shadow Orb 38.13 37.82 (83.56%) 0.99 0.31 0.81%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.44 7.44 (16.44%) 1.00 0.00 0.00%
Devouring Plague Health Health 214.86 0.00 (0.00%) 0.00 4574034.29 100.00%
Vampiric Touch Mana Mana 229.29 1081111.03 (52.22%) 4714.94 73521.41 6.37%
halo_heal Health 7.29 0.00 (0.00%) 0.00 2330628.30 100.00%
external_healing Health 57.74 0.00 (0.00%) 0.00 18699188.94 100.00%
mp5_regen Mana 1812.85 526714.46 (25.44%) 290.55 17140.44 3.15%
pet - shadowfiend
external_healing Health 16.46 0.00 (0.00%) 0.00 5688243.42 100.00%
Resource RPS-Gain RPS-Loss
Mana 4567.19 5164.20
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 29051.18 0.00 233040.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.3%
shadowfiend-Mana Cap 3.3%
mindbender-Mana Cap 3.3%

Procs

Count Interval
Shadowy Recall Extra Tick 394.9 1.1sec
Shadowy Apparition Procced 169.9 2.6sec
FDCL Mind Spike proc 45.8 8.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 237975.90
Minimum 157973.01
Maximum 324035.89
Spread ( max - min ) 166062.88
Range [ ( max - min ) / 2 * 100% ] 34.89%
Standard Deviation 22562.2912
5th Percentile 202245.03
95th Percentile 276534.61
( 95th Percentile - 5th Percentile ) 74289.57
Mean Distribution
Standard Deviation 142.7193
95.00% Confidence Intervall ( 237696.18 - 238255.63 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 345
0.1% Error 34530
0.1 Scale Factor Error with Delta=300 4345603
0.05 Scale Factor Error with Delta=300 17382412
0.01 Scale Factor Error with Delta=300 434560321
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 237975.90
Minimum 157973.01
Maximum 324035.89
Spread ( max - min ) 166062.88
Range [ ( max - min ) / 2 * 100% ] 34.89%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 103246851.79
Minimum 54564829.52
Maximum 151542293.46
Spread ( max - min ) 96977463.94
Range [ ( max - min ) / 2 * 100% ] 46.96%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.09 shadowfiend,if=!talent.mindbender.enabled
B 4.32 power_infusion,if=talent.power_infusion.enabled
C 6.95 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 2.08 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 39.20 mind_blast,if=active_enemies<=5&cooldown_react
F 7.44 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 25.04 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 26.52 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 3.07 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 4.80 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.58 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 6.44 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 7.29 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 108.25 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 231.70 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 36.80 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.31 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 40.68 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 67.12 shadow_word_pain,moving=1
a 2.14 dispersion

Sample Sequence

ABEIJPWZZZZEWLUWZZUENWUWZUZEJUWZZOEIIIJJOPUZEJNWUZZZEWUULZZZZEJWZZZZENWLIIIPEJJJJUUKZZEWZUZZEJNWZBZZZEWOUWZZZEIIIJJZZZWENWUZUUZJEWZZZTTEWLWZUZUENWUAIIIEJJJJKOPUEWUUWZZZZEJNWZZZZEUWZZUEWWWTTTTTTTTTTTTTTTTTTTTTTTENBJaIPUZEWLUWZZZEWIIIZEJJJJNOUZZEWZPUZEJWZZUZENUWZZZZEWWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWTTTTTTTTTTTTTTTTTTTTTTTENWWTTTTTTTTTTTTTTTTTTTTTTEWABIIIIEJJJZPZZWENWFCUUZJEWUFCNOUZEWFCZUZZENWFaCKPZEJW8FCNZZEWSFCUZUZEJDFCOIIIOEUFCNKZTTTTTTTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSSSSSSSSSSF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 223962 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
223962.3 223962.3 294.00 / 0.13% 38963 / 17.4% 43.2 4938.2 4313.2 Mana 23.52% 91.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 5.55 4.18 5.40 3.69 -7.64 4.54
Normalized 1.00 0.75 0.97 0.67 -1.38 0.82
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.41 0.41 0.41 0.41 0.43 0.41
Gear Ranking
Optimizers
Ranking
  • Int ~= Hit > Mastery ~= SP > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=5.55, SpellDamage=4.18, HitRating=5.40, CritRating=3.69, HasteRating=-7.64, MasteryRating=4.54 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=5.55, SpellDamage=4.18, HitRating=0.00, CritRating=3.69, HasteRating=-7.64, MasteryRating=4.54 )

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:926358|495003|362738|295856|245260|217779|192507|127064|29618&chds=0,1852716&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++926358++devouring_plague,9482C9,0,0,15|t++495003++halo,9482C9,1,0,15|t++362738++vampiric_touch,9482C9,2,0,15|t++295856++shadow_word_death,9482C9,3,0,15|t++245260++shadow_word_pain,9482C9,4,0,15|t++217779++mind_blast,9482C9,5,0,15|t++192507++mind_spike,4A79D3,6,0,15|t++127064++mind_flay,9482C9,7,0,15|t++29618++mind_sear,9482C9,8,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,9,9,8,8,6,6,5,4,4,4,4,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,7BC29D,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,336600,9482C9,9482C9&chl=shadow_word_pain|essence_of_yulon|mind_flay|mind_blast|shadow_word_pain_mastery|mind_spike|vampiric_touch|devouring_plague_tick|mind_flay_mastery|shadowfiend: melee|shadow_word_death|devouring_plague|multistrike_spell|devouring_plague_mastery|vampiric_touch_mastery|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:5.55,5.40,4.54,4.18,3.69,-7.64|5.13,4.98,4.13,3.77,3.28,-8.07|5.96,5.81,4.95,4.59,4.10,-7.20&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++5.55++Int,FFFFFF,0,0,15,0.1,e|t++++5.40++Hit,FFFFFF,0,1,15,0.1,e|t++++4.54++Mastery,FFFFFF,0,2,15,0.1,e|t++++4.18++SP,FFFFFF,0,3,15,0.1,e|t++++3.69++Crit,FFFFFF,0,4,15,0.1,e|t++++-7.64++Haste,FFFFFF,0,5,15,0.1,s&chds=-8.080,6.665& http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:imortwz23677674765332110zywwwwwwwvvusrqorvwxyyzzzz00110zzzyytomkiiggfedcbbbcddeffgglnoppqrsssssrqpoonmmhgffffeffggggggggggggghggfeeeefgggghiijjjjiiiiihgfdccbbaZYYXXWWWXXXXYZbcefhjmoqsttvvwwwwwvvtsrpomkjhhgffffeeeeeeeddddcccdddccbbbbaaaaaZZYXXWVUUUUUUTTSSSSSSSSTTTTUUVVWWWWXXXXXXXXXXXXXWVUUUUUUVVWWWWWWWWWXYYZaaaaabbbaaZaaaaaZZYXWVVVUUUUUUUUUTTTSSSSSTTUWXYacegjmprtuxyz01222210zyxvtrqpommmlllkkjjjiiihhhghhgffeeedddedcbbaaaaaaaaaaaZZZZYYZZZZZaaaabbbbccccccdddddddddcbbaaaabbabbaaaZYYYYYYZabaaZZZZZYZZZZYYYZYXVUTSSSSSSSTSRRQQPOOPPPPQSUVWZabcgjoruwyz12455444443321ywvussssttttsrrponkjiihhhgecZWUSQPML&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5554,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=223962|max=403271&chxp=1,1,56,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,8,13,38,74,126,179,273,352,496,596,808,881,1020,1184,1187,1329,1347,1435,1373,1352,1323,1226,1130,1020,960,906,761,670,523,519,410,311,257,226,183,128,100,81,56,48,33,20,11,10,1,0,2,2,2&chds=0,1435&chbh=5&chxt=x&chxl=0:|min=156087|avg=223962|max=323382&chxp=0,1,41,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:22.0,19.6,8.4,8.4,5.8,3.2,3.0,1.6,1.4,0.7,0.1,23.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 99.9s|shadow_word_pain 89.0s|mind_spike 38.1s|mind_blast 37.9s|vampiric_touch 26.3s|devouring_plague 14.4s|shadow_word_death 13.8s|dispersion 7.1s|halo 6.5s|shadowfiend 3.2s|mind_sear 0.2s|waiting 106.6s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 223962
devouring_plague 8462 (29600) 3.8% (13.3%) 13.9 32.14sec 960099 926358 204334 442845 274492 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.93 13.93 0.00 0.00 1.0365 0.0000 3822512.07 3822512.07 0.00 926358.14 926358.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.83 70.57% 204334.07 173797 358674 204278.86 173797 258975 2007985 2007985 0.00
crit 4.10 29.42% 442845.30 362119 896790 438635.67 0 877382 1814527 1814527 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 7398 3.3% 64.5 6.58sec 51779 0 34901 91460 51845 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.55 64.47 0.00 0.00 0.0000 0.0000 3342318.08 3342318.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.14 70.02% 34900.73 28967 59780 34910.64 30603 42106 1575523 1575523 0.00
crit 19.32 29.96% 91460.24 72910 185342 91416.11 73719 127422 1766795 1766795 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13739 6.2% 13.9 32.14sec 445598 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.0 34029 73415 45631 29.5% 0.0% 18.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.93 13.93 135.99 135.99 0.0000 0.6088 6205296.86 6205296.86 0.00 74954.97 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.9 70.54% 34029.42 28967 107186 34035.53 30133 40776 3264460 3264460 0.00
crit 40.1 29.46% 73414.84 60355 149467 73353.93 62687 92262 2940837 2940837 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 2.3 143.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 10.3 0 0 0 0.0% 0.0% 1.4%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.30 2.30 10.25 10.25 3.0882 0.6213 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.3 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 21500 9.6% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 168.9 27069 59204 36650 29.8% 0.0% 29.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.58 168.88 265.01 0.0000 0.7952 9712776.94 9712776.94 0.00 72323.65 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 186.0 70.17% 27069.46 21627 47667 27082.09 24554 31693 5033958 5033958 0.00
crit 79.0 29.82% 59204.02 45062 119180 59194.73 51629 76142 4678819 4678819 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7215) 0.0% (3.2%) 6.3 67.14sec 513011 495003 0 0 0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.28 6.28 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 495002.54 495002.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.40 70.04% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.88 29.95% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7215 3.2% 6.3 67.14sec 513011 0 179297 390451 241235 29.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.28 13.36 0.00 0.00 0.0000 0.0000 3223951.53 3223951.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.44 70.65% 179296.76 157064 320990 179509.26 157064 253804 1692997 1692997 0.00
crit 3.92 29.34% 390450.82 327255 802570 383864.17 0 763624 1530955 1530955 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18306 8.2% 36.3 12.42sec 227422 217779 169184 367397 227425 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.32 36.32 0.00 0.00 1.0443 0.0000 8261003.63 8261003.63 0.00 217778.81 217778.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.64 70.60% 169183.55 139099 461650 169111.65 145688 198189 4338714 4338714 0.00
crit 10.68 29.39% 367396.84 289823 1154262 367347.02 289823 623086 3922290 3922290 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18414 (28036) 8.3% (12.6%) 71.7 6.07sec 177108 127064 0 0 0 0.0% 0.0% 0.0% 0.0% 141.4 43602 94821 58951 30.0% 0.0% 18.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.66 71.66 141.41 141.41 1.3939 0.5966 8336334.65 8336334.65 0.00 127064.24 127064.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.65 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.0 70.03% 43601.66 36858 76060 43637.39 39932 49621 4317926 4317926 0.00
crit 42.4 29.97% 94821.12 76796 190174 94893.86 83121 117816 4018409 4018409 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9622 4.3% 67.1 6.40sec 64884 0 43568 114753 64915 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.12 67.09 0.00 0.00 0.0000 0.0000 4355349.90 4355349.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.96 70.00% 43568.02 36858 76060 43603.46 38618 50442 2046042 2046042 0.00
crit 20.12 29.99% 114752.81 92771 235819 114850.43 92771 156036 2309308 2309308 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 16 0.0% 0.3 121.72sec 27390 29618 0 0 0 0.0% 0.0% 0.0% 0.0% 0.1 23910 54090 32405 28.1% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.25 0.25 0.05 0.21 0.9249 0.6027 6960.28 6960.28 0.00 29618.19 29618.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.25 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 71.85% 23909.92 21702 42765 922.07 0 42765 3690 3690 0.00
crit 0.1 28.15% 54090.43 45218 92979 1623.40 0 92979 3270 3270 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 8 0.0% 0.1 7.47sec 36178 0 23867 66204 36178 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.10 0.10 0.00 0.00 0.0000 0.0000 3673.95 3673.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.07 70.92% 23867.18 21702 42765 791.97 0 42765 1719 1719 0.00
crit 0.03 29.08% 66203.94 54624 115296 1378.76 0 115296 1955 1955 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (8) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 16339 7.3% 36.7 10.53sec 199531 192507 146908 321957 199528 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.73 36.73 0.00 0.00 1.0365 0.0000 7328556.90 7328556.90 0.00 192507.21 192507.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.68 69.91% 146908.48 113151 376817 146944.20 117680 187917 3772310 3772310 0.00
crit 11.05 30.07% 321956.53 235760 942154 322189.45 0 528222 3556247 3556247 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 7645 3.4% 144.1 3.10sec 23882 0 23883 0 23883 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.15 144.15 0.00 0.00 0.0000 0.0000 3442577.67 3442577.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.15 100.00% 23882.90 8570 433495 23880.84 16354 36743 3442578 3442578 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:69407.81
  • base_dd_max:69407.81
shadow_word_death 9015 4.0% 13.3 6.87sec 306637 295856 226984 492846 306632 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.28 13.28 0.00 0.00 1.0365 0.0000 4071271.12 4071271.12 0.00 295855.76 295855.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.30 70.03% 226984.48 156358 520132 227472.57 179812 332925 2110352 2110352 0.00
crit 3.98 29.97% 492845.64 357001 1300484 488045.40 0 1231559 1960919 1960919 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31737 (48541) 14.2% (21.6%) 85.9 4.98sec 254211 245260 0 0 0 0.0% 0.0% 0.0% 0.0% 339.8 31048 67870 42013 29.8% 0.0% 101.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.89 85.89 339.81 339.81 1.0365 1.3472 14276553.37 14276553.37 0.00 39929.12 245260.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.88 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 238.6 70.22% 31047.92 25710 55695 31039.25 28552 34984 7408800 7408800 0.00
crit 101.2 29.78% 67869.84 53569 139253 67837.75 60063 77979 6867753 6867753 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 16803 7.5% 161.2 2.67sec 46873 0 31438 83352 46900 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.23 161.13 0.00 0.00 0.0000 0.0000 7557250.97 7557250.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.11 70.20% 31438.15 26996 55695 31426.58 28452 34876 3556082 3556082 0.00
crit 48.00 29.79% 83351.64 67948 172676 83323.42 72342 101798 4001169 4001169 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.1 180.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 3.09 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6068 2.7% 149.2 2.88sec 18292 0 15800 34653 21476 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.19 127.08 0.00 0.00 0.0000 0.0000 2729081.02 2729081.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.79 69.87% 15800.15 13769 25133 15802.82 14452 17691 1402953 1402953 0.00
crit 38.27 30.11% 34652.69 28689 62840 34654.27 29724 42486 1326128 1326128 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1165 0.5% 15.5 21.33sec 33286 0 22459 55611 33285 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.52 15.52 0.00 0.00 0.0000 0.0000 516745.36 516745.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.45 67.32% 22459.09 17031 35749 22561.59 17707 31825 234736 234736 0.00
crit 5.07 32.66% 55611.03 35485 77725 54985.88 0 77725 282009 282009 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 13997 (21300) 6.2% (9.5%) 22.5 18.37sec 424351 362738 0 0 0 0.0% 0.0% 0.0% 0.0% 131.7 34953 76902 47661 30.3% 0.0% 51.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.51 22.51 131.73 131.73 1.1699 1.7744 6278304.71 6278304.71 0.00 36735.86 362737.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.51 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.8 69.70% 34952.80 28140 61929 34945.80 31071 42425 3209309 3209309 0.00
crit 39.9 30.30% 76901.87 58633 154841 76877.96 64620 97492 3068996 3068996 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 7304 3.2% 62.5 6.34sec 52416 0 34897 93232 52444 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.50 62.46 0.00 0.00 0.0000 0.0000 3275848.14 3275848.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.66 69.90% 34896.90 29548 61929 34877.64 30594 40783 1523671 1523671 0.00
crit 18.79 30.09% 93232.09 74371 192006 93242.60 74371 124725 1752177 1752177 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 113932 / 9211
melee 113567 4.1% 39.3 10.34sec 104788 118050 77740 179472 104787 31.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.34 39.34 0.00 0.00 0.8877 0.0000 4122053.38 4122053.38 0.00 118049.53 118049.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.71 45.01% 77739.81 58973 121698 77947.29 65955 108242 1376537 1376537 0.00
crit 12.18 30.95% 179472.14 117946 292075 179106.73 133183 282551 2185255 2185255 0.00
glance 9.45 24.02% 59287.78 44230 91273 59297.29 0 91273 560262 560262 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 6.13 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 365 0.0% 8.0 0.73sec 1630 0 1082 2678 1630 34.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 13037.85 13037.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.25 65.62% 1081.72 895 1434 1092.08 0 1434 5678 5678 0.00
crit 2.75 34.36% 2677.77 2147 3442 2533.18 0 3442 7360 7360 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.9 0.0 32.0sec 32.0sec 16.70% 14.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:16.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.4 0.0 148.0sec 148.0sec 14.89% 14.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.89%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 413.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.9 6.5 36.2sec 23.5sec 42.02% 42.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:42.02%

    Trigger Attempt Success

    • trigger_pct:99.58%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 6.9 0.0 13.7sec 13.7sec 13.05% 47.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:13.05%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 10.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 29.3 9.5 13.4sec 10.0sec 16.35% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:13.75%
  • surge_of_darkness_2:2.60%

Trigger Attempt Success

  • trigger_pct:19.88%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.9 2.3 46.9sec 37.4sec 24.51% 53.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.51%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.4 0.0 60.7sec 60.6sec 16.26% 16.26%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.26%

    Trigger Attempt Success

    • trigger_pct:99.88%
twist_of_fate 1.0 211.3 52.9sec 0.8sec 37.55% 37.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:37.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 6.1 0.0 74.7sec 74.7sec 83.43% 82.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 50.63% 62.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:50.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.12% 16.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 13.9 41.8 3.0 3.0 320050.9
halo Mana 6.3 254524.7 40500.0 40501.2 12.7
mind_blast Mana 36.3 326923.2 9000.0 9000.1 25.3
mind_flay Mana 71.7 214986.4 3000.0 3000.1 59.0
mind_sear Mana 0.3 2286.7 9000.0 8998.5 3.0
shadow_word_death Mana 13.3 103567.2 7800.0 7800.4 39.3
shadow_word_pain Mana 85.9 1133718.4 13200.0 13199.9 19.3
vampiric_touch Mana 22.5 202632.5 9000.0 9000.0 47.2
Resource Gains Type Count Total Average Overflow
dispersion Mana 10.25 184555.44 (9.44%) 18000.00 0.00 0.00%
shadowfiend Mana 39.33 290260.97 (14.84%) 7379.70 63730.27 18.00%
Shadow Orbs from Mind Blast Shadow Orb 36.32 36.09 (83.86%) 0.99 0.24 0.65%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.94 6.94 (16.14%) 1.00 0.00 0.00%
Devouring Plague Health Health 200.46 0.00 (0.00%) 0.00 4267482.26 100.00%
Vampiric Touch Mana Mana 194.19 945670.15 (48.36%) 4869.81 32080.85 3.28%
halo_heal Health 6.28 0.00 (0.00%) 0.00 2081404.27 100.00%
external_healing Health 58.75 0.00 (0.00%) 0.00 18957802.91 100.00%
mp5_regen Mana 1812.85 534801.89 (27.35%) 295.01 9053.02 1.66%
pet - shadowfiend
external_healing Health 16.39 0.00 (0.00%) 0.00 5660463.79 100.00%
Resource RPS-Gain RPS-Loss
Mana 4313.16 4938.20
Shadow Orb 0.09 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 16496.83 0.00 209100.00
Shadow Orb 1.26 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.7%
shadowfiend-Mana Cap 1.7%
mindbender-Mana Cap 1.7%

Procs

Count Interval
Shadowy Recall Extra Tick 355.3 1.3sec
Shadowy Apparition Procced 149.2 2.9sec
FDCL Mind Spike proc 38.8 10.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 223962.27
Minimum 156087.11
Maximum 323382.30
Spread ( max - min ) 167295.19
Range [ ( max - min ) / 2 * 100% ] 37.35%
Standard Deviation 23713.7918
5th Percentile 187493.74
95th Percentile 265419.01
( 95th Percentile - 5th Percentile ) 77925.27
Mean Distribution
Standard Deviation 150.0032
95.00% Confidence Intervall ( 223668.27 - 224256.27 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 430
0.1% Error 43067
0.1 Scale Factor Error with Delta=300 4800491
0.05 Scale Factor Error with Delta=300 19201964
0.01 Scale Factor Error with Delta=300 480049115
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 223962.27
Minimum 156087.11
Maximum 323382.30
Spread ( max - min ) 167295.19
Range [ ( max - min ) / 2 * 100% ] 37.35%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 96746367.17
Minimum 57570244.02
Maximum 151629056.88
Spread ( max - min ) 94058812.86
Range [ ( max - min ) / 2 * 100% ] 48.61%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.09 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 6.33 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 2.14 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 37.06 mind_blast,if=active_enemies<=5&cooldown_react
F 6.94 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 23.01 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 23.60 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 2.73 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 4.37 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 11.78 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 5.19 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 6.28 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 130.88 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 291.36 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 31.54 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.25 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 40.94 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 60.15 shadow_word_pain,moving=1
a 2.30 dispersion

Sample Sequence

AEIJPWUWZZZZEUWLWUZZZENUUWZZZZEJWZZZZEIIIJJOOPUEJNWZZZZEWZZZEJWZZZZENUWLIIIPEJJJJKZZZEWLZZZEJNUWZZUUEWLUZZZTEWIOJJOIIUELNOKUZZTTTTTTTTTTEWUWZZTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEaZZZWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAIIIEJJJJKNPOUEWZZZJTTTTTTTTTTTTTEUWZZUWENLUWZZZWEJUJJIIIJEJUWKUPUENWZZUZEWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWWTTTTTENWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEaIZZWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWWWTTTTTTTTTTTTTTTTTTTENWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTITTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWWAIIEIIJJJZZZUENOUFCPUZTTTTTTEUWSSSSSSSSSSSSSSSFDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTWFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTTTESSSSSSSSS8SSSSSSSSSSSSSSFDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTESSSSSSSSSSSSSSSSSFaCIPZEJNWFCZZZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 279968 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
279968.3 279968.3 204.65 / 0.07% 27089 / 9.7% 39.1 6545.1 5951.7 Mana 6.70% 59.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.03 5.20 6.96 4.43 0.14 5.44
Normalized 1.00 0.74 0.99 0.63 0.02 0.77
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.29 0.29 0.29 0.29 0.28 0.29
Gear Ranking
Optimizers
Ranking
  • Int ~= Hit > Mastery ~= SP > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.03, SpellDamage=5.20, HitRating=6.96, CritRating=4.43, HasteRating=0.14, MasteryRating=5.44 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.03, SpellDamage=5.20, HitRating=0.00, CritRating=4.43, HasteRating=0.14, MasteryRating=5.44 )

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:890634|415644|367009|262118|230845|211487|123673|98949&chds=0,1781267&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++890634++devouring_plague,9482C9,0,0,15|t++415644++halo,9482C9,1,0,15|t++367009++vampiric_touch,9482C9,2,0,15|t++262118++shadow_word_death,9482C9,3,0,15|t++230845++mind_blast,9482C9,4,0,15|t++211487++shadow_word_pain,9482C9,5,0,15|t++123673++mind_flay,9482C9,6,0,15|t++98949++mind_sear,9482C9,7,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:16,11,9,9,9,8,8,8,5,4,4,4,4,4,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|mindbender: melee|essence_of_yulon|mind_flay|shadow_word_pain_mastery|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|devouring_plague_mastery|vampiric_touch_mastery|shadow_word_death|multistrike_spell|halo_damage|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|mindbender: stormlash&
http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.03,6.96,5.44,5.20,4.43,0.14|6.74,6.67,5.16,4.91,4.14,-0.14|7.32,7.25,5.73,5.49,4.72,0.43&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.03++Int,FFFFFF,0,0,15,0.1,e|t++++6.96++Hit,FFFFFF,0,1,15,0.1,e|t++++5.44++Mastery,FFFFFF,0,2,15,0.1,e|t++++5.20++SP,FFFFFF,0,3,15,0.1,e|t++++4.43++Crit,FFFFFF,0,4,15,0.1,e|t++++0.14++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.150,8.448& http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:filorvy02567776764210zyvusrqrrqqpppppoooruwxyyyyxxwwxxwxxxwwtqonmmmmmmmllkjjihhgfffhhijjkmmnnnnnnnnnnnnkjiihgeeddeeffgghiijkkmmmmnqsuvwwvuuuttssrrrqqqoljhggffffffffffffeeeefghiklnprstuwwxxxxxxxwvtsrpmljihffeeedddddddddddefhijjjjiiiiiijjkkllllkjjkklllllmllkkjjihhghhhhijkklllllllllllkjihhgfddccccddeghiijklnoppqsuwxyyxwwvutssrqpoonmkigfeeeddddccccbbbaaaabcdegijlmopqstuvvwwwwvvutrqpomlkjihhhggggggggfggghhiiihhhhhhhhhiijkkllmmnpqrssttuuutttssrrqqpppppppooonnmmlllkjihgfedccbbbbcdeffghiklnoqrsuwyzzzzyxxwwvutsqponmkiggffeedddccbbaaZZZZZaabdeghijkmnoqrttuuvvvvutsrrqponmmlkjjiihhgfefeefeedcaYXVTSRQON&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6482,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=279968|max=431900&chxp=1,1,65,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,2,3,4,12,17,28,44,76,96,165,209,280,391,464,589,657,852,988,1087,1226,1253,1355,1442,1439,1543,1462,1381,1319,1160,1040,914,776,686,557,392,334,209,178,110,72,76,32,29,16,11,5,4,2,1&chds=0,1543&chbh=5&chxt=x&chxl=0:|min=218122|avg=279968|max=342912&chxp=0,1,50,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:29.4,26.9,12.7,8.2,4.7,3.8,2.1,1.8,1.0,0.2,6.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 133.1s|mind_flay 121.9s|mind_blast 57.4s|vampiric_touch 36.9s|devouring_plague 21.1s|shadow_word_death 17.4s|halo 9.6s|mindbender 8.3s|dispersion 4.6s|mind_sear 0.8s|waiting 30.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 279968
devouring_plague 11840 (41536) 4.2% (14.9%) 20.4 21.86sec 923107 890634 195238 424196 263169 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.36 20.36 0.00 0.00 1.0365 0.0000 5358369.06 5358369.06 0.00 890633.61 890633.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.31 70.31% 195238.33 173797 311890 195268.16 174316 237255 2794806 2794806 0.00
crit 6.04 29.68% 424195.72 362119 779817 424141.22 0 685919 2563563 2563563 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 10259 3.7% 94.8 4.54sec 48986 0 32973 86451 49042 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.77 94.66 0.00 0.00 0.0000 0.0000 4642592.43 4642592.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.20 69.93% 32973.15 28967 51982 32990.31 29352 38012 2182851 2182851 0.00
crit 28.45 30.06% 86450.69 72910 161167 86445.96 74046 108613 2459741 2459741 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 19436 6.9% 20.4 21.86sec 431916 0 0 0 0 0.0% 0.0% 0.0% 0.0% 199.7 32695 70716 44027 29.8% 0.0% 26.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.36 20.36 199.74 199.74 0.0000 0.6068 8794079.55 8794079.55 0.00 72554.22 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.2 70.19% 32694.65 28967 104768 32707.61 29581 73189 4583976 4583976 0.00
crit 59.5 29.81% 70715.91 60355 237433 70692.37 61625 151687 4210104 4210104 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.3 164.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 6.8 0 0 0 0.0% 0.0% 0.9%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.31 1.31 6.82 6.82 3.5232 0.6194 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.8 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 22680 8.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 176.4 25674 55855 34680 29.8% 0.0% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.10 176.41 295.95 0.0000 0.7954 10263633.07 10263633.07 0.00 73151.25 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 207.6 70.14% 25673.64 21627 41449 25687.22 23550 29298 5329666 5329666 0.00
crit 88.3 29.85% 55855.27 45062 103635 55848.70 49324 68370 4933967 4933967 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8904) 0.0% (3.2%) 9.3 48.33sec 430771 415644 0 0 0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.28 9.28 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 415643.83 415643.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.50 70.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.78 29.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8904 3.2% 9.3 48.33sec 430771 0 178803 387127 240623 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.28 16.62 0.00 0.00 0.0000 0.0000 3998078.01 3998078.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.68 70.31% 178803.08 157064 279122 179760.58 157936 241054 2088812 2088812 0.00
crit 4.93 29.68% 387127.24 327255 697887 382487.98 0 664021 1909266 1909266 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 29271 10.5% 54.6 8.30sec 242634 230845 180772 391277 242633 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.56 54.56 0.00 0.00 1.0511 0.0000 13239179.84 13239179.84 0.00 230844.79 230844.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.52 70.59% 180771.60 139099 401435 180770.48 156515 216139 6962804 6962804 0.00
crit 16.04 29.40% 391276.54 289823 1003706 391403.56 292354 579578 6276375 6276375 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 21937 (33364) 7.8% (11.9%) 89.3 4.98sec 168838 123673 0 0 0 0.0% 0.0% 0.0% 0.0% 174.9 41851 91265 56685 30.0% 0.0% 22.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.31 89.31 174.90 174.90 1.3652 0.5939 9914442.86 9914442.86 0.00 123672.95 123672.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.30 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.4 69.98% 41850.84 36858 66140 41874.09 38777 46499 5122502 5122502 0.00
crit 52.5 30.02% 91265.48 76796 165368 91317.23 80247 110191 4791941 4791941 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 11427 4.1% 83.0 5.28sec 62211 0 41754 110286 62244 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.02 82.98 0.00 0.00 0.0000 0.0000 5164999.63 5164999.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.15 70.08% 41753.82 36858 66140 41777.59 38111 47073 2428111 2428111 0.00
crit 24.82 29.91% 110285.74 92771 205060 110354.22 93909 139393 2736888 2736888 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 172 0.1% 0.7 135.39sec 110903 98949 0 0 0 0.0% 0.0% 0.0% 0.0% 0.6 23649 52021 31863 29.0% 0.0% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.69 0.69 0.61 2.42 1.1213 0.6194 76982.51 76982.51 0.00 98949.25 98949.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.69 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.7 71.04% 23648.63 21702 37187 7494.27 0 37187 40586 40586 0.00
crit 0.7 28.96% 52021.01 45218 92979 14270.34 0 92979 36397 36397 0.00
miss 0.0 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 89 0.0% 1.1 24.75sec 35083 0 23649 63186 35084 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.14 1.14 0.00 0.00 0.0000 0.0000 40133.23 40133.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.81 71.05% 23649.33 21702 37187 6868.97 0 37187 19223 19223 0.00
crit 0.33 28.93% 63185.72 54624 115296 12611.40 0 115296 20911 20911 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (89) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 8.1 60.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.06 8.06 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 9010 3.2% 189.9 2.36sec 21446 0 21446 0 21446 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.89 189.89 0.00 0.00 0.0000 0.0000 4072408.53 4072408.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.89 100.00% 21445.82 8570 376952 21451.05 15625 29455 4072409 4072409 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:58430.66
  • base_dd_max:58430.66
shadow_word_death 10053 3.6% 16.8 5.45sec 271675 262118 201542 435624 271672 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.76 16.76 0.00 0.00 1.0365 0.0000 4552997.99 4552997.99 0.00 262118.48 262118.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.73 70.02% 201542.42 156358 452288 201864.50 156358 288111 2364947 2364947 0.00
crit 5.02 29.97% 435624.38 325785 1130856 434697.68 0 898750 2188051 2188051 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 40680 (62271) 14.5% (22.2%) 128.4 3.48sec 219207 211487 0 0 0 0.0% 0.0% 0.0% 0.0% 457.5 29840 64727 40194 29.7% 0.0% 132.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.40 128.40 457.52 457.52 1.0365 1.3094 18389631.65 18389631.65 0.00 38442.97 211486.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.39 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 321.7 70.32% 29840.15 25710 48430 29850.98 28164 32717 9600415 9600415 0.00
crit 135.8 29.68% 64726.66 53569 121089 64739.81 59031 72195 8789217 8789217 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 21591 7.7% 217.0 2.06sec 44958 0 30303 79674 44987 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 217.04 216.89 0.00 0.00 0.0000 0.0000 9757579.26 9757579.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.34 70.24% 30303.23 26996 48430 30315.06 28358 33351 4616424 4616424 0.00
crit 64.53 29.75% 79673.75 67948 150153 79695.54 72145 90387 5141155 5141155 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 7967 2.8% 200.3 2.23sec 17973 0 15746 34300 21321 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.32 168.86 0.00 0.00 0.0000 0.0000 3600305.24 3600305.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.09 69.93% 15746.45 13769 25133 15751.49 14560 17576 1859489 1859489 0.00
crit 50.75 30.06% 34299.81 28689 62840 34304.54 30675 40813 1740816 1740816 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1286 0.5% 18.0 18.21sec 31753 0 21536 53164 31753 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 0.00 0.00 0.0000 0.0000 570129.85 570129.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.15 67.67% 21535.96 17031 31086 21625.17 17367 30890 261678 261678 0.00
crit 5.80 32.31% 53163.55 35485 77725 52658.63 0 77725 308452 308452 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 19795 (30049) 7.1% (10.7%) 31.5 14.17sec 430748 367009 0 0 0 0.0% 0.0% 0.0% 0.0% 196.0 33634 73394 45584 30.1% 0.0% 78.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.48 31.48 195.99 195.99 1.1737 1.8084 8934051.19 8934051.19 0.00 34647.75 367008.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.48 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.1 69.95% 33633.88 28140 53851 33658.61 30743 37837 4610770 4610770 0.00
crit 58.9 30.05% 73393.54 58633 134645 73417.25 65127 86747 4323281 4323281 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10253 3.7% 92.9 4.71sec 49779 0 33432 88331 49811 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.94 92.88 0.00 0.00 0.0000 0.0000 4626556.98 4626556.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.15 70.15% 33432.41 29548 53851 33449.91 30611 38606 2178194 2178194 0.00
crit 27.72 29.84% 88330.76 74371 166962 88389.09 75994 110266 2448363 2448363 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 89264 / 23316
melee 88997 8.3% 122.2 3.64sec 86026 93162 66291 144695 86025 30.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.16 122.16 0.00 0.00 0.9234 0.0000 10508962.17 10508962.17 0.00 93162.08 93162.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.17 45.98% 66291.43 51896 107094 66371.15 59449 81212 3723710 3723710 0.00
crit 36.71 30.05% 144694.97 103793 257026 144639.43 121955 183644 5312276 5312276 0.00
glance 29.26 23.95% 50338.92 38922 80320 50365.12 43801 64228 1472976 1472976 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.7 19.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.73 23.73 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 268 0.0% 22.5 14.40sec 1381 0 973 2259 1381 31.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.47 22.47 0.00 0.00 0.0000 0.0000 31020.92 31020.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.34 68.25% 972.65 786 1434 975.58 815 1402 14916 14916 0.00
crit 7.13 31.73% 2258.70 1573 3442 2242.22 0 3442 16104 16104 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:821.88
  • base_dd_max:821.88

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.78%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 30.5 3.2 14.1sec 12.7sec 8.78% 53.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.78%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.4 0.0 21.9sec 21.9sec 25.36% 26.99%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.5 0.0 142.1sec 142.1sec 15.13% 15.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.13%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 413.9sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.5sec 41.70% 41.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.70%

    Trigger Attempt Success

    • trigger_pct:99.47%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.5 0.0 11.1sec 11.1sec 16.07% 49.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:16.07%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 8.39%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.9 2.4 47.1sec 37.1sec 24.48% 53.92%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.48%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.7 0.0 58.6sec 58.5sec 16.76% 16.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.76%

    Trigger Attempt Success

    • trigger_pct:99.89%
mindbender-shadowcrawl 23.7 0.0 19.2sec 19.2sec 85.39% 86.32%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.05% 32.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.18% 16.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 20.4 61.1 3.0 3.0 307726.6
halo Mana 9.3 375899.9 40500.0 40501.2 10.6
mind_blast Mana 54.6 207984.6 3811.7 3811.7 63.7
mind_flay Mana 89.3 267941.8 3000.0 3000.0 56.3
mind_sear Mana 0.7 6247.4 9000.0 9000.2 12.3
shadow_word_death Mana 16.8 130721.4 7800.0 7800.1 34.8
shadow_word_pain Mana 128.4 1694949.7 13200.0 13200.0 16.6
vampiric_touch Mana 31.5 283331.2 9000.0 8999.9 47.9
Resource Gains Type Count Total Average Overflow
dispersion Mana 6.82 122698.80 (4.55%) 18000.00 0.00 0.00%
mindbender Mana 122.15 612861.44 (22.71%) 5017.42 26955.34 4.21%
Shadow Orbs from Mind Blast Shadow Orb 54.56 53.86 (86.34%) 0.99 0.70 1.29%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.52 8.52 (13.66%) 1.00 0.00 0.00%
Devouring Plague Health Health 294.41 0.00 (0.00%) 0.00 6267517.22 100.00%
Vampiric Touch Mana Mana 288.88 1426965.51 (52.89%) 4939.73 27640.41 1.90%
halo_heal Health 9.28 0.00 (0.00%) 0.00 2977119.28 100.00%
external_healing Health 55.75 0.00 (0.00%) 0.00 18059858.87 100.00%
mp5_regen Mana 1812.85 535558.46 (19.85%) 295.42 8296.44 1.53%
pet - mindbender
external_healing Health 26.28 0.00 (0.00%) 0.00 8842247.62 100.00%
Resource RPS-Gain RPS-Loss
Mana 5951.69 6545.06
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 31873.53 52.38 242171.43
Shadow Orb 1.29 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.6%
shadowfiend-Mana Cap 1.6%
mindbender-Mana Cap 1.6%

Procs

Count Interval
Shadowy Recall Extra Tick 488.6 0.9sec
Shadowy Apparition Procced 200.3 2.2sec
Divine Insight Mind Blast CD Reset 56.6 12.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 279968.26
Minimum 218121.60
Maximum 342911.53
Spread ( max - min ) 124789.93
Range [ ( max - min ) / 2 * 100% ] 22.29%
Standard Deviation 16506.9722
5th Percentile 252615.31
95th Percentile 306792.81
( 95th Percentile - 5th Percentile ) 54177.50
Mean Distribution
Standard Deviation 104.4160
95.00% Confidence Intervall ( 279763.61 - 280172.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 133
0.1% Error 13354
0.1 Scale Factor Error with Delta=300 2326047
0.05 Scale Factor Error with Delta=300 9304188
0.01 Scale Factor Error with Delta=300 232604711
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 279968.26
Minimum 218121.60
Maximum 342911.53
Spread ( max - min ) 124789.93
Range [ ( max - min ) / 2 * 100% ] 22.29%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 115996150.88
Minimum 73860610.50
Maximum 162906379.94
Spread ( max - min ) 89045769.44
Range [ ( max - min ) / 2 * 100% ] 38.38%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 8.06 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 8.24 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 4.24 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 56.05 mind_blast,if=active_enemies<=5&cooldown_react
F 8.52 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 28.29 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 30.78 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 2.94 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 9.09 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 16.12 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 9.28 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 49.71 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 69.07 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.69 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 45.04 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 97.18 shadow_word_pain,moving=1
a 1.31 dispersion

Sample Sequence

9EIJPWZZZZEWLWZZZZENWZZZZEJWZZEZPIIIJZZZZEJNW9ZEWLZZEZJWZZZZENPWLWIIIEJEJJVEKNWLWEZZZEWZZ9ZEJWPWZZZZEIIIDEZZZEJWZZZZENWLZEZZJWPTEZZZZWTELWII9IJEJJNZEZZELWZZZZEDEWPZZZZEJWZZZZEJNIJJEIIZJWTEWZZ9ENWLPZZEJWZZEZWLIEIIJJJJDEZZZZWELZZZaPZZZ9EJWZENZWIIIJEZZEJTTEWZENWLZPZZEJWZZEZWLIIIE9JJJJDEKZWTTEFCNPZJWEWFCZZZWEDLFCZZZWEIIFCIENJEJWFCEINZW9SF8CPZEZJEDFCWZZZZEWFCLIINIaEFCKJWTEDPFC

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 262687 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
262686.6 262686.6 171.70 / 0.07% 22770 / 8.7% 37.7 6331.3 5722.3 Mana 13.25% 71.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.45 4.99 5.89 4.42 -0.23 4.42
Normalized 1.00 0.77 0.91 0.68 -0.04 0.68
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.24 0.24 0.25 0.24 0.24 0.24
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit ~= Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=6.45, SpellDamage=4.99, HitRating=5.89, CritRating=4.42, HasteRating=-0.23, MasteryRating=4.42 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=6.45, SpellDamage=4.99, HitRating=0.00, CritRating=4.42, HasteRating=-0.23, MasteryRating=4.42 )

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:891370|518913|379744|265299|232611|215600|131305|58659&chds=0,1782740&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++891370++devouring_plague,9482C9,0,0,15|t++518913++halo,9482C9,1,0,15|t++379744++vampiric_touch,9482C9,2,0,15|t++265299++shadow_word_death,9482C9,3,0,15|t++232611++mind_blast,9482C9,4,0,15|t++215600++shadow_word_pain,9482C9,5,0,15|t++131305++mind_flay,9482C9,6,0,15|t++58659++mind_sear,9482C9,7,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:17,10,10,9,9,9,8,6,5,4,4,4,4,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,C79C6E,336600,9482C9,336600,9482C9&chl=shadow_word_pain|mindbender: melee|essence_of_yulon|mind_flay|mind_blast|shadow_word_pain_mastery|vampiric_touch|devouring_plague_tick|mind_flay_mastery|halo_damage|shadow_word_death|vampiric_touch_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadowy_apparition|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.45,5.89,4.99,4.42,4.42,-0.23|6.22,5.64,4.75,4.18,4.17,-0.48|6.69,6.14,5.23,4.66,4.66,0.01&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.45++Int,FFFFFF,0,0,15,0.1,e|t++++5.89++Hit,FFFFFF,0,1,15,0.1,e|t++++4.99++SP,FFFFFF,0,2,15,0.1,e|t++++4.42++Crit,FFFFFF,0,3,15,0.1,e|t++++4.42++Mastery,FFFFFF,0,4,15,0.1,e|t++++-0.23++Haste,FFFFFF,0,5,15,0.1,s&chds=-0.487,7.755& http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:ilortx0347777757530zzywvutrqqqqpppoonmlkpqrssstssttuvwwwxxxxqponmmkkkjihffeedddddddijklmmnnoooommllkjjidcabababbcdefghijjkllmononntuvvwwwvvvwwwvvuttsslkigfddcbZZYXXWWWWXXXYZabcefilmnopqrrrrrqqponmlkhfeddcbaZZZYYYYXXXXWWWVVUVVVUUUUUUUVVWXYZbdefghiklmmnooonnnmlkjihhhghhhiiiiiihhhggffeddcaZYWVVVVVWXYZabcefgijklmnpqrsrrponmlkjigffedcaZYXWWWVVVVVVUUUUTTTTTUVXZadfhikmnqstvwxyyyxxwvusrqpnmkjiihhggffeeeeedddddccbbaaZZaaabbbcdefghjkmnoopqqqqppponmmlkjiihhgfedddccbaaaZZYXWUUTTTTTUVWXYacdfhjmoqstw0356666654320zxwvutqoljhgfeddccbbaaZZYXXXXXYZacefghijkmnopqrrssrrqpoonmlkjhgedccbbaZYXWVUUXYZbbaZYXWUUTSRR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5884,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=262687|max=446449&chxp=1,1,59,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,0,1,10,16,29,45,76,118,188,260,328,447,564,764,851,1022,1234,1318,1336,1474,1534,1581,1455,1490,1363,1197,1104,967,847,670,631,517,392,343,215,157,126,99,78,42,46,24,14,6,5,2,1,1,2&chds=0,1581&chbh=5&chxt=x&chxl=0:|min=214028|avg=262687|max=320929&chxp=0,1,46,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:29.0,26.0,9.4,7.4,3.6,3.6,1.9,1.8,1.3,0.2,13.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 131.4s|mind_flay 117.7s|mind_blast 42.5s|vampiric_touch 33.7s|shadow_word_death 16.5s|devouring_plague 16.3s|halo 8.5s|mindbender 8.4s|dispersion 6.1s|mind_sear 0.8s|waiting 60.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 262687
devouring_plague 9004 (32073) 3.4% (12.2%) 15.7 28.36sec 923902 891370 193853 416795 259298 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.72 15.72 0.00 0.00 1.0365 0.0000 4076546.34 4076546.34 0.00 891370.07 891370.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.10 70.62% 193853.14 173797 327485 193887.98 173797 252690 2152144 2152144 0.00
crit 4.62 29.37% 416795.14 362119 818808 414596.31 0 758090 1924402 1924402 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8045 3.1% 74.5 5.71sec 48891 0 33037 86096 48958 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.53 74.43 0.00 0.00 0.0000 0.0000 3643707.14 3643707.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.08 69.98% 33036.76 28967 54581 33055.91 29272 38699 1720589 1720589 0.00
crit 22.34 30.01% 86096.17 72910 169225 86073.12 74042 115672 1923118 1923118 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 15024 5.7% 15.7 28.36sec 432830 0 0 0 0 0.0% 0.0% 0.0% 0.0% 157.1 32367 69510 43321 29.5% 0.0% 20.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.72 15.72 157.07 157.07 0.0000 0.5953 6804621.76 6804621.76 0.00 72767.36 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.8 70.51% 32367.49 28967 167790 32382.30 29363 61031 3584791 3584791 0.00
crit 46.3 29.49% 69509.74 60355 419524 69484.44 60813 120006 3219831 3219831 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.9 154.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 8.9 0 0 0 0.0% 0.0% 1.2%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.92 1.92 8.88 8.88 3.1868 0.6197 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.9 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 22938 8.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 177.2 25908 56456 34984 29.7% 0.0% 31.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.06 177.17 296.50 0.0000 0.7964 10372758.59 10372758.59 0.00 73511.96 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 208.4 70.28% 25907.73 21627 43522 25916.63 23579 30534 5398486 5398486 0.00
crit 88.1 29.72% 56456.23 45062 108817 56436.69 49647 67395 4974273 4974273 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (9826) 0.0% (3.7%) 8.2 55.84sec 537806 518913 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 518912.61 518912.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.77 70.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.44 29.70% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 9826 3.7% 8.2 55.84sec 537806 0 178859 387523 240259 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 18.38 0.00 0.00 0.0000 0.0000 4415427.42 4415427.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.97 70.56% 178858.79 157064 293078 178969.82 157064 225127 2319522 2319522 0.00
crit 5.41 29.43% 387523.01 327255 732781 385377.30 0 610651 2095906 2095906 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 21840 8.3% 40.7 11.16sec 242630 232611 180869 391473 242631 29.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.71 40.71 0.00 0.00 1.0431 0.0000 9878050.37 9878050.37 0.00 232610.80 232610.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.76 70.65% 180868.55 139099 421507 180881.78 156524 210291 5202499 5202499 0.00
crit 11.94 29.34% 391472.71 289823 1053892 391631.20 292670 566710 4675551 4675551 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 22449 (34193) 8.5% (13.0%) 88.6 4.99sec 174394 131305 0 0 0 0.0% 0.0% 0.0% 0.0% 175.9 42456 93007 57649 30.1% 0.0% 22.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.59 88.59 175.94 175.94 1.3282 0.5671 10143031.38 10143031.38 0.00 131305.31 131305.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.58 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.1 69.95% 42456.45 36858 69446 42490.32 39170 48032 5224951 5224951 0.00
crit 52.9 30.05% 93007.46 76796 173637 93081.75 82773 115859 4918080 4918080 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 11744 4.5% 83.5 5.24sec 63575 0 42492 112797 63607 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.46 83.41 0.00 0.00 0.0000 0.0000 5305695.17 5305695.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.35 69.95% 42491.75 36858 69446 42525.45 38207 48387 2479366 2479366 0.00
crit 25.06 30.04% 112797.42 92771 215313 112894.51 95075 146639 2826330 2826330 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 106 0.0% 0.8 138.97sec 58899 58659 0 0 0 0.0% 0.0% 0.0% 0.0% 0.4 24145 55752 33396 29.3% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.82 0.82 0.36 1.44 1.0052 0.5961 48100.59 48100.59 0.00 58659.26 58659.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.82 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.0 70.73% 24144.73 21702 39047 5127.87 0 39047 24595 24595 0.00
crit 0.4 29.27% 55751.54 45218 97628 10054.33 0 97628 23506 23506 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 55 0.0% 0.7 18.98sec 36996 0 24159 68316 36997 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.68 0.68 0.00 0.00 0.0000 0.0000 25068.89 25068.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.48 70.91% 24159.38 21702 39047 4607.05 0 39047 11607 11607 0.00
crit 0.20 29.08% 68316.23 54624 121061 8627.74 0 121061 13462 13462 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (55) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 8.1 60.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.07 8.07 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 8206 3.1% 177.0 2.54sec 20958 0 20958 0 20958 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.95 176.95 0.00 0.00 0.0000 0.0000 3708642.49 3708642.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.95 100.00% 20958.29 8570 387154 20968.35 15010 30006 3708642 3708642 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:28966.79
  • base_dd_max:28966.79
power_infusion 0 0.0% 4.3 120.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9674 3.7% 15.9 5.69sec 274966 265299 203714 440910 274964 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.95 15.95 0.00 0.00 1.0365 0.0000 4385122.45 4385122.45 0.00 265298.71 265298.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.16 69.95% 203714.12 156358 474903 204118.12 159719 300549 2272454 2272454 0.00
crit 4.79 30.05% 440910.22 325785 1187398 440152.87 0 989499 2112668 2112668 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 40938 (62660) 15.6% (23.9%) 126.8 3.51sec 223468 215600 0 0 0 0.0% 0.0% 0.0% 0.0% 454.4 30210 65644 40724 29.7% 0.0% 126.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.75 126.75 454.44 454.44 1.0365 1.2575 18506859.51 18506859.51 0.00 40300.59 215599.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.74 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 319.6 70.33% 30210.17 25710 50852 30218.10 28346 32806 9655000 9655000 0.00
crit 134.8 29.67% 65644.12 53569 127144 65648.98 59849 75388 8851860 8851860 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 21721 8.3% 215.6 2.07sec 45540 0 30648 80819 45570 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 215.59 215.45 0.00 0.00 0.0000 0.0000 9817970.14 9817970.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.33 70.24% 30647.65 26996 50852 30657.44 28485 34235 4637976 4637976 0.00
crit 64.09 29.75% 80819.29 67948 157661 80835.06 72260 92729 5179994 5179994 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 7991 3.0% 198.9 2.24sec 18153 0 15748 34359 21340 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.94 169.23 0.00 0.00 0.0000 0.0000 3611440.79 3611440.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.34 69.93% 15747.68 13769 25133 15751.99 14592 17668 1863628 1863628 0.00
crit 50.87 30.06% 34358.83 28689 62840 34360.92 30112 40888 1747813 1747813 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1423 0.5% 19.0 17.18sec 33204 0 22393 55806 33204 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.99 18.99 0.00 0.00 0.0000 0.0000 630484.02 630484.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.84 67.62% 22393.19 17031 32641 22504.69 18139 32217 287531 287531 0.00
crit 6.15 32.36% 55806.26 35485 81611 55279.02 0 81611 342953 342953 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 18714 (28392) 7.1% (10.8%) 28.8 15.40sec 444479 379744 0 0 0 0.0% 0.0% 0.0% 0.0% 181.1 34307 75186 46607 30.1% 0.0% 67.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.82 28.82 181.13 181.13 1.1705 1.6964 8441893.94 8441893.94 0.00 37561.34 379743.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.81 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.6 69.91% 34306.60 28140 56544 34339.72 31222 39812 4344168 4344168 0.00
crit 54.5 30.09% 75186.25 58633 141377 75220.25 66387 90142 4097726 4097726 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 9678 3.7% 85.9 5.09sec 50830 0 34011 90347 50865 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.90 85.84 0.00 0.00 0.0000 0.0000 4366108.99 4366108.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.14 70.07% 34011.00 29548 56544 34031.51 31090 39821 2045524 2045524 0.00
crit 25.69 29.92% 90347.06 74371 175310 90408.42 77086 111719 2320585 2320585 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 89030 / 23311
melee 88765 8.9% 122.5 3.63sec 85813 92924 66188 144299 85812 30.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.46 122.46 0.00 0.00 0.9235 0.0000 10508258.90 10508258.90 0.00 92924.37 92924.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.35 46.02% 66188.05 51896 107094 66263.06 59736 79856 3729920 3729920 0.00
crit 36.76 30.02% 144299.01 103793 257026 144255.26 122645 181536 5304311 5304311 0.00
glance 29.33 23.95% 50255.52 38922 80320 50281.60 43974 62780 1474028 1474028 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.8 19.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.79 23.79 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 265 0.0% 22.6 14.30sec 1359 0 961 2222 1359 31.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.61 22.61 0.00 0.00 0.0000 0.0000 30722.12 30722.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.49 68.48% 961.45 786 1434 964.29 811 1397 14889 14889 0.00
crit 7.12 31.51% 2222.21 1573 3442 2205.83 0 3442 15833 15833 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:821.88
  • base_dd_max:821.88

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.40%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 15.7 0.0 28.4sec 28.4sec 26.93% 25.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:26.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.3 0.0 148.8sec 148.8sec 14.51% 14.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.51%

    Trigger Attempt Success

    • trigger_pct:99.92%
jade_serpent_potion 2.0 0.0 413.9sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.5sec 41.72% 41.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.72%

    Trigger Attempt Success

    • trigger_pct:99.45%
power_infusion 4.3 0.0 120.8sec 120.8sec 18.52% 18.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.2 0.0 11.6sec 11.6sec 15.34% 48.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.34%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 9.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.9 2.4 47.1sec 37.2sec 24.45% 44.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.45%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.5 0.0 59.6sec 59.4sec 16.55% 16.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.55%

    Trigger Attempt Success

    • trigger_pct:99.89%
mindbender-shadowcrawl 23.8 0.0 19.2sec 19.2sec 85.39% 86.32%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.07% 32.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.13% 16.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 15.7 47.2 3.0 3.0 307997.2
halo Mana 8.2 302486.7 36843.9 36843.4 14.6
mind_blast Mana 40.7 351198.4 8626.3 8626.3 28.1
mind_flay Mana 88.6 253317.1 2859.5 2859.6 61.0
mind_sear Mana 0.8 7249.2 8876.5 8876.7 6.6
shadow_word_death Mana 15.9 118952.6 7458.6 7458.8 36.9
shadow_word_pain Mana 126.7 1590202.5 12546.1 12545.9 17.8
vampiric_touch Mana 28.8 246773.7 8563.9 8563.8 51.9
Resource Gains Type Count Total Average Overflow
dispersion Mana 8.88 159858.72 (6.16%) 18000.00 0.00 0.00%
mindbender Mana 122.44 602918.75 (23.24%) 4924.06 38451.86 6.00%
Shadow Orbs from Mind Blast Shadow Orb 40.71 40.26 (83.15%) 0.99 0.45 1.10%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.16 8.16 (16.85%) 1.00 0.00 0.00%
Devouring Plague Health Health 231.50 0.00 (0.00%) 0.00 4928334.29 100.00%
Vampiric Touch Mana Mana 266.96 1299807.63 (50.11%) 4868.84 44465.25 3.31%
halo_heal Health 8.21 0.00 (0.00%) 0.00 2608159.65 100.00%
external_healing Health 56.82 0.00 (0.00%) 0.00 18408294.23 100.00%
mp5_regen Mana 1812.85 531502.65 (20.49%) 293.19 12352.25 2.27%
pet - mindbender
external_healing Health 26.15 0.00 (0.00%) 0.00 8795400.72 100.00%
Resource RPS-Gain RPS-Loss
Mana 5722.29 6331.31
Shadow Orb 0.11 0.10
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 24340.01 8.57 226330.48
Shadow Orb 1.27 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.4%
shadowfiend-Mana Cap 2.4%
mindbender-Mana Cap 2.4%

Procs

Count Interval
Shadowy Recall Extra Tick 459.8 1.0sec
Shadowy Apparition Procced 198.9 2.2sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 262686.62
Minimum 214028.40
Maximum 320928.95
Spread ( max - min ) 106900.55
Range [ ( max - min ) / 2 * 100% ] 20.35%
Standard Deviation 13849.4403
5th Percentile 240657.38
95th Percentile 286197.09
( 95th Percentile - 5th Percentile ) 45539.71
Mean Distribution
Standard Deviation 87.6056
95.00% Confidence Intervall ( 262514.92 - 262858.32 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10677
0.1 Scale Factor Error with Delta=300 1637374
0.05 Scale Factor Error with Delta=300 6549499
0.01 Scale Factor Error with Delta=300 163737485
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 262686.62
Minimum 214028.40
Maximum 320928.95
Spread ( max - min ) 106900.55
Range [ ( max - min ) / 2 * 100% ] 20.35%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 108181529.99
Minimum 72292447.54
Maximum 151287772.71
Spread ( max - min ) 78995325.17
Range [ ( max - min ) / 2 * 100% ] 36.51%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 8.07 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 7.79 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.82 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 41.36 mind_blast,if=active_enemies<=5&cooldown_react
F 8.16 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 26.83 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 30.04 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 2.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 5.40 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.90 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.21 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 69.97 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 163.85 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.82 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 42.92 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 97.42 shadow_word_pain,moving=1
a 1.92 dispersion

Sample Sequence

9BEIJPWZZZZEWLWZZZZENWZZZZEJWZZZZEIIIJJPZZZEJNW9ZZZEWZZZZEJWZZZZENWIIIEJJJJPKZZZEWLZZZZEJNWZ9BZZEWZZZZEIIIJJPZZZENWZZZZEWTTTTTTTTTTTTTTTTTTTTEaKZZZJENWII9IEJJJLPKZZZEWZZZLENWZZTEWZZZTTTTTTTWWWTTTTTTTTTTTTTTTTTTTTTTTTTTTE9BIJWENPZZZWTELWZZZZWEWIIIZJEJNJJZZWEWLZZWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTE9ZJWEWPZZWIIEIJNZZaZZZZEJWZZZZEWLZPZZEJNWII9BEIJJJVKZZZEJWFCNZZEWSFCZPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSEDSSSSSFWWWSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSS9CENI8WZZFCTTTTTTTEJWZFDCEWIIFaCIPZEJNWFCZZZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 252207 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
252207.0 252207.0 194.95 / 0.08% 25660 / 10.2% 37.1 6154.1 5535.3 Mana 17.16% 74.7 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.30 4.50 5.58 4.03 -1.32 4.18
Normalized 1.00 0.71 0.89 0.64 -0.21 0.66
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.27 0.27 0.27 0.27 0.28 0.27
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Mastery ~= Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=6.30, SpellDamage=4.50, HitRating=5.58, CritRating=4.03, HasteRating=-1.32, MasteryRating=4.18 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=6.30, SpellDamage=4.50, HitRating=0.00, CritRating=4.03, HasteRating=-1.32, MasteryRating=4.18 )

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:926237|479627|383973|302147|239020|220328|127997|61674&chds=0,1852475&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++926237++devouring_plague,9482C9,0,0,15|t++479627++halo,9482C9,1,0,15|t++383973++vampiric_touch,9482C9,2,0,15|t++302147++shadow_word_death,9482C9,3,0,15|t++239020++mind_blast,9482C9,4,0,15|t++220328++shadow_word_pain,9482C9,5,0,15|t++127997++mind_flay,9482C9,6,0,15|t++61674++mind_sear,9482C9,7,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:17,10,10,10,9,9,7,7,5,5,4,4,4,4,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,C79C6E,336600,9482C9,336600,9482C9&chl=shadow_word_pain|mindbender: melee|essence_of_yulon|mind_flay|mind_blast|shadow_word_pain_mastery|vampiric_touch|devouring_plague_tick|mind_flay_mastery|shadow_word_death|devouring_plague|vampiric_touch_mastery|devouring_plague_mastery|halo_damage|multistrike_spell|shadowy_apparition|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.30,5.58,4.50,4.18,4.03,-1.32|6.03,5.31,4.22,3.91,3.76,-1.59|6.57,5.86,4.77,4.46,4.31,-1.04&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.30++Int,FFFFFF,0,0,15,0.1,e|t++++5.58++Hit,FFFFFF,0,1,15,0.1,e|t++++4.50++SP,FFFFFF,0,2,15,0.1,e|t++++4.18++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.03++Crit,FFFFFF,0,4,15,0.1,e|t++++-1.32++Haste,FFFFFF,0,5,15,0.1,s&chds=-1.603,7.569& http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkmqtwz2356655354210zyywuusrttstsssrrqpnuvwxxxyxyyyz11222222vttsrqpponmljiihhhhhhhgmnpqqqssssssrqqpoonmgfdededeefggijjkklmmnopoponqqqqqpppoppppoomnmmlihgfedcbaZYXXWWWWWWWXXYabdfhknpqrtuvwwwwwwvutrqomkjigfedcccbbbaaaaZZZZYXXXXXWVVVUUUVVWWXYZbcefghjklmnoonnnnmlkjihggffffffeedddcccbbaaaZYYWVUVVVWXYZbdfgijkloqrsuvxz0110zywvutsrpponmkjhfedddccccbbbaaaZZZZZaacegikmnprsuwxyz011110zywutsrqpnlkjjihhggfffeeeddcdcbbaaaaaabccdefgikmnpsuvxyz111100zzyxwvvutsrrqponnmmlkkjjjihgedcbbbbbcdefgijklnprtvxz0257877654321zywvtsqomkigfeddccbbaaZYYYXXXXXZacegjklmoqsuwyz0122210zyxwwvusrpnlkjihgffdbaYXXWWXXWUTSRPPNMLK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6312,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=252207|max=399557&chxp=1,1,63,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,3,5,8,14,31,58,89,131,219,305,412,610,786,907,1062,1219,1401,1501,1595,1582,1516,1460,1447,1347,1191,1098,928,823,686,574,506,365,292,222,147,129,104,67,63,25,19,15,14,5,5,2,2,0,1&chds=0,1595&chbh=5&chxt=x&chxl=0:|min=198265|avg=252207|max=322475&chxp=0,1,43,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:26.4,26.0,9.1,6.6,3.5,3.5,1.8,1.7,1.5,0.1,17.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 119.7s|mind_flay 118.1s|mind_blast 41.0s|vampiric_touch 30.0s|shadow_word_death 15.9s|devouring_plague 15.8s|mindbender 8.4s|halo 7.6s|dispersion 7.0s|mind_sear 0.7s|waiting 77.8s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 252207
devouring_plague 9229 (32284) 3.7% (12.8%) 15.2 29.36sec 959993 926237 204874 442031 274462 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 15.22 0.00 0.00 1.0365 0.0000 4177196.78 4177196.78 0.00 926237.34 926237.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.75 70.64% 204874.27 173797 358674 204888.09 173797 253529 2202526 2202526 0.00
crit 4.47 29.35% 442031.37 362119 896790 439978.37 0 747325 1974670 1974670 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8070 3.2% 70.5 6.04sec 51806 0 34988 91423 51875 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.49 70.40 0.00 0.00 0.0000 0.0000 3651909.02 3651909.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.32 70.06% 34988.13 28967 59780 35005.89 30528 41883 1725671 1725671 0.00
crit 21.07 29.93% 91422.74 72910 185342 91407.09 74797 121111 1926238 1926238 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 14985 6.0% 15.2 29.36sec 445575 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.6 34088 73381 45634 29.4% 0.0% 20.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 15.22 148.60 148.60 0.0000 0.6087 6781361.94 6781361.94 0.00 74966.14 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.9 70.62% 34087.87 28967 84586 34101.83 30721 40901 3577057 3577057 0.00
crit 43.7 29.38% 73380.69 60355 176242 73348.12 63114 92877 3204305 3204305 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 2.1 150.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 10.1 0 0 0 0.0% 0.0% 1.4%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.14 2.14 10.13 10.13 3.2563 0.6218 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.1 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 22278 8.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 169.1 26982 58799 36435 29.7% 0.0% 29.7%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.36 169.07 276.42 0.0000 0.7968 10071105.98 10071105.98 0.00 74760.83 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.3 70.28% 26982.34 21627 47667 26992.66 24222 31198 5241647 5241647 0.00
crit 82.1 29.71% 58798.68 45062 119180 58780.36 51374 70608 4829459 4829459 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8095) 0.0% (3.2%) 7.3 60.36sec 497094 479627 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 479627.39 479627.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.12 70.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.17 29.71% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8095 3.2% 7.3 60.36sec 497094 0 179794 386778 240642 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 15.06 0.00 0.00 0.0000 0.0000 3623584.96 3623584.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.63 70.59% 179793.77 157064 320990 179915.21 157064 259995 1911086 1911086 0.00
crit 4.43 29.40% 386777.71 327255 802570 382250.75 0 654532 1712499 1712499 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 21700 8.6% 39.3 11.56sec 249706 239020 186163 403194 249708 29.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.29 39.29 0.00 0.00 1.0447 0.0000 9810320.68 9810320.68 0.00 239019.61 239019.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.78 70.70% 186162.65 139099 461650 186173.10 160439 219195 5171056 5171056 0.00
crit 11.51 29.29% 403193.72 289823 1154262 403424.22 289823 623444 4639265 4639265 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 21953 (33434) 8.7% (13.3%) 86.7 5.10sec 174239 127997 0 0 0 0.0% 0.0% 0.0% 0.0% 168.4 43524 94866 58917 30.0% 0.0% 22.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.74 86.74 168.44 168.44 1.3613 0.5927 9923951.93 9923951.93 0.00 127997.25 127997.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.73 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.9 70.02% 43523.71 36858 76060 43545.22 40024 48281 5133015 5133015 0.00
crit 50.5 29.98% 94865.98 76796 190174 94915.49 83429 113084 4790937 4790937 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 11481 4.6% 79.9 5.48sec 64936 0 43585 115146 64971 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.92 79.88 0.00 0.00 0.0000 0.0000 5189578.92 5189578.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.99 70.10% 43585.02 36858 76060 43609.85 39197 49352 2440330 2440330 0.00
crit 23.88 29.89% 115145.90 92771 235819 115215.71 97350 148669 2749248 2749248 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 91 0.0% 0.7 129.05sec 62759 61674 0 0 0 0.0% 0.0% 0.0% 0.0% 0.3 24484 58757 34568 29.4% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.65 0.65 0.30 1.18 1.0191 0.6140 40951.82 40951.82 0.00 61674.42 61674.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.65 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 70.57% 24483.54 21702 42765 4314.85 0 42765 20469 20469 0.00
crit 0.3 29.43% 58757.23 45218 106926 8843.25 0 106926 20482 20482 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 48 0.0% 0.6 13.64sec 38467 0 24457 72407 38466 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.56 0.56 0.00 0.00 0.0000 0.0000 21643.70 21643.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.40 70.75% 24456.56 21702 42765 3919.03 0 42765 9736 9736 0.00
crit 0.16 29.23% 72407.04 54624 132590 7762.58 0 132590 11908 11908 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (48) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 8.1 60.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.07 8.07 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 7887 3.1% 162.4 2.75sec 21941 0 21941 0 21941 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.37 162.37 0.00 0.00 0.0000 0.0000 3562641.56 3562641.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.37 100.00% 21940.74 8570 433495 21951.30 15404 31125 3562642 3562642 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:92154.28
  • base_dd_max:92154.28
shadow_word_death 10603 4.2% 15.3 5.92sec 313168 302147 231986 502539 313166 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.34 15.34 0.00 0.00 1.0365 0.0000 4804134.86 4804134.86 0.00 302146.85 302146.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.73 69.98% 231986.22 156358 520132 232415.52 180601 355538 2490309 2490309 0.00
crit 4.60 30.01% 502539.41 374653 1300484 500720.24 0 1231559 2313826 2313826 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 38175 (58409) 15.1% (23.1%) 115.5 3.84sec 228368 220328 0 0 0 0.0% 0.0% 0.0% 0.0% 410.4 31166 67697 42004 29.7% 0.0% 118.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.48 115.48 410.38 410.38 1.0365 1.3055 17237537.97 17237537.97 0.00 40236.59 220328.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.47 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.6 70.33% 31166.08 25710 55695 31173.29 28677 34246 8995458 8995458 0.00
crit 121.8 29.67% 67696.71 53569 139253 67694.09 61348 76286 8242080 8242080 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20234 8.0% 194.6 2.29sec 46936 0 31616 83239 46964 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 194.62 194.50 0.00 0.00 0.0000 0.0000 9134647.00 9134647.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.64 70.25% 31616.26 26996 55695 31625.97 29058 34796 4320051 4320051 0.00
crit 57.84 29.74% 83239.04 67948 172676 83243.15 73582 96815 4814596 4814596 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 7267 2.9% 179.6 2.47sec 18269 0 15724 34299 21302 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.59 154.02 0.00 0.00 0.0000 0.0000 3281025.66 3281025.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.74 69.95% 15724.46 13769 25133 15728.22 14560 17488 1694142 1694142 0.00
crit 46.27 30.04% 34298.65 28689 62840 34297.93 30331 40942 1586883 1586883 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1271 0.5% 17.2 19.01sec 32601 0 22203 54414 32601 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 0.00 0.00 0.0000 0.0000 561742.81 561742.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.67 67.70% 22203.27 17031 35749 22295.05 17737 32013 259012 259012 0.00
crit 5.56 32.29% 54413.82 35485 77725 53891.13 0 77725 302731 302731 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 16789 (25530) 6.6% (10.1%) 25.7 17.29sec 448650 383973 0 0 0 0.0% 0.0% 0.0% 0.0% 159.3 35019 76610 47526 30.1% 0.0% 62.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.66 25.66 159.28 159.28 1.1685 1.7913 7570064.34 7570064.34 0.00 36507.41 383972.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.66 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.4 69.93% 35019.47 28140 61929 35030.67 31151 40518 3900707 3900707 0.00
crit 47.9 30.07% 76610.27 58633 154841 76601.53 66223 91712 3669358 3669358 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 8741 3.5% 75.5 5.74sec 52196 0 34976 92719 52228 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.50 75.46 0.00 0.00 0.0000 0.0000 3941051.38 3941051.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.90 70.11% 34976.17 29548 61929 34980.19 30907 40214 1850237 1850237 0.00
crit 22.55 29.88% 92718.85 74371 192006 92740.83 76774 116418 2090814 2090814 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 88990 / 23309
melee 88726 9.2% 122.5 3.63sec 85767 92874 66213 144376 85767 29.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.50 122.50 0.00 0.00 0.9235 0.0000 10506634.54 10506634.54 0.00 92873.86 92873.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.39 46.03% 66212.51 51896 107094 66287.80 58666 79184 3733864 3733864 0.00
crit 36.66 29.93% 144376.28 103793 257026 144347.15 121327 184920 5292983 5292983 0.00
glance 29.44 24.03% 50270.08 38922 80320 50296.97 43626 62775 1479787 1479787 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.8 19.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.80 23.80 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 264 0.0% 22.5 14.36sec 1362 0 964 2226 1362 31.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.53 22.53 0.00 0.00 0.0000 0.0000 30692.57 30692.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.41 68.39% 963.69 786 1434 966.69 810 1388 14848 14848 0.00
crit 7.12 31.60% 2225.78 1573 3442 2210.24 0 3442 15844 15844 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:821.88
  • base_dd_max:821.88

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 15.2 0.0 29.3sec 29.3sec 26.53% 25.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:26.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.3 0.0 152.3sec 152.3sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.25%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 413.9sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.8 6.6 36.4sec 23.5sec 41.75% 41.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.75%

    Trigger Attempt Success

    • trigger_pct:99.54%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 12.0sec 12.0sec 14.84% 48.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.84%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 9.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.9 2.4 47.1sec 37.3sec 24.46% 53.86%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.46%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.4 0.0 60.7sec 60.4sec 16.29% 16.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.29%

    Trigger Attempt Success

    • trigger_pct:99.87%
twist_of_fate 1.0 281.7 65.4sec 0.6sec 37.65% 37.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:37.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-shadowcrawl 23.8 0.0 19.2sec 19.2sec 85.39% 86.32%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.06% 32.17%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.13% 16.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 15.2 45.7 3.0 3.0 320015.9
halo Mana 7.3 295230.4 40500.0 40500.6 12.3
mind_blast Mana 39.3 353589.5 9000.0 9000.1 27.7
mind_flay Mana 86.7 260222.4 3000.0 3000.0 58.1
mind_sear Mana 0.7 5872.3 9000.0 8999.3 7.0
shadow_word_death Mana 15.3 119657.3 7800.0 7800.1 40.1
shadow_word_pain Mana 115.5 1524359.2 13200.0 13200.1 17.3
vampiric_touch Mana 25.7 230913.0 9000.0 8999.9 49.9
Resource Gains Type Count Total Average Overflow
dispersion Mana 10.13 182272.32 (7.26%) 18000.00 0.00 0.00%
mindbender Mana 122.49 618764.02 (24.66%) 5051.53 22852.15 3.56%
Shadow Orbs from Mind Blast Shadow Orb 39.28 38.97 (83.16%) 0.99 0.31 0.80%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.89 7.89 (16.84%) 1.00 0.00 0.00%
Devouring Plague Health Health 219.00 0.00 (0.00%) 0.00 4662263.98 100.00%
Vampiric Touch Mana Mana 234.74 1169189.37 (46.59%) 4980.75 12885.75 1.09%
halo_heal Health 7.29 0.00 (0.00%) 0.00 2413363.33 100.00%
external_healing Health 57.74 0.00 (0.00%) 0.00 18614418.62 100.00%
mp5_regen Mana 1812.85 539083.26 (21.48%) 297.37 4771.64 0.88%
pet - mindbender
external_healing Health 26.15 0.00 (0.00%) 0.00 8791770.83 100.00%
Resource RPS-Gain RPS-Loss
Mana 5535.27 6154.10
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 19101.62 42.86 213100.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.9%
shadowfiend-Mana Cap 0.9%
mindbender-Mana Cap 0.9%

Procs

Count Interval
Shadowy Recall Extra Tick 420.8 1.1sec
Shadowy Apparition Procced 179.6 2.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 252206.95
Minimum 198264.85
Maximum 322475.14
Spread ( max - min ) 124210.28
Range [ ( max - min ) / 2 * 100% ] 24.62%
Standard Deviation 15724.3709
5th Percentile 227968.93
95th Percentile 279289.02
( 95th Percentile - 5th Percentile ) 51320.08
Mean Distribution
Standard Deviation 99.4656
95.00% Confidence Intervall ( 252012.00 - 252401.90 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 149
0.1% Error 14932
0.1 Scale Factor Error with Delta=300 2110718
0.05 Scale Factor Error with Delta=300 8442872
0.01 Scale Factor Error with Delta=300 211071807
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 252206.95
Minimum 198264.85
Maximum 322475.14
Spread ( max - min ) 124210.28
Range [ ( max - min ) / 2 * 100% ] 24.62%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 103384451.32
Minimum 67402610.68
Maximum 145987710.18
Spread ( max - min ) 78585099.49
Range [ ( max - min ) / 2 * 100% ] 38.01%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 8.07 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 7.45 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.93 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 40.06 mind_blast,if=active_enemies<=5&cooldown_react
F 7.89 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 25.41 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 26.51 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 2.24 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 5.14 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.28 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 7.29 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 82.61 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 199.80 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.65 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 45.17 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 87.84 shadow_word_pain,moving=1
a 2.14 dispersion

Sample Sequence

9EIJPWZZZZEWLWZZZZENWZZZZEJWZZZZEIIIJPZZZEJNW9ZZEWLZZZZEJWZZZZENWIIIPEJJJJVKZZZEWZZZZENW9ZEWJWZZZZEIJWJIIZZENWWTTTTTTTTTTTTTTTTTTTTTTTTTEaKPJTTTTTTTTTEWZZWENLWI9IIEJJJKZZZZEJWZZZZENWLZZZEWTTTTTTTTTTWEWW9EJNIWZZZZEWPWZTTTTTEWWWTTTTTENaIZZZEJWZZZ9EWPLZZZZEINIWEWWTTTTTTTTTTTTTTTTTEWWTTTTTTTTTTTTTTTTTTTTTTTTTTTENWTTTTTTTTTTTTTTTTTTTT9EIWJIZZEWPFDCZTTTTTTTTTEWSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTWFDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC9EWJSF8CIZZTTTENWFCZZZZTTEWSSSSSSSSSSSSSSSSSSSSSSSSSSFDWWSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 234785 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
234785.3 234785.3 284.78 / 0.12% 37838 / 16.1% 44.6 5029.6 4412.9 Mana 19.89% 77.2 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 5.93 4.58 6.73 4.07 1.67 5.33
Normalized 1.00 0.77 1.13 0.69 0.28 0.90
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.40 0.40 0.40 0.40 0.40 0.40
Gear Ranking
Optimizers
Ranking
  • Hit > Int > Mastery > SP > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=5.93, SpellDamage=4.58, HitRating=6.73, CritRating=4.07, HasteRating=1.67, MasteryRating=5.33 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=5.93, SpellDamage=4.58, HitRating=0.00, CritRating=4.07, HasteRating=1.67, MasteryRating=5.33 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:889787|403550|384795|258774|226204|222259|218305|125341|93858&chds=0,1779575&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++889787++devouring_plague,9482C9,0,0,15|t++403550++halo,9482C9,1,0,15|t++384795++vampiric_touch,9482C9,2,0,15|t++258774++shadow_word_death,9482C9,3,0,15|t++226204++mind_blast,9482C9,4,0,15|t++222259++shadow_word_pain,9482C9,5,0,15|t++218305++mind_flay_insanity,9482C9,6,0,15|t++125341++mind_flay,9482C9,7,0,15|t++93858++mind_sear,9482C9,8,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,11,9,7,7,7,7,6,4,4,4,4,3,3,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|essence_of_yulon|shadow_word_pain_mastery|devouring_plague_tick|mind_flay_insanity|mind_flay|vampiric_touch|devouring_plague|shadowfiend: melee|devouring_plague_mastery|mind_flay_insanity_mastery|multistrike_spell|mind_flay_mastery|shadow_word_death|vampiric_touch_mastery|shadowy_apparition|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.73,5.93,5.33,4.58,4.07,1.67|6.33,5.53,4.93,4.18,3.67,1.27|7.13,6.33,5.73,4.97,4.46,2.08&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.73++Hit,FFFFFF,0,0,15,0.1,e|t++++5.93++Int,FFFFFF,0,1,15,0.1,e|t++++5.33++Mastery,FFFFFF,0,2,15,0.1,e|t++++4.58++SP,FFFFFF,0,3,15,0.1,e|t++++4.07++Crit,FFFFFF,0,4,15,0.1,e|t++++1.67++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.087& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gkmoqtx02568776754321zzyywvuutttssssrrqpsuwyzz0zyyyxxxwvvuttqnkiggffggggggfffffffffijkklmnnoopppppppppolkkjihgfeeeddddddddddddddeeefgijjjjjjiiiiiiihhhgfecbbbbbaaaaaaaaaaaaabcefhiknoqsttuvvwwxwwvusrpomkihhgffeeeeedddddddddeefggffeeeeedddccbbaZYXWWWWWWVVVVVVVVVVVVVWWXXYYZZZZZZZZZZZYZZYYXXWVVVVVVWWWWXXXXXXXYYZZZaaaaaaaZZZZZZZZYYXWWVVVUUUUUUUUUTTTTTTTTTUVXXZbcegjmopqstuvwxxwwvutsrqomlkjihhhggggfffffeeeeeeeedddccccccbbaaZZZZYYYYYYYYYXXXXXXXXYYYYYYYYYYYYYYYYYYYZZZZYYXXWWWWWWWWWWWWVVVUUVVVWWWWWWWWWWVWWWWWWWWWVUUUUUUUUVVVVVUUUTTUUUUUVWXYaabdfiloqrtuvwxyyyyxwwwvusqonmlkjjjiihggfedbaYXXYYZYWVTRPONNLJ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5467,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=234785|max=429469&chxp=1,1,55,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,7,13,19,38,79,115,166,260,331,453,641,707,867,1004,1179,1299,1323,1411,1410,1462,1453,1434,1407,1237,1069,1031,847,779,669,484,452,361,283,223,159,114,72,52,28,19,12,7,5,2,3,1,1,0,1&chds=0,1462&chbh=5&chxt=x&chxl=0:|min=161638|avg=234785|max=336021&chxp=0,1,42,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:21.5,18.1,11.1,10.7,5.3,3.9,3.0,1.7,1.5,0.7,0.1,19.9&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 97.6s|mind_flay 82.0s|mind_flay_insanity 50.5s|mind_blast 48.5s|vampiric_touch 24.1s|devouring_plague 17.8s|shadow_word_death 13.4s|dispersion 7.9s|halo 6.9s|shadowfiend 3.2s|mind_sear 0.3s|waiting 90.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 234785
devouring_plague 9965 (35056) 4.3% (15.0%) 17.2 25.94sec 922237 889787 194221 423986 262217 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.16 17.16 0.00 0.00 1.0365 0.0000 4498929.98 4498929.98 0.00 889787.36 889787.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.08 70.39% 194221.35 173797 311890 194209.76 173797 237255 2345674 2345674 0.00
crit 5.08 29.60% 423986.43 362119 779817 422610.95 0 779817 2153256 2153256 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8713 3.7% 80.1 5.32sec 49091 0 32986 86774 49143 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.11 80.03 0.00 0.00 0.0000 0.0000 3932903.63 3932903.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.97 69.94% 32985.92 28967 51982 33001.03 29544 38161 1846343 1846343 0.00
crit 24.05 30.05% 86773.70 72910 161167 86763.13 73618 123403 2086561 2086561 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16378 7.0% 17.2 25.94sec 430794 0 0 0 0 0.0% 0.0% 0.0% 0.0% 168.8 32506 70461 43780 29.7% 0.0% 22.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.16 17.16 168.83 168.83 0.0000 0.6052 7391255.03 7391255.03 0.00 72340.59 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.7 70.29% 32505.85 28967 85799 32516.80 29028 53188 3857633 3857633 0.00
crit 50.2 29.71% 70460.61 60355 191263 70412.83 61413 124849 3533622 3533622 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 2.3 146.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 11.6 0 0 0 0.0% 0.0% 1.6%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.30 2.30 11.64 11.64 3.4423 0.6216 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.6 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20730 8.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 166.3 25651 55939 34669 29.8% 0.0% 29.2%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 33.89 166.28 270.20 0.0000 0.7962 9367771.54 9367771.54 0.00 70756.77 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.7 70.21% 25650.84 22500 41449 25665.67 23338 29549 4866389 4866389 0.00
crit 80.5 29.78% 55938.54 46880 103635 55927.39 49515 66264 4501382 4501382 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6262) 0.0% (2.6%) 6.7 65.55sec 418227 403550 0 0 0 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 403549.82 403549.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.68 69.81% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.02 30.17% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6262 2.6% 6.7 65.55sec 418227 0 179190 391785 242476 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 11.56 0.00 0.00 0.0000 0.0000 2802249.92 2802249.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.11 70.21% 179190.33 157064 279122 180028.90 0 279122 1453990 1453990 0.00
crit 3.44 29.78% 391785.37 327255 697887 381095.62 0 683930 1348260 1348260 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 24317 10.4% 46.0 9.67sec 238493 226204 177609 385498 238493 29.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.98 45.98 0.00 0.00 1.0543 0.0000 10965256.99 10965256.99 0.00 226204.37 226204.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.50 70.69% 177609.10 139099 401435 177511.51 150286 207790 5772917 5772917 0.00
crit 13.47 29.29% 385498.43 289823 1003706 385396.00 289823 607119 5192340 5192340 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14918 (22714) 6.4% (9.7%) 58.0 7.37sec 177151 125341 0 0 0 0.0% 0.0% 0.0% 0.0% 119.1 41754 91554 56668 29.9% 0.0% 15.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.01 58.01 119.12 119.12 1.4134 0.5896 6750112.11 6750112.11 0.00 125341.31 125341.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.00 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.4 70.05% 41754.31 36858 66140 41794.23 37751 48193 3484130 3484130 0.00
crit 35.7 29.95% 91553.90 76796 165368 91633.99 79255 119875 3265982 3265982 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 16093 (24432) 6.9% (10.4%) 34.4 12.47sec 320310 218305 0 0 0 0.0% 0.0% 0.0% 0.0% 70.3 76512 165330 103245 30.1% 0.0% 9.4%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.42 34.42 70.35 70.35 1.4673 0.6047 7263362.36 7263362.36 0.00 218305.30 218305.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.42 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.2 69.90% 76511.86 36858 132279 76573.99 60360 96447 3762505 3762505 0.00
crit 21.2 30.10% 165330.22 76796 330737 165262.55 105708 226047 3500857 3500857 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 8339 3.6% 33.4 12.69sec 112600 0 76071 198551 112725 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.41 33.38 0.00 0.00 0.0000 0.0000 3762365.28 3762365.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.38 70.06% 76071.28 36858 132279 76132.01 55443 101130 1778738 1778738 0.00
crit 9.99 29.93% 198550.67 92771 410120 198468.24 0 335260 1983627 1983627 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 7796 3.3% 56.5 7.45sec 62398 0 41698 110885 62420 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.51 56.49 0.00 0.00 0.0000 0.0000 3526120.77 3526120.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.56 70.03% 41697.76 36858 66140 41739.70 37471 49240 1649637 1649637 0.00
crit 16.92 29.96% 110885.27 92771 205060 111017.14 92771 164061 1876484 1876484 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 73 0.0% 0.3 129.12sec 102918 93858 0 0 0 0.0% 0.0% 0.0% 0.0% 0.3 23587 52327 32041 29.4% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.32 0.32 0.25 1.01 1.0993 0.6147 32474.73 32474.73 0.00 93857.60 93857.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.32 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.7 70.58% 23587.27 21702 37187 3427.66 0 37187 16872 16872 0.00
crit 0.3 29.42% 52326.88 45218 92979 6575.93 0 92979 15602 15602 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 38 0.0% 0.5 7.43sec 35249 0 23574 63753 35244 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.48 0.48 0.00 0.00 0.0000 0.0000 16934.91 16934.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.34 70.94% 23573.89 21702 37187 3085.89 0 37187 8035 8035 0.00
crit 0.14 29.06% 63752.87 54624 115296 5619.86 0 115296 8900 8900 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (38) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 7850 3.3% 155.6 2.87sec 22736 0 22736 0 22736 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 155.59 155.59 0.00 0.00 0.0000 0.0000 3537479.23 3537479.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 155.59 100.00% 22735.68 8570 376952 22758.71 15544 33224 3537479 3537479 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:87013.99
  • base_dd_max:87013.99
shadow_word_death 7687 3.3% 12.9 7.01sec 268216 258774 199059 432102 268220 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.93 12.93 0.00 0.00 1.0365 0.0000 3468341.56 3468341.56 0.00 258773.53 258773.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.09 70.31% 199058.81 156358 452288 199065.16 156358 297492 1809711 1809711 0.00
crit 3.84 29.68% 432101.99 325785 1130856 425334.66 0 1070921 1658630 1658630 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31494 (48194) 13.4% (20.5%) 94.1 4.55sec 230370 222259 0 0 0 0.0% 0.0% 0.0% 0.0% 351.3 29871 65168 40346 29.7% 0.0% 102.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.15 94.15 351.29 351.29 1.0365 1.3235 14173406.96 14173406.96 0.00 38555.97 222258.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.14 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 247.0 70.32% 29871.40 25710 48430 29884.90 27676 33495 7379408 7379408 0.00
crit 104.3 29.68% 65167.55 53569 121089 65194.92 58571 75294 6793999 6793999 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 16700 7.1% 166.7 2.59sec 45088 0 30283 80163 45113 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.67 166.58 0.00 0.00 0.0000 0.0000 7514828.59 7514828.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.02 70.25% 30282.96 26996 48430 30295.57 27843 33457 3543799 3543799 0.00
crit 49.54 29.74% 80163.38 67948 150153 80203.55 70661 95100 3971029 3971029 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.1 180.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 3.09 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6263 2.7% 153.8 2.80sec 18327 0 15741 34461 21365 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.79 131.92 0.00 0.00 0.0000 0.0000 2818516.91 2818516.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.26 69.94% 15741.36 13769 25133 15745.62 14431 18046 1452314 1452314 0.00
crit 39.65 30.05% 34460.58 28689 62840 34471.00 29874 41379 1366203 1366203 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1237 0.5% 17.1 19.04sec 32061 0 21669 53746 32061 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.13 17.13 0.00 0.00 0.0000 0.0000 549341.77 549341.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.58 67.58% 21668.61 17031 31086 21784.60 17031 31086 250916 250916 0.00
crit 5.55 32.41% 53745.52 35485 77725 53282.96 0 77725 298425 298425 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:18461.88
  • base_dd_max:18461.88
vampiric_touch 13626 (20700) 5.8% (8.8%) 21.2 19.36sec 438089 384795 0 0 0 0.0% 0.0% 0.0% 0.0% 133.3 33750 74100 45894 30.1% 0.0% 52.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.21 21.21 133.26 133.26 1.1385 1.7828 6115923.69 6115923.69 0.00 35498.63 384795.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.21 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.2 69.90% 33749.79 28140 53851 33795.98 29784 40253 3143854 3143854 0.00
crit 40.1 30.10% 74099.73 58633 134645 74180.29 62579 93357 2972070 2972070 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 7074 3.0% 63.2 6.30sec 50245 0 33555 89422 50268 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.19 63.16 0.00 0.00 0.0000 0.0000 3174955.44 3174955.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.25 70.07% 33554.61 29548 53851 33589.78 29864 39706 1484946 1484946 0.00
crit 18.90 29.92% 89421.67 74371 166962 89590.28 74704 129419 1690009 1690009 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 114219 / 9232
melee 113859 3.9% 39.3 10.35sec 105039 118333 78017 179948 105039 30.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.33 39.33 0.00 0.00 0.8877 0.0000 4130785.66 4130785.66 0.00 118333.50 118333.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.67 44.93% 78016.60 58973 121698 78229.79 65701 111032 1378614 1378614 0.00
crit 12.16 30.92% 179947.63 117946 292075 179540.03 134256 275849 2188445 2188445 0.00
glance 9.49 24.13% 59407.73 44230 91273 59433.98 0 91273 563727 563727 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 6.12 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 360 0.0% 8.0 0.73sec 1607 0 1071 2652 1607 33.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12852.80 12852.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.29 66.10% 1071.23 895 1434 1082.22 0 1434 5664 5664 0.00
crit 2.71 33.89% 2652.18 2147 3442 2501.74 0 3442 7189 7189 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:852.09
  • base_dd_max:852.09

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.19%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 23.6 2.2 17.3sec 15.7sec 6.77% 49.22%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:6.77%

Trigger Attempt Success

  • trigger_pct:4.98%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 17.2 0.0 26.0sec 26.0sec 25.58% 25.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.3 0.0 150.5sec 150.5sec 14.40% 14.40%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.40%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 413.9sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.8 6.6 36.3sec 23.5sec 41.96% 41.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.96%

    Trigger Attempt Success

    • trigger_pct:99.56%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.1 0.0 13.3sec 13.3sec 13.42% 44.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 10.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.9 2.4 47.0sec 37.3sec 24.52% 53.84%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.52%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.3 0.0 61.5sec 61.3sec 16.09% 16.09%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.09%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.1 0.0 74.8sec 74.8sec 83.43% 82.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 50.96% 62.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:50.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.13% 16.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 17.2 51.5 3.0 3.0 307428.8
halo Mana 6.7 271350.0 40500.0 40498.2 10.3
mind_blast Mana 46.0 194143.3 4222.6 4222.6 56.5
mind_flay Mana 58.0 174020.8 3000.0 2999.9 59.1
mind_flay_insanity Mana 34.4 103273.9 3000.0 3000.2 106.8
mind_sear Mana 0.3 2840.0 9000.0 9000.5 11.4
shadow_word_death Mana 12.9 100869.3 7800.0 7800.5 34.4
shadow_word_pain Mana 94.1 1242696.0 13200.0 13199.8 17.5
vampiric_touch Mana 21.2 190871.6 9000.0 9000.1 48.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 11.64 209592.72 (10.48%) 18000.00 0.00 0.00%
shadowfiend Mana 39.32 294211.66 (14.71%) 7482.31 59676.98 16.86%
Shadow Orbs from Mind Blast Shadow Orb 45.97 45.56 (86.47%) 0.99 0.41 0.89%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.13 7.13 (13.53%) 1.00 0.00 0.00%
Devouring Plague Health Health 248.86 0.00 (0.00%) 0.00 5297831.01 100.00%
Vampiric Touch Mana Mana 196.42 960986.35 (48.04%) 4892.52 28050.05 2.84%
halo_heal Health 6.70 0.00 (0.00%) 0.00 2163773.86 100.00%
external_healing Health 58.33 0.00 (0.00%) 0.00 18870925.78 100.00%
mp5_regen Mana 1812.85 535732.20 (26.78%) 295.52 8122.70 1.49%
pet - shadowfiend
external_healing Health 16.50 0.00 (0.00%) 0.00 5702054.02 100.00%
Resource RPS-Gain RPS-Loss
Mana 4412.94 5029.58
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 20566.61 0.00 212700.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.6%
shadowfiend-Mana Cap 1.6%
mindbender-Mana Cap 1.6%

Procs

Count Interval
Shadowy Recall Extra Tick 400.1 1.1sec
Shadowy Apparition Procced 153.8 2.8sec
Divine Insight Mind Blast CD Reset 43.5 15.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 234785.34
Minimum 161638.38
Maximum 336020.87
Spread ( max - min ) 174382.49
Range [ ( max - min ) / 2 * 100% ] 37.14%
Standard Deviation 22969.6979
5th Percentile 198336.11
95th Percentile 274011.40
( 95th Percentile - 5th Percentile ) 75675.29
Mean Distribution
Standard Deviation 145.2964
95.00% Confidence Intervall ( 234500.56 - 235070.11 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 367
0.1% Error 36767
0.1 Scale Factor Error with Delta=300 4503957
0.05 Scale Factor Error with Delta=300 18015828
0.01 Scale Factor Error with Delta=300 450395701
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 234785.34
Minimum 161638.38
Maximum 336020.87
Spread ( max - min ) 174382.49
Range [ ( max - min ) / 2 * 100% ] 37.14%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 101662531.42
Minimum 61183543.73
Maximum 152613393.91
Spread ( max - min ) 91429850.18
Range [ ( max - min ) / 2 * 100% ] 44.97%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.09 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 5.80 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 3.85 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 47.55 mind_blast,if=active_enemies<=5&cooldown_react
F 7.13 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 3.04 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 17.74 mind_flay_insanity,interrupt=1,chain=1
I 23.71 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 21.48 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 2.43 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 3.88 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.31 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 6.70 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 105.11 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 216.71 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.32 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 30.48 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 68.01 shadow_word_pain,moving=1
a 2.30 dispersion

Sample Sequence

AEIJPWZEZZENHZZZZEJWZZZEWLZZZEIIIDEPZEZEJNHZEZZTTTEENHZZZZEJWZZZEWIIIPEJNHKZEWZZZTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWTTTTTTTTTTWENHHTTTTTTTTTTTTTTTEaIPZZJEWZZTENHEAEIIIJJEDEIEZZWLZENPHEHZZZZJTTTEWZZZEIJDEHIIZZWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEZEWWTTTTTTTTTTTTTEJNHKZTTTTTEWTTTTTTTEIIIJENHZZZTTTTTTEWLZZTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEJZWaENPZHIIEIZEWWTTTTTTTTTTTTTENHEEWTTTTTTTTTTTTTENHAIEIIIJJEJPZENHFCZEJWFCNZEHLEFCNZHEIEFCIILNHEHFCIWTE8DZFCZHWTTTTTTTTTTTTTTTTSFSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTEDaFCIPEJTTTTTEDHFCZE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 217426 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
217426.5 217426.5 232.74 / 0.11% 30906 / 14.2% 42.5 4874.9 4256.7 Mana 26.59% 90.6 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 5.37 3.82 6.14 3.54 -2.08 3.74
Normalized 1.00 0.71 1.14 0.66 -0.39 0.70
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.33 0.33 0.33 0.33 0.34 0.32
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP ~= Mastery ~= Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=5.37, SpellDamage=3.82, HitRating=6.14, CritRating=3.54, HasteRating=-2.08, MasteryRating=3.74 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=5.37, SpellDamage=3.82, HitRating=0.00, CritRating=3.54, HasteRating=-2.08, MasteryRating=3.74 )

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:889072|509411|381880|259490|231134|230138|225025|134478|73608&chds=0,1778144&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++889072++devouring_plague,9482C9,0,0,15|t++509411++halo,9482C9,1,0,15|t++381880++vampiric_touch,9482C9,2,0,15|t++259490++shadow_word_death,9482C9,3,0,15|t++231134++mind_flay_insanity,9482C9,4,0,15|t++230138++shadow_word_pain,9482C9,5,0,15|t++225025++mind_blast,9482C9,6,0,15|t++134478++mind_flay,9482C9,7,0,15|t++73608++mind_sear,9482C9,8,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,9,8,8,6,6,6,4,4,4,4,3,3,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|essence_of_yulon|mind_blast|shadow_word_pain_mastery|mind_flay|vampiric_touch|devouring_plague_tick|mind_flay_insanity|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague|halo_damage|multistrike_spell|devouring_plague_mastery|vampiric_touch_mastery|mind_flay_insanity_mastery|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.14,5.37,3.82,3.74,3.54,-2.08|5.81,5.05,3.49,3.41,3.21,-2.42|6.47,5.70,4.15,4.06,3.86,-1.74&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.14++Hit,FFFFFF,0,0,15,0.1,e|t++++5.37++Int,FFFFFF,0,1,15,0.1,e|t++++3.82++SP,FFFFFF,0,2,15,0.1,e|t++++3.74++Mastery,FFFFFF,0,3,15,0.1,e|t++++3.54++Crit,FFFFFF,0,4,15,0.1,e|t++++-2.08++Haste,FFFFFF,0,5,15,0.1,s&chds=-2.426,7.376& http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:koqrtx0347877656542221000zwvwwvvvvttsqnlqrstututuwxxyyxxxwvvnlkjhhffecbaZZZZabceffglmoppprrrrrrppnlkjiidbZZZZYYYYYYYYYYYYYYYZZaaaaccdeeeeefgghhgggffedbaZYXWWWVUUTSSSRRRRSSTUWXYaceghklmmopqqqrqponmljihgedccaaZZYYXXWWWWVVUTTTSSSRQQQPPPPQQQPPPPPPPQQRRSSSSSTSSSTTUUVVWWXYYZaaaaaaaaaaaaaZZYYXXWVVVVVVVWWWWWVVVVWWXXXXXWWXWWVVUUUUUUTTSRQPPPPPPPPPPPPOOOOOOOPPRSTUXZbdgjmpqsvwy0233221zywvusqonmkjiihgggfffffeddccddcbbaaZZZZZZYYYXXXXXWWXXXXXWWWWWWWWWWWWWWWWWWWWWVWWWVVVVVVVUUTSSRRRRSSTTTTUUTTTUUWXZabbbaZZZYYYXYYXXXWUTRQPPQQQQRRRSRRQQPQQQRRSTVVWYZabdgjmoprtuvxyxwwvtssrqpomlkihffeddcbbaZYXWUSRQQRQONLLJJIIHG&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.4997,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=217426|max=435123&chxp=1,1,50,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:9,19,25,40,110,154,207,287,455,536,590,793,922,994,1084,1205,1286,1306,1337,1356,1305,1364,1234,1189,1107,955,860,714,693,573,496,414,315,285,207,153,123,75,67,40,38,28,12,12,9,4,2,2,0,1&chds=0,1364&chbh=5&chxt=x&chxl=0:|min=164431|avg=217426|max=296130&chxp=0,1,40,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:21.0,18.5,8.2,8.0,5.2,3.0,2.9,1.8,1.4,0.7,0.1,26.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 95.3s|mind_flay 84.1s|mind_flay_insanity 37.2s|mind_blast 36.2s|vampiric_touch 23.7s|devouring_plague 13.8s|shadow_word_death 13.3s|dispersion 8.2s|halo 6.3s|shadowfiend 3.2s|mind_sear 0.5s|waiting 120.5s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 217426
devouring_plague 7605 (27181) 3.5% (12.5%) 13.3 33.50sec 921482 889072 192394 417143 257821 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.33 13.33 0.00 0.00 1.0365 0.0000 3436567.67 3436567.67 0.00 889071.94 889071.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.45 70.87% 192393.85 173797 327485 192401.66 173797 243132 1817397 1817397 0.00
crit 3.88 29.12% 417143.39 362119 818808 412330.88 0 758090 1619171 1619171 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6876 3.2% 63.2 6.67sec 49139 0 33123 86807 49208 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.23 63.14 0.00 0.00 0.0000 0.0000 3106960.05 3106960.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.21 70.02% 33123.12 28967 54581 33142.30 29417 39286 1464456 1464456 0.00
crit 18.92 29.97% 86807.20 72910 169225 86777.69 73287 120814 1642505 1642505 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12700 5.9% 13.3 33.50sec 430562 0 0 0 0 0.0% 0.0% 0.0% 0.0% 133.3 32131 69297 43037 29.3% 0.0% 17.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.33 13.33 133.35 133.35 0.0000 0.5945 5739001.15 5739001.15 0.00 72389.93 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.2 70.66% 32131.08 28967 147048 32145.07 29160 39835 3027338 3027338 0.00
crit 39.1 29.34% 69297.46 60355 306387 69254.01 60702 89872 2711664 2711664 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 2.5 149.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 12.7 0 0 0 0.0% 0.0% 1.6%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.52 2.52 12.72 12.72 3.2779 0.5842 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.7 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20406 9.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 162.5 25911 56659 35055 29.7% 0.0% 28.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.98 162.54 263.10 0.0000 0.7971 9222942.44 9222942.44 0.00 71183.90 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.8 70.25% 25910.96 21627 43522 25923.88 23730 30270 4789069 4789069 0.00
crit 78.3 29.74% 56659.18 45062 108817 56645.77 50111 71505 4433873 4433873 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7162) 0.0% (3.3%) 6.1 74.72sec 527931 509411 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.07 6.07 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 509410.92 509410.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.26 70.26% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.80 29.73% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7162 3.3% 6.1 74.72sec 527931 0 178026 388197 240012 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.07 13.35 0.00 0.00 0.0000 0.0000 3203685.30 3203685.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.41 70.50% 178026.44 157064 293078 178315.99 157064 251741 1675245 1675245 0.00
crit 3.94 29.50% 388197.16 327255 732781 382144.81 0 732781 1528441 1528441 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18058 8.3% 34.3 12.98sec 237258 225025 176765 384402 237258 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.34 34.34 0.00 0.00 1.0544 0.0000 8147935.64 8147935.64 0.00 225025.15 225025.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.33 70.84% 176764.72 139099 421507 176717.89 144530 212657 4300605 4300605 0.00
crit 10.01 29.14% 384401.78 289823 1053892 384432.00 0 774001 3847330 3847330 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 16404 (24993) 7.6% (11.5%) 60.8 7.02sec 185989 134478 0 0 0 0.0% 0.0% 0.0% 0.0% 128.2 42506 93725 57867 30.0% 0.0% 15.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.78 60.78 128.22 128.22 1.3831 0.5612 7419807.16 7419807.16 0.00 134477.64 134477.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.77 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.8 70.01% 42505.80 36858 69446 42558.09 38725 49302 3815561 3815561 0.00
crit 38.5 29.99% 93725.23 76796 173637 93838.14 81182 120477 3604246 3604246 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 12520 (19026) 5.8% (8.8%) 26.6 16.07sec 323292 231134 0 0 0 0.0% 0.0% 0.0% 0.0% 52.9 79688 171039 107096 30.0% 0.0% 6.8%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.63 26.63 52.89 52.89 1.3987 0.5871 5664700.09 5664700.09 0.00 231133.83 231133.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.62 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.0 70.00% 79687.74 36858 138893 79738.44 61173 101234 2950377 2950377 0.00
crit 15.9 30.00% 171038.95 76796 347273 170881.42 104496 247290 2714323 2714323 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6507 3.0% 25.1 16.88sec 117269 0 79524 206277 117433 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.10 25.06 0.00 0.00 0.0000 0.0000 2942955.03 2942955.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.56 70.08% 79523.76 36858 138893 79560.15 54815 112871 1396542 1396542 0.00
crit 7.50 29.92% 206276.87 92771 430626 206010.22 0 398695 1546413 1546413 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 8589 4.0% 60.8 6.94sec 63896 0 42537 113796 63915 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.79 60.77 0.00 0.00 0.0000 0.0000 3884249.13 3884249.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.53 69.98% 42536.76 36858 69446 42593.54 38097 52050 1809081 1809081 0.00
crit 18.24 30.01% 113795.84 92771 215313 113950.82 94041 183793 2075169 2075169 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 75 0.0% 0.4 161.56sec 77461 73608 0 0 0 0.0% 0.0% 0.0% 0.0% 0.3 23954 51759 32101 29.3% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.44 0.44 0.26 1.05 1.0533 0.6187 33712.32 33712.32 0.00 73607.70 73607.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.44 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.7 70.71% 23953.91 21702 38145 3664.02 0 38145 17791 17791 0.00
crit 0.3 29.29% 51759.02 45218 92979 6747.39 0 92979 15922 15922 0.00
miss 0.0 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 39 0.0% 0.5 7.34sec 35298 0 23965 62674 35301 29.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.50 0.50 0.00 0.00 0.0000 0.0000 17592.59 17592.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.35 70.69% 23965.04 21702 38145 3292.14 0 38145 8443 8443 0.00
crit 0.15 29.30% 62674.11 54624 115296 5821.65 0 115296 9149 9149 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (39) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 7092 3.3% 144.5 3.09sec 22118 0 22119 0 22119 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.52 144.52 0.00 0.00 0.0000 0.0000 3196429.19 3196429.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.52 100.00% 22118.69 8570 387154 22138.72 15259 32133 3196429 3196429 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:60354.61
  • base_dd_max:60354.61
power_infusion 0 0.0% 4.3 120.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 7670 3.5% 12.9 7.04sec 268940 259490 199529 432983 268940 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.86 12.86 0.00 0.00 1.0365 0.0000 3459776.44 3459776.44 0.00 259489.72 259489.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.04 70.26% 199529.39 156358 474903 199733.93 0 295238 1803346 1803346 0.00
crit 3.83 29.74% 432983.49 325785 1187398 426447.85 0 1187398 1656430 1656430 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31860 (48758) 14.6% (22.4%) 92.0 4.66sec 238538 230138 0 0 0 0.0% 0.0% 0.0% 0.0% 350.8 30217 66125 40863 29.6% 0.0% 98.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.95 91.95 350.75 350.75 1.0365 1.2755 14332775.53 14332775.53 0.00 40417.97 230138.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.94 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 246.8 70.35% 30216.59 25710 50852 30229.50 28082 33525 7456066 7456066 0.00
crit 104.0 29.65% 66124.75 53569 127144 66148.14 59453 76204 6876710 6876710 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 16899 7.8% 166.4 2.60sec 45694 0 30622 81450 45721 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.36 166.26 0.00 0.00 0.0000 0.0000 7601691.71 7601691.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.84 70.28% 30622.04 26996 50852 30635.30 28024 35081 3577927 3577927 0.00
crit 49.40 29.71% 81450.13 67948 157661 81481.77 71414 99083 4023764 4023764 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.1 180.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 3.09 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6253 2.9% 153.4 2.81sec 18340 0 15742 34572 21404 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.40 131.44 0.00 0.00 0.0000 0.0000 2813278.98 2813278.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.89 69.91% 15741.51 13769 25133 15744.78 14318 17700 1446455 1446455 0.00
crit 39.54 30.08% 34572.39 28689 62840 34575.41 29971 41466 1366824 1366824 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1376 0.6% 18.2 17.82sec 33550 0 22533 56415 33548 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.20 18.20 0.00 0.00 0.0000 0.0000 610610.84 610610.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.28 67.47% 22533.07 17031 32641 22681.91 18280 32641 276687 276687 0.00
crit 5.92 32.52% 56414.86 35485 81611 55899.00 0 81611 333924 333924 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:29606.04
  • base_dd_max:29606.04
vampiric_touch 13278 (20121) 6.1% (9.2%) 20.6 20.29sec 438326 381880 0 0 0 0.0% 0.0% 0.0% 0.0% 125.8 34657 76636 47394 30.3% 0.0% 46.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.61 20.61 125.76 125.76 1.1478 1.6672 5960095.48 5960095.48 0.00 38710.99 381880.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.60 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.6 69.66% 34657.15 28140 56544 34725.22 30927 42210 3035991 3035991 0.00
crit 38.2 30.34% 76635.90 58633 141377 76751.22 63628 98057 2924104 2924104 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 6844 3.1% 59.6 6.69sec 51500 0 34217 91821 51529 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.65 59.61 0.00 0.00 0.0000 0.0000 3071759.92 3071759.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.69 69.93% 34217.45 29548 56544 34257.65 30326 40434 1426408 1426408 0.00
crit 17.92 30.06% 91821.24 74371 175310 91976.38 74371 125930 1645352 1645352 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 113880 / 9214
melee 113524 4.2% 39.4 10.35sec 104766 118021 77920 179231 104766 30.9% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.36 39.36 0.00 0.00 0.8877 0.0000 4123536.93 4123536.93 0.00 118021.03 118021.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.77 45.16% 77920.34 58973 121698 78125.36 66276 110746 1384939 1384939 0.00
crit 12.16 30.90% 179230.84 117946 292075 178688.95 135201 267144 2180102 2180102 0.00
glance 9.42 23.93% 59303.46 44230 91273 59329.85 0 91273 558496 558496 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 6.13 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 355 0.0% 8.0 0.73sec 1588 0 1062 2624 1588 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12704.85 12704.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.30 66.26% 1061.78 895 1434 1072.24 0 1434 5628 5628 0.00
crit 2.70 33.72% 2623.80 2147 3442 2474.12 0 3442 7077 7077 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.3 0.0 33.6sec 33.6sec 25.72% 23.23%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.2 0.0 158.9sec 158.9sec 13.72% 13.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:13.72%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 413.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.8 6.5 36.3sec 23.6sec 41.95% 41.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.95%

    Trigger Attempt Success

    • trigger_pct:99.56%
power_infusion 4.3 0.0 120.3sec 120.3sec 18.61% 18.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.1 0.0 13.4sec 13.4sec 13.32% 44.66%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:13.32%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 11.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.9 2.3 47.0sec 37.4sec 24.50% 44.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.50%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.1 0.0 63.7sec 63.5sec 15.62% 15.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:15.62%

    Trigger Attempt Success

    • trigger_pct:99.87%
shadowfiend-shadowcrawl 6.1 0.0 74.7sec 74.7sec 83.43% 82.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 50.03% 61.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:50.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.11% 16.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 13.3 40.0 3.0 3.0 307180.3
halo Mana 6.1 226246.9 37286.2 37282.9 14.2
mind_blast Mana 34.3 297245.3 8655.4 8655.4 27.4
mind_flay Mana 60.8 172258.5 2834.3 2834.2 65.6
mind_flay_insanity Mana 26.6 77865.5 2924.2 2924.5 110.5
mind_sear Mana 0.4 3909.5 8982.5 8982.9 8.6
shadow_word_death Mana 12.9 96070.7 7467.6 7467.9 36.0
shadow_word_pain Mana 91.9 1160355.3 12619.5 12618.9 18.9
vampiric_touch Mana 20.6 176007.4 8542.4 8541.8 51.3
Resource Gains Type Count Total Average Overflow
dispersion Mana 12.72 228921.12 (11.86%) 18000.00 0.00 0.00%
shadowfiend Mana 39.35 281792.59 (14.60%) 7160.32 72400.25 20.44%
Shadow Orbs from Mind Blast Shadow Orb 34.34 34.11 (82.80%) 0.99 0.23 0.67%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.09 7.09 (17.20%) 1.00 0.00 0.00%
Devouring Plague Health Health 196.49 0.00 (0.00%) 0.00 4183012.14 100.00%
Vampiric Touch Mana Mana 185.36 886945.28 (45.96%) 4785.07 46372.24 4.97%
halo_heal Health 6.07 0.00 (0.00%) 0.00 1939680.95 100.00%
external_healing Health 58.96 0.00 (0.00%) 0.00 19099951.79 100.00%
mp5_regen Mana 1812.85 532021.70 (27.57%) 293.47 11833.20 2.18%
pet - shadowfiend
external_healing Health 16.18 0.00 (0.00%) 0.00 5585142.08 100.00%
Resource RPS-Gain RPS-Loss
Mana 4256.67 4874.94
Shadow Orb 0.09 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 19928.49 0.00 199680.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.3%
shadowfiend-Mana Cap 2.3%
mindbender-Mana Cap 2.3%

Procs

Count Interval
Shadowy Recall Extra Tick 375.3 1.2sec
Shadowy Apparition Procced 153.4 2.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 217426.47
Minimum 164431.29
Maximum 296130.21
Spread ( max - min ) 131698.92
Range [ ( max - min ) / 2 * 100% ] 30.29%
Standard Deviation 18772.2678
5th Percentile 187816.66
95th Percentile 249629.04
( 95th Percentile - 5th Percentile ) 61812.38
Mean Distribution
Standard Deviation 118.7452
95.00% Confidence Intervall ( 217193.73 - 217659.20 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 286
0.1% Error 28635
0.1 Scale Factor Error with Delta=300 3008272
0.05 Scale Factor Error with Delta=300 12033089
0.01 Scale Factor Error with Delta=300 300827232
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 217426.47
Minimum 164431.29
Maximum 296130.21
Spread ( max - min ) 131698.92
Range [ ( max - min ) / 2 * 100% ] 30.29%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 93866526.64
Minimum 57417259.94
Maximum 136713262.16
Spread ( max - min ) 79296002.22
Range [ ( max - min ) / 2 * 100% ] 42.24%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.09 shadowfiend,if=!talent.mindbender.enabled
B 4.32 power_infusion,if=talent.power_infusion.enabled
C 5.78 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.95 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 35.61 mind_blast,if=active_enemies<=5&cooldown_react
F 7.09 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 1.08 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 14.08 mind_flay_insanity,interrupt=1,chain=1
I 22.94 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 22.26 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 1.55 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 2.45 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 11.38 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 6.07 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 111.79 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 331.15 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.44 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 30.82 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 67.46 shadow_word_pain,moving=1
a 2.52 dispersion

Sample Sequence

ABEIJPWZZZZEWLWZZZZENHZZZZEJWZZZZEIIIJPZZZEJNHZZZZEWZZZZEJWZZZENHIIIPEJJWJJKZEWLZZZTTTTTTTTTTTTTTTTTTTENaZBZZZTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEZWWWWTTTTTTTTTTTTTTTTTTTTTTTTTTTEWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWTTTTTTTTTTTTTTTTTTENHAIIIEIJJJZZZZEWZZZTTTTTTTTTENHTTEWWTTTTTTTTTTWWTTTTTTTTTTTTTTTTEWBWTTTTTTTTTTTTTTTTTTTTTTTTTTTTEIWaPZZZEJNHIIIZEJJJVZZZEWWTTTTTTTTTTTTTTTTTTTTTTTTTENHWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEIWTTTTTTTTTTTTTTTTTTTTTEWWTTTTTTTTTTENHAIBIIEIJJJJPZZZEWFCNZEHGFCZTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSFDHWWSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT8TTTTTTTTTTTTTTFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTEDSSSSSHSSHWFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 205721 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
205720.7 205720.7 225.87 / 0.11% 29838 / 14.5% 42.1 4637.2 4008.5 Mana 30.49% 94.9 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 5.10 3.93 5.59 3.29 -1.07 3.76
Normalized 1.00 0.77 1.10 0.65 -0.21 0.74
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.32 0.31 0.32 0.32 0.33 0.31
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP ~= Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=5.10, SpellDamage=3.93, HitRating=5.59, CritRating=3.29, HasteRating=-1.07, MasteryRating=3.76 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=5.10, SpellDamage=3.93, HitRating=0.00, CritRating=3.29, HasteRating=-1.07, MasteryRating=3.76 )

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:916343|505340|376124|294586|237293|230104|229235|130376|77302&chds=0,1832687&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++916343++devouring_plague,9482C9,0,0,15|t++505340++halo,9482C9,1,0,15|t++376124++vampiric_touch,9482C9,2,0,15|t++294586++shadow_word_death,9482C9,3,0,15|t++237293++mind_flay_insanity,9482C9,4,0,15|t++230104++shadow_word_pain,9482C9,5,0,15|t++229235++mind_blast,9482C9,6,0,15|t++130376++mind_flay,9482C9,7,0,15|t++77302++mind_sear,9482C9,8,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,9,8,8,6,6,6,5,4,4,4,3,3,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|essence_of_yulon|mind_blast|mind_flay|shadow_word_pain_mastery|mind_flay_insanity|devouring_plague_tick|vampiric_touch|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague|devouring_plague_mastery|multistrike_spell|mind_flay_insanity_mastery|halo_damage|vampiric_touch_mastery|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:5.59,5.10,3.93,3.76,3.29,-1.07|5.27,4.78,3.62,3.45,2.97,-1.40|5.91,5.41,4.25,4.07,3.61,-0.74&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++5.59++Hit,FFFFFF,0,0,15,0.1,e|t++++5.10++Int,FFFFFF,0,1,15,0.1,e|t++++3.93++SP,FFFFFF,0,2,15,0.1,e|t++++3.76++Mastery,FFFFFF,0,3,15,0.1,e|t++++3.29++Crit,FFFFFF,0,4,15,0.1,e|t++++-1.07++Haste,FFFFFF,0,5,15,0.1,s&chds=-1.411,6.721& http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:ilmoqtwz0333220200000zzyxyvvwwwwwwvvuspntuvwwwxwxz0011100zyyqonljjhhgedcbaabbdeghhinoqrssttttttrqpnlkjjdcaaZaYZZZZZZZZZYYYYYYYYYYXXXXXYXXXXYYYYYYYXXWWVUUTTTTTTTSSRRRRRRRSSTUWXYacdfhklmnpqrstuutsrqonmljhgffdcbaZZYYXXXWWWVUUUUUTSSRRRQQQRQQQPOOOOOPPPQRRRRRRRRRSTUUVVWWWXYYZZZZaaaaaaaaaaaZYXXWVVVVVVVVVVUUUTTUUVWXXXWWWWWVUUUUUUUUTSRQPOOOOPPQRRRRQQQQPQQRSSUVXXZcdfikoqstwxz0122110zywvusqponlkjihhggffffeedddddeddccccccdddccccbbcbbbcccccbbbbabbaabbbabbbbaaaaZZZZZZYYYYXXWVUTSSSTTTTTUUUUTTSTTUVWXXXWVVVUUTUTTTTTTTSQPOOOPQQRSTTUTTTTSTTUUVVXZZacdefhlpsuwy1346876542210zxvtrqonlkkiihhhgfecZaaZaZZYXVTSRQPONM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5038,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=597|1:|0|avg=205721|max=408324&chxp=1,1,50,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,3,21,36,62,144,206,326,503,668,798,1011,1146,1259,1421,1510,1474,1481,1556,1466,1370,1269,1176,1042,960,797,664,551,443,359,308,250,179,140,105,79,55,49,34,19,12,12,5,6,5,3,1,2,0,2&chds=0,1556&chbh=5&chxt=x&chxl=0:|min=152965|avg=205721|max=294168&chxp=0,1,37,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:18.9,18.5,8.1,7.7,4.5,2.9,2.7,1.8,1.2,0.7,0.1,30.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 85.5s|mind_flay 83.8s|mind_flay_insanity 36.6s|mind_blast 34.7s|vampiric_touch 20.4s|devouring_plague 13.3s|shadow_word_death 12.4s|dispersion 8.2s|halo 5.3s|shadowfiend 3.2s|mind_sear 0.4s|waiting 138.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 205721
devouring_plague 7690 (26954) 3.7% (13.1%) 12.8 34.88sec 949750 916343 201866 438663 270924 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.83 12.83 0.00 0.00 1.0365 0.0000 3474684.56 3474684.56 0.00 916343.36 916343.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.08 70.81% 201866.28 173797 358674 201837.41 173797 251877 1833367 1833367 0.00
crit 3.74 29.17% 438662.71 362119 896790 432656.80 0 877382 1641318 1641318 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6799 3.3% 59.5 7.11sec 51688 0 34824 91287 51761 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.46 59.37 0.00 0.00 0.0000 0.0000 3073170.19 3073170.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.55 69.99% 34823.69 28967 59780 34837.74 30061 41616 1447003 1447003 0.00
crit 17.81 30.00% 91286.88 72910 185342 91229.50 73224 138595 1626167 1626167 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12465 6.1% 12.8 34.88sec 439213 0 0 0 0 0.0% 0.0% 0.0% 0.0% 125.4 33597 72399 44908 29.2% 0.0% 16.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.83 12.83 125.44 125.44 0.0000 0.6081 5633097.53 5633097.53 0.00 73852.47 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.9 70.85% 33597.02 28967 64193 33603.99 30247 38863 2985813 2985813 0.00
crit 36.6 29.15% 72399.03 60355 149467 72339.01 61466 92784 2647284 2647284 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 2.6 144.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 11.8 0 0 0 0.0% 0.0% 1.6%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 2.56 11.81 11.81 3.1925 0.6226 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.8 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20074 9.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.5 27005 58961 36507 29.7% 0.0% 27.5%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.68 156.46 248.58 0.0000 0.7975 9075014.07 9075014.07 0.00 72727.53 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.6 70.26% 27005.06 21627 47667 27013.55 24483 31875 4716272 4716272 0.00
crit 73.9 29.74% 58961.40 45062 119180 58932.45 50700 71697 4358742 4358742 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (5954) 0.0% (2.9%) 5.1 83.93sec 523755 505340 0 0 0 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 5.08 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 505339.84 505339.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.54 69.74% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.54 30.26% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 5954 2.9% 5.1 83.93sec 523755 0 179323 389397 240975 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 11.03 0.00 0.00 0.0000 0.0000 2658592.92 2658592.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.79 70.64% 179323.47 157064 320990 179597.98 0 259469 1397654 1397654 0.00
crit 3.24 29.35% 389397.10 327255 802570 377558.28 0 786519 1260939 1260939 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 17645 8.6% 33.1 13.37sec 240782 229235 179690 389867 240781 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.08 33.08 0.00 0.00 1.0504 0.0000 7964313.16 7964313.16 0.00 229235.04 229235.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.45 70.91% 179690.34 139099 461650 179605.39 151474 228050 4214540 4214540 0.00
crit 9.62 29.08% 389867.26 289823 1154262 389790.33 0 689629 3749773 3749773 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 15852 (24171) 7.7% (11.8%) 58.4 7.31sec 187223 130376 0 0 0 0.0% 0.0% 0.0% 0.0% 122.1 43329 94726 58715 29.9% 0.0% 15.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.39 58.39 122.11 122.11 1.4360 0.5904 7169927.37 7169927.37 0.00 130376.23 130376.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.38 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.6 70.06% 43329.22 36858 76060 43373.05 39307 49895 3707093 3707093 0.00
crit 36.6 29.94% 94726.03 76796 180188 94808.98 82393 122315 3462834 3462834 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 12655 (19228) 6.2% (9.4%) 25.7 16.65sec 337428 237293 0 0 0 0.0% 0.0% 0.0% 0.0% 50.7 83728 180110 112631 30.0% 0.0% 6.7%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.74 25.74 50.75 50.75 1.4220 0.6021 5715789.63 5715789.63 0.00 237292.92 237292.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.73 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.5 70.01% 83727.69 36858 152121 83769.22 63268 107709 2974757 2974757 0.00
crit 15.2 29.99% 180110.37 76796 380347 179980.84 111678 255290 2741033 2741033 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6573 3.2% 24.1 17.60sec 123298 0 83533 217029 123478 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.08 24.04 0.00 0.00 0.0000 0.0000 2968419.31 2968419.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.84 70.06% 83533.23 36858 152121 83589.41 58326 111803 1406820 1406820 0.00
crit 7.20 29.93% 217028.94 92771 471638 216637.58 0 374604 1561600 1561600 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 8319 4.1% 58.0 7.26sec 64899 0 43417 115171 64917 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.96 57.95 0.00 0.00 0.0000 0.0000 3761858.52 3761858.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.57 70.02% 43416.93 36858 76060 43467.42 38556 52808 1761605 1761605 0.00
crit 17.37 29.97% 115171.30 92771 223436 115281.92 93371 160386 2000253 2000253 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 72 0.0% 0.4 169.41sec 79809 77302 0 0 0 0.0% 0.0% 0.0% 0.0% 0.2 24124 52013 32129 28.7% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.40 0.40 0.25 0.99 1.0344 0.6215 31770.97 31770.97 0.00 77301.63 77301.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.40 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.7 71.28% 24124.36 21702 42765 3890.08 0 42765 17005 17005 0.00
crit 0.3 28.71% 52012.99 45218 92979 6965.81 0 92979 14766 14766 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 38 0.0% 0.5 14.27sec 35599 0 24138 63069 35610 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.47 0.47 0.00 0.00 0.0000 0.0000 16685.42 16685.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.33 70.54% 24137.51 21702 42765 3433.38 0 42765 7979 7979 0.00
crit 0.14 29.46% 63068.94 54624 115296 5797.19 0 115296 8707 8707 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (38) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 6694 3.3% 130.6 3.42sec 23105 0 23105 0 23105 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.58 130.58 0.00 0.00 0.0000 0.0000 3016981.38 3016981.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.58 100.00% 23105.24 8570 424026 23117.69 15934 35949 3016981 3016981 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:45623.35
  • base_dd_max:45623.35
shadow_word_death 8096 3.9% 12.0 7.54sec 305331 294586 226419 490603 305336 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.97 11.97 0.00 0.00 1.0365 0.0000 3653458.44 3653458.44 0.00 294586.23 294586.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.39 70.10% 226419.35 156358 520132 226485.26 179812 353159 1899254 1899254 0.00
crit 3.58 29.88% 490602.75 325785 1300484 481191.20 0 1203152 1754204 1754204 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 28595 (43768) 13.9% (21.2%) 82.5 5.13sec 238502 230104 0 0 0 0.0% 0.0% 0.0% 0.0% 307.8 30877 67640 41787 29.7% 0.0% 89.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.54 82.54 307.78 307.78 1.0365 1.3183 12861001.24 12861001.24 0.00 40067.60 230103.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.53 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 216.4 70.32% 30877.35 25710 55695 30874.92 28015 34463 6683153 6683153 0.00
crit 91.3 29.68% 67639.57 53569 139253 67621.97 59861 78645 6177848 6177848 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15174 7.4% 146.0 2.93sec 46738 0 31315 83277 46765 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.01 145.93 0.00 0.00 0.0000 0.0000 6824131.26 6824131.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.51 70.25% 31314.81 26996 55695 31314.11 28181 35652 3210170 3210170 0.00
crit 43.40 29.74% 83276.73 67948 172676 83270.84 71111 100765 3613962 3613962 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.1 180.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 3.09 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5506 2.7% 134.7 3.16sec 18376 0 15736 34579 21405 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.73 115.67 0.00 0.00 0.0000 0.0000 2475794.55 2475794.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.84 69.90% 15735.56 13769 25133 15740.23 14309 17607 1272141 1272141 0.00
crit 34.81 30.09% 34578.79 28689 62840 34587.26 29663 44358 1203653 1203653 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1173 0.6% 15.9 20.55sec 32680 0 22150 54829 32681 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.91 15.91 0.00 0.00 0.0000 0.0000 520049.61 520049.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.78 67.76% 22149.71 17031 35749 22247.28 17739 31086 238826 238826 0.00
crit 5.13 32.23% 54828.66 35485 77725 54275.85 0 77725 281223 281223 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17807.40
  • base_dd_max:17807.40
vampiric_touch 11278 (17123) 5.5% (8.3%) 17.8 23.08sec 431256 376124 0 0 0 0.0% 0.0% 0.0% 0.0% 105.8 34965 77236 47800 30.4% 0.0% 40.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.80 17.80 105.77 105.77 1.1466 1.7511 5055996.72 5055996.72 0.00 37328.32 376123.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.80 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.7 69.64% 34964.59 28140 61929 34990.32 30262 43021 2575321 2575321 0.00
crit 32.1 30.36% 77236.25 58633 154841 77260.28 63601 105714 2480676 2480676 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5845 2.8% 50.2 7.79sec 52223 0 34722 93115 52249 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.16 50.14 0.00 0.00 0.0000 0.0000 2619563.49 2619563.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.08 69.97% 34721.90 29548 61929 34718.05 30373 42099 1217973 1217973 0.00
crit 15.05 30.02% 93115.35 74371 192006 93173.42 74371 142533 1401590 1401590 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 114021 / 9225
melee 113666 4.5% 39.4 10.35sec 104889 118157 77991 179413 104889 30.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.36 39.36 0.00 0.00 0.8877 0.0000 4128518.15 4128518.15 0.00 118156.84 118156.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.75 45.09% 77991.30 58973 121698 78190.26 66471 115346 1384204 1384204 0.00
crit 12.18 30.93% 179413.46 117946 292075 178841.31 0 279376 2184490 2184490 0.00
glance 9.43 23.96% 59348.95 44230 91273 59402.45 0 89356 559824 559824 0.00
dodge 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 6.13 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 355 0.0% 8.0 0.73sec 1588 0 1058 2617 1588 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12703.26 12703.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.28 65.99% 1058.28 895 1434 1068.61 0 1434 5586 5586 0.00
crit 2.72 34.00% 2616.71 2147 3442 2472.74 0 3442 7118 7118 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 12.8 0.0 34.9sec 34.9sec 25.83% 22.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 162.1sec 162.1sec 13.48% 13.48%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:13.48%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 413.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.9 6.4 36.1sec 23.6sec 42.05% 42.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:42.05%

    Trigger Attempt Success

    • trigger_pct:99.62%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 6.7 0.0 14.1sec 14.1sec 12.68% 43.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:12.68%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.60% 11.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.9 2.3 46.9sec 37.5sec 24.51% 53.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.51%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.0 0.0 64.6sec 64.4sec 15.43% 15.43%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:15.43%

    Trigger Attempt Success

    • trigger_pct:99.88%
twist_of_fate 1.0 191.2 61.1sec 0.9sec 37.51% 37.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:37.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 6.1 0.0 74.7sec 74.7sec 83.43% 82.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 49.94% 61.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:49.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.11% 16.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 12.8 38.5 3.0 3.0 316602.5
halo Mana 5.1 205579.6 40500.0 40500.1 12.9
mind_blast Mana 33.1 297697.0 9000.0 9000.1 26.8
mind_flay Mana 58.4 175162.9 3000.0 2999.9 62.4
mind_flay_insanity Mana 25.7 77217.7 3000.0 3000.3 112.5
mind_sear Mana 0.4 3582.7 9000.0 8999.8 8.9
shadow_word_death Mana 12.0 93338.9 7800.0 7800.6 39.1
shadow_word_pain Mana 82.5 1089441.4 13200.0 13199.5 18.1
vampiric_touch Mana 17.8 160171.9 9000.0 8999.4 47.9
Resource Gains Type Count Total Average Overflow
dispersion Mana 11.81 212548.32 (11.70%) 18000.00 0.00 0.00%
shadowfiend Mana 39.36 297057.68 (16.35%) 7547.85 57151.72 16.14%
Shadow Orbs from Mind Blast Shadow Orb 33.07 32.90 (82.99%) 0.99 0.17 0.51%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.74 6.74 (17.01%) 1.00 0.00 0.00%
Devouring Plague Health Health 184.81 0.00 (0.00%) 0.00 3934440.29 100.00%
Vampiric Touch Mana Mana 155.90 768966.52 (42.32%) 4932.40 16039.40 2.04%
halo_heal Health 5.08 0.00 (0.00%) 0.00 1683742.58 100.00%
external_healing Health 59.96 0.00 (0.00%) 0.00 19331161.89 100.00%
mp5_regen Mana 1812.85 538626.24 (29.64%) 297.12 5228.66 0.96%
pet - shadowfiend
external_healing Health 16.15 0.00 (0.00%) 0.00 5584013.53 100.00%
Resource RPS-Gain RPS-Loss
Mana 4008.55 4637.22
Shadow Orb 0.09 0.08
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 14566.61 0.00 207600.00
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%
shadowfiend-Mana Cap 1.1%
mindbender-Mana Cap 1.1%

Procs

Count Interval
Shadowy Recall Extra Tick 337.9 1.3sec
Shadowy Apparition Procced 134.7 3.2sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 205720.68
Minimum 152964.55
Maximum 294168.11
Spread ( max - min ) 141203.56
Range [ ( max - min ) / 2 * 100% ] 34.32%
Standard Deviation 18218.2562
5th Percentile 178132.89
95th Percentile 237809.42
( 95th Percentile - 5th Percentile ) 59676.54
Mean Distribution
Standard Deviation 115.2408
95.00% Confidence Intervall ( 205494.82 - 205946.55 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 301
0.1% Error 30126
0.1 Scale Factor Error with Delta=300 2833330
0.05 Scale Factor Error with Delta=300 11333323
0.01 Scale Factor Error with Delta=300 283333078
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 205720.68
Minimum 152964.55
Maximum 294168.11
Spread ( max - min ) 141203.56
Range [ ( max - min ) / 2 * 100% ] 34.32%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 88570300.31
Minimum 54782341.33
Maximum 131062104.97
Spread ( max - min ) 76279763.63
Range [ ( max - min ) / 2 * 100% ] 43.06%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.09 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 5.22 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 2.02 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 34.15 mind_blast,if=active_enemies<=5&cooldown_react
F 6.74 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 1.15 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 13.58 mind_flay_insanity,interrupt=1,chain=1
I 21.55 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 19.29 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 1.35 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 2.31 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 10.81 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 5.08 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 127.14 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 369.10 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.40 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 30.87 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 59.63 shadow_word_pain,moving=1
a 2.56 dispersion

Sample Sequence

AEIJPWZZZZEWLWZZZENHZZZZEJWZZZZEIIIJJPZZZEJNHZZZZEWZZZZEJWZZZENHIIIPEJJJJKZZTTTTTTTTTTTEaZZZZJENHZZZZTEWLZZZZTTTTTTTTEWWTTTTTTTTTTTTTTTTTTTTTTENHTTTTTTTTTTTTTEWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTITTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAIIIEJJJJKPZTTTTTTTTENHZZEWWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEIaPZZZEJNHZZZZEWIIIEJJWJJZZZENHZZZTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTITTTTTWWWTTTTTTTTTTTTTTTTTTTTTTTTTTTTEWTTTTTTTTTTTTTTTTTTTTTTTTENHTTTTTTTTTTTTTTTTTTTTEWAIIIEIJJJZZZZENHFCZZZEJaFCNPEHGFCKZEIINHFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTTTTESSSSSSSS8SSSSSSSSSSSSSSFDSSSSHSSSSSSSHSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCWWWSSSSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 312 - 597 ( 453.3 )

Performance:
Total Events Processed: 1112125560
Max Event Queue: 294
Sim Seconds: 11333268
CPU Seconds: 2168.0900
Physical Seconds: 278.4270
Speed Up: 5227

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
Standard Deviation 65.3256
5th Percentile 361.92
95th Percentile 555.41
( 95th Percentile - 5th Percentile ) 193.49
Mean Distribution
Standard Deviation 0.4132
95.00% Confidence Intervall ( 452.52 - 454.14 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 797
0.1% Error 79768
0.1 Scale Factor Error with Delta=300 36
0.05 Scale Factor Error with Delta=300 145
0.01 Scale Factor Error with Delta=300 3642
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 5156432 11375 2.59 195468 425039 19.6 19.6 29.7% 0.0% 0.0% 0.0% 22.66sec 5156432 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 4460528 9839 12.04 32953 86501 91.1 91.0 30.0% 0.0% 0.0% 0.0% 4.70sec 4460528 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 8468587 18819 25.59 32743 70881 19.6 191.9 29.8% 0.0% 0.0% 0.0% 22.66sec 8468587 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI dispersion 47585 0 0 0.17 0 0 1.3 1.3 0.0% 0.0% 0.0% 0.0% 163.10sec 0 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 10332012 22960 24.32 25728 56091 0.0 182.4 29.9% 0.0% 0.0% 0.0% 0.00sec 10332012 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.17 0 0 8.8 8.8 29.8% 0.0% 0.0% 0.0% 49.93sec 0 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 3764030 8303 2.06 179162 389207 8.8 15.6 29.9% 0.0% 0.0% 0.0% 49.93sec 3764030 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 0 0 13.12 0 0 8.8 99.1 33.1% 0.0% 0.0% 0.0% 49.93sec 32147654 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 11871494 26187 6.97 167625 363357 52.7 52.7 29.6% 0.0% 0.0% 0.0% 8.55sec 11871494 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 7837421 17416 18.37 41975 91529 71.9 137.8 30.1% 0.0% 0.0% 0.0% 6.11sec 7837421 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 4076339 8992 8.64 41842 110403 65.3 65.3 30.0% 0.0% 0.0% 0.0% 6.64sec 4076339 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear ticks -48045 15944 35 0.02 23681 51786 0.2 0.1 30.0% 0.0% 0.0% 0.0% 156.05sec 15944 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_mastery 124469 8335 18 0.03 23690 62468 0.2 0.2 29.6% 0.0% 0.0% 0.0% 10.82sec 8335 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 9860398 21751 6.73 142982 312149 50.9 50.9 30.0% 0.0% 0.0% 0.0% 8.13sec 9860398 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 4273180 9426 24.18 23393 0 182.7 182.7 0.0% 0.0% 0.0% 0.0% 2.44sec 4273180 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 4163919 9185 2.08 196317 424805 15.7 15.7 30.0% 0.0% 0.0% 0.0% 5.77sec 4163919 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 16980567 37735 56.05 29938 65073 103.7 420.3 29.8% 0.0% 0.0% 0.0% 4.21sec 16980567 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 9014418 19885 26.39 30386 80062 199.5 199.4 29.8% 0.0% 0.0% 0.0% 2.20sec 9014418 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.41 0 0 3.1 3.1 0.0% 0.0% 0.0% 0.0% 180.44sec 0 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 3306328 7293 20.39 15815 34509 184.6 154.1 30.2% 0.0% 0.0% 0.0% 2.37sec 3306328 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 551747 1217 2.27 21706 53750 17.2 17.2 32.5% 0.0% 0.0% 0.0% 19.00sec 551747 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 8605312 19123 25.08 33729 73709 30.5 188.1 30.1% 0.0% 0.0% 0.0% 14.03sec 8605312 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 4483012 9889 11.80 33649 89120 89.2 89.2 30.0% 0.0% 0.0% 0.0% 4.71sec 4483012 453.33sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 4093501 112659 64.87 77353 179126 39.3 39.3 30.7% 0.0% 24.1% 0.0% 10.34sec 4093501 36.34sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.11 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 74.82sec 0 36.34sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 13145 362 13.21 1089 2697 8.0 8.0 34.5% 0.0% 0.0% 0.0% 0.73sec 13145 36.34sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 3818626 8423 1.94 194044 419933 14.7 14.7 29.4% 0.0% 0.0% 0.0% 30.36sec 3818626 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 3396022 7491 9.14 33097 86570 69.2 69.1 30.0% 0.0% 0.0% 0.0% 6.10sec 3396022 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 6339649 14088 19.44 32425 69889 14.7 145.8 29.5% 0.0% 0.0% 0.0% 30.36sec 6339649 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI dispersion 47585 0 0 0.28 0 0 2.1 2.1 0.0% 0.0% 0.0% 0.0% 150.07sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 10012321 22250 23.78 26029 57059 0.0 178.3 29.9% 0.0% 0.0% 0.0% 0.00sec 10012321 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 0.96 0 0 7.3 7.3 30.0% 0.0% 0.0% 0.0% 62.10sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 3468535 7651 1.90 179094 392164 7.3 14.3 29.6% 0.0% 0.0% 0.0% 62.10sec 3468535 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 0 0 11.65 0 0 7.3 88.0 33.1% 0.0% 0.0% 0.0% 62.10sec 28470680 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 8427356 18590 5.05 164410 356086 38.1 38.1 29.5% 0.0% 0.0% 0.0% 11.85sec 8427356 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 8330098 18511 19.24 42519 93058 72.7 144.3 30.1% 0.0% 0.0% 0.0% 6.00sec 8330098 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 4343801 9582 9.05 42455 112542 68.4 68.4 30.0% 0.0% 0.0% 0.0% 6.30sec 4343801 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear ticks -48045 14395 32 0.01 23549 52445 0.3 0.1 29.8% 0.0% 0.0% 0.0% 143.75sec 14395 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_mastery 124469 7506 17 0.03 23560 63694 0.2 0.2 29.2% 0.0% 0.0% 0.0% 8.87sec 7506 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 8476819 18699 5.72 144057 316473 43.2 43.2 30.2% 0.0% 0.0% 0.0% 9.42sec 8476819 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 3670212 8096 21.17 22950 0 159.9 159.9 0.0% 0.0% 0.0% 0.0% 2.80sec 3670212 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.44sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 3866085 8528 1.90 198867 431553 14.4 14.4 30.0% 0.0% 0.0% 0.0% 6.31sec 3866085 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 15866461 35259 51.57 30339 66194 95.2 386.8 29.8% 0.0% 0.0% 0.0% 4.57sec 15866461 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 8403166 18537 24.28 30718 81368 183.6 183.4 29.8% 0.0% 0.0% 0.0% 2.39sec 8403166 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.41 0 0 3.1 3.1 0.0% 0.0% 0.0% 0.0% 180.32sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 3078630 6791 18.96 15818 34640 169.9 143.2 30.2% 0.0% 0.0% 0.0% 2.57sec 3078630 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 600446 1325 2.33 22840 57262 17.6 17.6 32.7% 0.0% 0.0% 0.0% 18.49sec 600446 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 7319693 16266 20.74 34508 76003 25.3 155.6 30.2% 0.0% 0.0% 0.0% 16.90sec 7319693 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 3807030 8398 9.76 34307 91816 73.8 73.7 30.2% 0.0% 0.0% 0.0% 5.63sec 3807030 453.33sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 4110925 113031 64.87 77612 179241 39.3 39.3 30.9% 0.0% 24.0% 0.0% 10.35sec 4110925 36.37sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 74.83sec 0 36.37sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 13108 360 13.20 1085 2691 8.0 8.0 34.5% 0.0% 0.0% 0.0% 0.73sec 13108 36.37sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 3822512 8432 1.84 204334 442845 13.9 13.9 29.4% 0.0% 0.0% 0.0% 32.14sec 3822512 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 3342318 7373 8.53 34901 91460 64.5 64.5 30.0% 0.0% 0.0% 0.0% 6.58sec 3342318 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 6205297 13790 18.13 34029 73415 13.9 136.0 29.5% 0.0% 0.0% 0.0% 32.14sec 6205297 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF dispersion 47585 0 0 0.30 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 143.32sec 0 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 9712777 21584 22.52 27069 59204 0.0 168.9 29.8% 0.0% 0.0% 0.0% 0.00sec 9712777 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 0.83 0 0 6.3 6.3 30.0% 0.0% 0.0% 0.0% 67.14sec 0 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 3223952 7112 1.77 179297 390451 6.3 13.4 29.3% 0.0% 0.0% 0.0% 67.14sec 3223952 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 0 0 9.90 0 0 6.3 74.8 33.3% 0.0% 0.0% 0.0% 67.14sec 25094458 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 8261004 18223 4.81 169184 367397 36.3 36.3 29.4% 0.0% 0.0% 0.0% 12.42sec 8261004 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 8336335 18525 18.85 43602 94821 71.7 141.4 30.0% 0.0% 0.0% 0.0% 6.07sec 8336335 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 4355350 9607 8.88 43568 114753 67.1 67.1 30.0% 0.0% 0.0% 0.0% 6.40sec 4355350 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear ticks -48045 6960 15 0.01 23910 54090 0.3 0.1 28.1% 0.0% 0.0% 0.0% 121.72sec 6960 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_mastery 124469 3674 8 0.01 23867 66204 0.1 0.1 29.1% 0.0% 0.0% 0.0% 7.47sec 3674 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 7328557 16166 4.86 146908 321957 36.7 36.7 30.1% 0.0% 0.0% 0.0% 10.53sec 7328557 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 3442578 7594 19.08 23883 0 144.1 144.1 0.0% 0.0% 0.0% 0.0% 3.10sec 3442578 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 4071271 8981 1.76 226984 492846 13.3 13.3 30.0% 0.0% 0.0% 0.0% 6.87sec 4071271 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 14276553 31726 45.31 31048 67870 85.9 339.8 29.8% 0.0% 0.0% 0.0% 4.98sec 14276553 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 7557251 16671 21.33 31438 83352 161.2 161.1 29.8% 0.0% 0.0% 0.0% 2.67sec 7557251 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.41 0 0 3.1 3.1 0.0% 0.0% 0.0% 0.0% 180.28sec 0 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 2729081 6020 16.82 15800 34653 149.2 127.1 30.1% 0.0% 0.0% 0.0% 2.88sec 2729081 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 516745 1140 2.05 22459 55611 15.5 15.5 32.7% 0.0% 0.0% 0.0% 21.33sec 516745 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 6278305 13952 17.56 34953 76902 22.5 131.7 30.3% 0.0% 0.0% 0.0% 18.37sec 6278305 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 3275848 7226 8.27 34897 93232 62.5 62.5 30.1% 0.0% 0.0% 0.0% 6.34sec 3275848 453.33sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 4122053 113289 64.87 77740 179472 39.3 39.3 31.0% 0.0% 24.0% 0.0% 10.34sec 4122053 36.39sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 74.78sec 0 36.39sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 13038 358 13.19 1082 2678 8.0 8.0 34.4% 0.0% 0.0% 0.0% 0.73sec 13038 36.39sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 5358369 11820 2.69 195238 424196 20.4 20.4 29.7% 0.0% 0.0% 0.0% 21.86sec 5358369 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 4642592 10241 12.53 32973 86451 94.8 94.7 30.1% 0.0% 0.0% 0.0% 4.54sec 4642592 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 8794080 19542 26.63 32695 70716 20.4 199.7 29.8% 0.0% 0.0% 0.0% 21.86sec 8794080 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI dispersion 47585 0 0 0.17 0 0 1.3 1.3 0.0% 0.0% 0.0% 0.0% 164.24sec 0 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 10263633 22808 23.52 25674 55855 0.0 176.4 29.8% 0.0% 0.0% 0.0% 0.00sec 10263633 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.23 0 0 9.3 9.3 30.0% 0.0% 0.0% 0.0% 48.33sec 0 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 3998078 8819 2.20 178803 387127 9.3 16.6 29.7% 0.0% 0.0% 0.0% 48.33sec 3998078 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 0 0 13.78 0 0 9.3 104.1 33.1% 0.0% 0.0% 0.0% 48.33sec 33677277 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 13239180 29204 7.22 180772 391277 54.6 54.6 29.4% 0.0% 0.0% 0.0% 8.30sec 13239180 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 9914443 22032 23.32 41851 91265 89.3 174.9 30.0% 0.0% 0.0% 0.0% 4.98sec 9914443 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 5165000 11393 10.98 41754 110286 83.0 83.0 29.9% 0.0% 0.0% 0.0% 5.28sec 5165000 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear ticks -48045 76983 171 0.08 23649 52021 0.7 0.6 29.0% 0.0% 0.0% 0.0% 135.39sec 76983 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_mastery 124469 40133 89 0.15 23649 63186 1.1 1.1 28.9% 0.0% 0.0% 0.0% 24.75sec 40133 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.07 0 0 8.1 8.1 0.0% 0.0% 0.0% 0.0% 60.53sec 0 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 4072409 8983 25.13 21446 0 189.9 189.9 0.0% 0.0% 0.0% 0.0% 2.36sec 4072409 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 4552998 10043 2.22 201542 435624 16.8 16.8 30.0% 0.0% 0.0% 0.0% 5.45sec 4552998 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 18389632 40866 61.00 29840 64727 128.4 457.5 29.7% 0.0% 0.0% 0.0% 3.48sec 18389632 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 9757579 21524 28.71 30303 79674 217.0 216.9 29.8% 0.0% 0.0% 0.0% 2.06sec 9757579 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 3600305 7942 22.35 15746 34300 200.3 168.9 30.1% 0.0% 0.0% 0.0% 2.23sec 3600305 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 570130 1258 2.38 21536 53164 18.0 18.0 32.3% 0.0% 0.0% 0.0% 18.21sec 570130 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 8934051 19853 26.13 33634 73394 31.5 196.0 30.1% 0.0% 0.0% 0.0% 14.17sec 8934051 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 4626557 10206 12.29 33432 88331 92.9 92.9 29.8% 0.0% 0.0% 0.0% 4.71sec 4626557 453.33sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 10508962 88859 61.98 66291 144695 122.2 122.2 30.1% 0.0% 24.0% 0.0% 3.64sec 10508962 118.27sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.04 0 0 23.7 23.7 0.0% 0.0% 0.0% 0.0% 19.21sec 0 118.27sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 31021 262 11.40 973 2259 22.5 22.5 31.7% 0.0% 0.0% 0.0% 14.40sec 31021 118.27sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 4076546 8992 2.08 193853 416795 15.7 15.7 29.4% 0.0% 0.0% 0.0% 28.36sec 4076546 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3643707 8038 9.85 33037 86096 74.5 74.4 30.0% 0.0% 0.0% 0.0% 5.71sec 3643707 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 6804622 15121 20.94 32367 69510 15.7 157.1 29.5% 0.0% 0.0% 0.0% 28.36sec 6804622 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI dispersion 47585 0 0 0.25 0 0 1.9 1.9 0.0% 0.0% 0.0% 0.0% 154.91sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 10372759 23051 23.62 25908 56456 0.0 177.2 29.7% 0.0% 0.0% 0.0% 0.00sec 10372759 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.09 0 0 8.2 8.2 29.7% 0.0% 0.0% 0.0% 55.84sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 4415427 9740 2.43 178859 387523 8.2 18.4 29.4% 0.0% 0.0% 0.0% 55.84sec 4415427 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 0 0 12.56 0 0 8.2 94.9 33.1% 0.0% 0.0% 0.0% 55.84sec 30542198 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 9878050 21790 5.39 180869 391473 40.7 40.7 29.3% 0.0% 0.0% 0.0% 11.16sec 9878050 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 10143031 22540 23.46 42456 93007 88.6 175.9 30.1% 0.0% 0.0% 0.0% 4.99sec 10143031 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 5305695 11704 11.04 42492 112797 83.5 83.4 30.0% 0.0% 0.0% 0.0% 5.24sec 5305695 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear ticks -48045 48101 107 0.05 24145 55752 0.8 0.4 29.3% 0.0% 0.0% 0.0% 138.97sec 48101 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_mastery 124469 25069 55 0.09 24159 68316 0.7 0.7 29.1% 0.0% 0.0% 0.0% 18.98sec 25069 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.07 0 0 8.1 8.1 0.0% 0.0% 0.0% 0.0% 60.42sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 3708642 8181 23.42 20958 0 177.0 177.0 0.0% 0.0% 0.0% 0.0% 2.54sec 3708642 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.82sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 4385122 9673 2.11 203714 440910 15.9 15.9 30.0% 0.0% 0.0% 0.0% 5.69sec 4385122 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 18506860 41126 60.59 30210 65644 126.8 454.4 29.7% 0.0% 0.0% 0.0% 3.51sec 18506860 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 9817970 21657 28.52 30648 80819 215.6 215.5 29.7% 0.0% 0.0% 0.0% 2.07sec 9817970 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 3611441 7966 22.40 15748 34359 198.9 169.2 30.1% 0.0% 0.0% 0.0% 2.24sec 3611441 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 630484 1391 2.51 22393 55806 19.0 19.0 32.4% 0.0% 0.0% 0.0% 17.18sec 630484 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 8441894 18760 24.15 34307 75186 28.8 181.1 30.1% 0.0% 0.0% 0.0% 15.40sec 8441894 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 4366109 9631 11.36 34011 90347 85.9 85.8 29.9% 0.0% 0.0% 0.0% 5.09sec 4366109 453.33sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 10508259 88633 61.97 66188 144299 122.5 122.5 30.0% 0.0% 24.0% 0.0% 3.63sec 10508259 118.56sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.04 0 0 23.8 23.8 0.0% 0.0% 0.0% 0.0% 19.17sec 0 118.56sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 30722 259 11.44 961 2222 22.6 22.6 31.5% 0.0% 0.0% 0.0% 14.30sec 30722 118.56sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 4177197 9214 2.01 204874 442031 15.2 15.2 29.4% 0.0% 0.0% 0.0% 29.36sec 4177197 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3651909 8056 9.32 34988 91423 70.5 70.4 29.9% 0.0% 0.0% 0.0% 6.04sec 3651909 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 6781362 15070 19.81 34088 73381 15.2 148.6 29.4% 0.0% 0.0% 0.0% 29.36sec 6781362 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF dispersion 47585 0 0 0.28 0 0 2.1 2.1 0.0% 0.0% 0.0% 0.0% 150.75sec 0 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 10071106 22380 22.54 26982 58799 0.0 169.1 29.7% 0.0% 0.0% 0.0% 0.00sec 10071106 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 0.96 0 0 7.3 7.3 29.7% 0.0% 0.0% 0.0% 60.36sec 0 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 3623585 7993 1.99 179794 386778 7.3 15.1 29.4% 0.0% 0.0% 0.0% 60.36sec 3623585 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 0 0 10.96 0 0 7.3 82.8 33.1% 0.0% 0.0% 0.0% 60.36sec 27721830 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 9810321 21641 5.20 186163 403194 39.3 39.3 29.3% 0.0% 0.0% 0.0% 11.56sec 9810321 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 9923952 22053 22.46 43524 94866 86.7 168.4 30.0% 0.0% 0.0% 0.0% 5.10sec 9923952 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 5189579 11448 10.57 43585 115146 79.9 79.9 29.9% 0.0% 0.0% 0.0% 5.48sec 5189579 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear ticks -48045 40952 91 0.04 24484 58757 0.7 0.3 29.4% 0.0% 0.0% 0.0% 129.05sec 40952 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_mastery 124469 21644 48 0.07 24457 72407 0.6 0.6 29.2% 0.0% 0.0% 0.0% 13.64sec 21644 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.07 0 0 8.1 8.1 0.0% 0.0% 0.0% 0.0% 60.40sec 0 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 3562642 7859 21.49 21941 0 162.4 162.4 0.0% 0.0% 0.0% 0.0% 2.75sec 3562642 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 4804135 10597 2.03 231986 502539 15.3 15.3 30.0% 0.0% 0.0% 0.0% 5.92sec 4804135 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 17237538 38306 54.72 31166 67697 115.5 410.4 29.7% 0.0% 0.0% 0.0% 3.84sec 17237538 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 9134647 20150 25.74 31616 83239 194.6 194.5 29.7% 0.0% 0.0% 0.0% 2.29sec 9134647 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 3281026 7238 20.39 15724 34299 179.6 154.0 30.0% 0.0% 0.0% 0.0% 2.47sec 3281026 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 561743 1239 2.28 22203 54414 17.2 17.2 32.3% 0.0% 0.0% 0.0% 19.01sec 561743 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 7570064 16822 21.24 35019 76610 25.7 159.3 30.1% 0.0% 0.0% 0.0% 17.29sec 7570064 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 3941051 8694 9.99 34976 92719 75.5 75.5 29.9% 0.0% 0.0% 0.0% 5.74sec 3941051 453.33sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 10506635 88586 61.97 66213 144376 122.5 122.5 29.9% 0.0% 24.0% 0.0% 3.63sec 10506635 118.60sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.04 0 0 23.8 23.8 0.0% 0.0% 0.0% 0.0% 19.16sec 0 118.60sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 30693 259 11.40 964 2226 22.5 22.5 31.6% 0.0% 0.0% 0.0% 14.36sec 30693 118.60sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 4498930 9924 2.27 194221 423986 17.2 17.2 29.6% 0.0% 0.0% 0.0% 25.94sec 4498930 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 3932904 8676 10.59 32986 86774 80.1 80.0 30.0% 0.0% 0.0% 0.0% 5.32sec 3932904 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 7391255 16425 22.51 32506 70461 17.2 168.8 29.7% 0.0% 0.0% 0.0% 25.94sec 7391255 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI dispersion 47585 0 0 0.31 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 146.53sec 0 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 9367772 20817 22.17 25651 55939 0.0 166.3 29.8% 0.0% 0.0% 0.0% 0.00sec 9367772 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 0.89 0 0 6.7 6.7 30.2% 0.0% 0.0% 0.0% 65.55sec 0 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 2802250 6181 1.53 179190 391785 6.7 11.6 29.8% 0.0% 0.0% 0.0% 65.55sec 2802250 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 0 0 10.60 0 0 6.7 80.1 33.4% 0.0% 0.0% 0.0% 65.55sec 26225765 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 10965257 24188 6.09 177609 385498 46.0 46.0 29.3% 0.0% 0.0% 0.0% 9.67sec 10965257 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 6750112 15000 15.88 41754 91554 58.0 119.1 29.9% 0.0% 0.0% 0.0% 7.37sec 6750112 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 3526121 7778 7.48 41698 110885 56.5 56.5 30.0% 0.0% 0.0% 0.0% 7.45sec 3526121 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 7263362 16141 9.38 76512 165330 34.4 70.3 30.1% 0.0% 0.0% 0.0% 12.47sec 7263362 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 3762365 8299 4.42 76071 198551 33.4 33.4 29.9% 0.0% 0.0% 0.0% 12.69sec 3762365 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear ticks -48045 32475 72 0.03 23587 52327 0.3 0.3 29.4% 0.0% 0.0% 0.0% 129.12sec 32475 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_mastery 124469 16935 37 0.06 23574 63753 0.5 0.5 29.1% 0.0% 0.0% 0.0% 7.43sec 16935 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 3537479 7803 20.59 22736 0 155.6 155.6 0.0% 0.0% 0.0% 0.0% 2.87sec 3537479 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 3468342 7651 1.71 199059 432102 12.9 12.9 29.7% 0.0% 0.0% 0.0% 7.01sec 3468342 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 14173407 31496 46.84 29871 65168 94.1 351.3 29.7% 0.0% 0.0% 0.0% 4.55sec 14173407 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 7514829 16577 22.05 30283 80163 166.7 166.6 29.7% 0.0% 0.0% 0.0% 2.59sec 7514829 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.41 0 0 3.1 3.1 0.0% 0.0% 0.0% 0.0% 180.30sec 0 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 2818517 6217 17.46 15741 34461 153.8 131.9 30.1% 0.0% 0.0% 0.0% 2.80sec 2818517 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 549342 1212 2.27 21669 53746 17.1 17.1 32.4% 0.0% 0.0% 0.0% 19.04sec 549342 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 6115924 13591 17.77 33750 74100 21.2 133.3 30.1% 0.0% 0.0% 0.0% 19.36sec 6115924 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 3174955 7004 8.36 33555 89422 63.2 63.2 29.9% 0.0% 0.0% 0.0% 6.30sec 3174955 453.33sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 4130786 113561 64.87 78017 179948 39.3 39.3 30.9% 0.0% 24.1% 0.0% 10.35sec 4130786 36.38sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 74.82sec 0 36.38sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 12853 353 13.19 1071 2652 8.0 8.0 33.9% 0.0% 0.0% 0.0% 0.73sec 12853 36.38sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 3436568 7581 1.76 192394 417143 13.3 13.3 29.1% 0.0% 0.0% 0.0% 33.50sec 3436568 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 3106960 6854 8.36 33123 86807 63.2 63.1 30.0% 0.0% 0.0% 0.0% 6.67sec 3106960 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 5739001 12753 17.78 32131 69297 13.3 133.3 29.3% 0.0% 0.0% 0.0% 33.50sec 5739001 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI dispersion 47585 0 0 0.33 0 0 2.5 2.5 0.0% 0.0% 0.0% 0.0% 149.50sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 9222942 20495 21.67 25911 56659 0.0 162.5 29.7% 0.0% 0.0% 0.0% 0.00sec 9222942 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 0.80 0 0 6.1 6.1 29.7% 0.0% 0.0% 0.0% 74.72sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 3203685 7067 1.77 178026 388197 6.1 13.3 29.5% 0.0% 0.0% 0.0% 74.72sec 3203685 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 0 0 10.04 0 0 6.1 75.8 33.2% 0.0% 0.0% 0.0% 74.72sec 24654507 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 8147936 17973 4.55 176765 384402 34.3 34.3 29.1% 0.0% 0.0% 0.0% 12.98sec 8147936 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 7419807 16488 17.10 42506 93725 60.8 128.2 30.0% 0.0% 0.0% 0.0% 7.02sec 7419807 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 3884249 8568 8.04 42537 113796 60.8 60.8 30.0% 0.0% 0.0% 0.0% 6.94sec 3884249 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 5664700 12588 7.05 79688 171039 26.6 52.9 30.0% 0.0% 0.0% 0.0% 16.07sec 5664700 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 2942955 6492 3.32 79524 206277 25.1 25.1 29.9% 0.0% 0.0% 0.0% 16.88sec 2942955 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear ticks -48045 33712 75 0.04 23954 51759 0.4 0.3 29.3% 0.0% 0.0% 0.0% 161.56sec 33712 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_mastery 124469 17593 39 0.07 23965 62674 0.5 0.5 29.3% 0.0% 0.0% 0.0% 7.34sec 17593 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 3196429 7051 19.13 22119 0 144.5 144.5 0.0% 0.0% 0.0% 0.0% 3.09sec 3196429 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.34sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 3459776 7632 1.70 199529 432983 12.9 12.9 29.7% 0.0% 0.0% 0.0% 7.04sec 3459776 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 14332776 31851 46.77 30217 66125 92.0 350.8 29.6% 0.0% 0.0% 0.0% 4.66sec 14332776 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 7601692 16769 22.01 30622 81450 166.4 166.3 29.7% 0.0% 0.0% 0.0% 2.60sec 7601692 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.41 0 0 3.1 3.1 0.0% 0.0% 0.0% 0.0% 180.23sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 2813279 6206 17.40 15742 34572 153.4 131.4 30.1% 0.0% 0.0% 0.0% 2.81sec 2813279 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 610611 1347 2.41 22533 56415 18.2 18.2 32.5% 0.0% 0.0% 0.0% 17.82sec 610611 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 5960095 13245 16.77 34657 76636 20.6 125.8 30.3% 0.0% 0.0% 0.0% 20.29sec 5960095 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 3071760 6776 7.89 34217 91821 59.6 59.6 30.1% 0.0% 0.0% 0.0% 6.69sec 3071760 453.33sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 4123537 113260 64.86 77920 179231 39.4 39.4 30.9% 0.0% 23.9% 0.0% 10.35sec 4123537 36.41sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 74.79sec 0 36.41sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 12705 349 13.18 1062 2624 8.0 8.0 33.7% 0.0% 0.0% 0.0% 0.73sec 12705 36.41sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 3474685 7665 1.70 201866 438663 12.8 12.8 29.2% 0.0% 0.0% 0.0% 34.88sec 3474685 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3073170 6779 7.86 34824 91287 59.5 59.4 30.0% 0.0% 0.0% 0.0% 7.11sec 3073170 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 5633098 12518 16.73 33597 72399 12.8 125.4 29.2% 0.0% 0.0% 0.0% 34.88sec 5633098 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF dispersion 47585 0 0 0.34 0 0 2.6 2.6 0.0% 0.0% 0.0% 0.0% 144.78sec 0 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 9075014 20167 20.86 27005 58961 0.0 156.5 29.7% 0.0% 0.0% 0.0% 0.00sec 9075014 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 0.67 0 0 5.1 5.1 30.3% 0.0% 0.0% 0.0% 83.93sec 0 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 2658593 5865 1.46 179323 389397 5.1 11.0 29.4% 0.0% 0.0% 0.0% 83.93sec 2658593 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 0 0 8.29 0 0 5.1 62.6 33.5% 0.0% 0.0% 0.0% 83.93sec 21190969 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 7964313 17568 4.38 179690 389867 33.1 33.1 29.1% 0.0% 0.0% 0.0% 13.37sec 7964313 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 7169927 15933 16.28 43329 94726 58.4 122.1 29.9% 0.0% 0.0% 0.0% 7.31sec 7169927 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 3761859 8298 7.67 43417 115171 58.0 57.9 30.0% 0.0% 0.0% 0.0% 7.26sec 3761859 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 5715790 12702 6.77 83728 180110 25.7 50.7 30.0% 0.0% 0.0% 0.0% 16.65sec 5715790 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 2968419 6548 3.18 83533 217029 24.1 24.0 29.9% 0.0% 0.0% 0.0% 17.60sec 2968419 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear ticks -48045 31771 71 0.03 24124 52013 0.4 0.2 28.7% 0.0% 0.0% 0.0% 169.41sec 31771 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_mastery 124469 16685 37 0.06 24138 63069 0.5 0.5 29.5% 0.0% 0.0% 0.0% 14.27sec 16685 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 3016981 6655 17.28 23105 0 130.6 130.6 0.0% 0.0% 0.0% 0.0% 3.42sec 3016981 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 3653458 8059 1.58 226419 490603 12.0 12.0 29.9% 0.0% 0.0% 0.0% 7.54sec 3653458 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 12861001 28580 41.04 30877 67640 82.5 307.8 29.7% 0.0% 0.0% 0.0% 5.13sec 12861001 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 6824131 15053 19.31 31315 83277 146.0 145.9 29.7% 0.0% 0.0% 0.0% 2.93sec 6824131 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.41 0 0 3.1 3.1 0.0% 0.0% 0.0% 0.0% 180.24sec 0 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 2475795 5461 15.31 15736 34579 134.7 115.7 30.1% 0.0% 0.0% 0.0% 3.16sec 2475795 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 520050 1147 2.11 22150 54829 15.9 15.9 32.2% 0.0% 0.0% 0.0% 20.55sec 520050 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 5055997 11236 14.10 34965 77236 17.8 105.8 30.4% 0.0% 0.0% 0.0% 23.08sec 5055997 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 2619563 5778 6.64 34722 93115 50.2 50.1 30.0% 0.0% 0.0% 0.0% 7.79sec 2619563 453.33sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 4128518 113397 64.87 77991 179413 39.4 39.4 30.9% 0.0% 24.0% 0.0% 10.35sec 4128518 36.41sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 74.76sec 0 36.41sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 12703 349 13.18 1058 2617 8.0 8.0 34.0% 0.0% 0.0% 0.0% 0.73sec 12703 36.41sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=597|1:|0|&chxp=1,1,-nan,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.06% 10.06%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.90% 9.90%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.66% 11.66%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.66%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 12.46% 12.46%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:12.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.43% 11.43%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.47% 10.47%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.67% 10.67%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 9.89% 9.89%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:9.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.85% 7.85%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.61% 5.61%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals {$m2=100}% weapon damage, absorbs the next ${{$m1=100}/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1978598.23
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 453.33
Minimum 312.22
Maximum 597.27
Spread ( max - min ) 285.05
Range [ ( max - min ) / 2 * 100% ] 31.44%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 1988346.40
Minimum 1741542.39
Maximum 2299264.62
Spread ( max - min ) 557722.23
Range [ ( max - min ) / 2 * 100% ] 14.02%
Standard Deviation 79155.6458
5th Percentile 1860507.24
95th Percentile 2114117.02
( 95th Percentile - 5th Percentile ) 253609.78
Mean Distribution
Standard Deviation 500.7044
95.00% Confidence Intervall ( 1987365.04 - 1989327.76 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 6088
0.1 Scale Factor Error with Delta=300 53486904
0.05 Scale Factor Error with Delta=300 213947616
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 714291384 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
337147.5 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=597|1:|0|&chxp=1,1,-nan,100 http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.9s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 337147.46
Combat End Resource Mean Min Max
Health 894850426.57 712054623.88 1069059622.75

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 94.89
Minimum 60.00
Maximum 130.00
Spread ( max - min ) 70.00
Range [ ( max - min ) / 2 * 100% ] 36.88%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 340220.01
Minimum 253755.39
Maximum 459525.15
Spread ( max - min ) 205769.76
Range [ ( max - min ) / 2 * 100% ] 30.24%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add2 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
298011.1 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add2 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=597|1:|0|&chxp=1,1,-nan,100 http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add2 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.9s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 298011.15
Combat End Resource Mean Min Max
Health 895050207.75 712305768.65 1069399163.89

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 24992
Mean 94.89
Minimum 60.00
Maximum 130.00
Spread ( max - min ) 70.00
Range [ ( max - min ) / 2 * 100% ] 36.88%
DPS
Sample Data Add2 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add2 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 24992
Mean 300730.79
Minimum 225972.25
Maximum 414705.53
Spread ( max - min ) 188733.28
Range [ ( max - min ) / 2 * 100% ] 31.38%
HPS
Sample Data Add2 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add2 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add3 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
291496.3 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add3 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=597|1:|0|&chxp=1,1,-nan,100 http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add3 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.9s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 291496.32
Combat End Resource Mean Min Max
Health 895096744.17 712811359.08 1069055376.22

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 24992
Mean 94.89
Minimum 60.00
Maximum 130.00
Spread ( max - min ) 70.00
Range [ ( max - min ) / 2 * 100% ] 36.88%
DPS
Sample Data Add3 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add3 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 24992
Mean 294216.29
Minimum 194849.43
Maximum 393944.37
Spread ( max - min ) 199094.94
Range [ ( max - min ) / 2 * 100% ] 33.83%
HPS
Sample Data Add3 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add3 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.