close

SimulationCraft 530-8

for World of Warcraft 5.4.0 PTR (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3
4 adds,count=3,first=45,cooldown=45,duration=10

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 6.83 - 5.10 - - - 6.43 - 4.27 5.02 4.12 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 6.63 - 4.99 - - - 6.36 - 4.33 4.55 4.00 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 6.68 - 5.08 - - - 6.75 - 4.34 5.86 4.08 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 6.93 - 5.17 - - - 6.43 - 4.44 4.93 4.35 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 6.84 - 5.20 - - - 7.66 - 4.52 7.81 4.16 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 6.93 - 5.26 - - - 6.95 - 4.43 6.63 4.33 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 6.93 - 5.24 - - - 7.67 - 4.39 4.69 5.03 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 7.03 - 5.21 - - - 8.25 - 4.53 4.67 4.81 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 6.65 - 4.86 - - - 7.48 - 4.09 2.01 5.38 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 273850 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
273850.0 273850.0 109.45 / 0.04% 14562 / 5.3% 48.0 5528.2 5289.0 Mana 0.61% 49.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.83 5.10 6.43 4.27 5.02 4.12
Normalized 1.00 0.75 0.94 0.63 0.74 0.60
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.15 0.15 0.16 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP ~= Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=6.83, SpellDamage=5.10, HitRating=6.43, CritRating=4.27, HasteRating=5.02, MasteryRating=4.12 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=6.83, SpellDamage=5.10, HitRating=0.00, CritRating=4.27, HasteRating=5.02, MasteryRating=4.12 )

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:830573|318961|315633|239940|231098|200231|176718|120298|83955&chds=0,1661145&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++830573++devouring_plague,9482C9,0,0,15|t++318961++vampiric_touch,9482C9,1,0,15|t++315633++shadow_word_pain,9482C9,2,0,15|t++239940++shadow_word_death,9482C9,3,0,15|t++231098++halo,9482C9,4,0,15|t++200231++mind_blast,9482C9,5,0,15|t++176718++mind_spike,4A79D3,6,0,15|t++120298++mind_flay,9482C9,7,0,15|t++83955++mind_sear,9482C9,8,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,10,9,9,8,8,7,7,5,4,4,4,4,3,3,2,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|mind_spike|vampiric_touch|mind_flay|essence_of_yulon|shadow_word_pain_mastery|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.83,6.43,5.10,5.02,4.27,4.12|6.67,6.27,4.95,4.87,4.12,3.96|6.98,6.59,5.25,5.17,4.43,4.27&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.83++Int,FFFFFF,0,0,15,0.1,e|t++++6.43++Hit,FFFFFF,0,1,15,0.1,e|t++++5.10++SP,FFFFFF,0,2,15,0.1,e|t++++5.02++Haste,FFFFFF,0,3,15,0.1,e|t++++4.27++Crit,FFFFFF,0,4,15,0.1,e|t++++4.12++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.201& http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:afiloqtwy124666787531ywvutsrqqqqqrqppoonnnopqrssrrqonmlkkjjiihgfedcccccddddeeeeeeddeefgghhhiijjiiiiijjjihhggfedbaZZYYXYYYYYZZZZZZabdfhjllmmmmmmllllllllllkjihhhhhhhhhihiiihgfffghijkklmnooooooopqqppnmkjjihgfeeeeeeeeedddddddefgijjjjjihgfeedddddddcaZZZZYabccdefffffeefghhiijkllmmmmmmmmnnmllkkkjihggffgggfffgggggggghijkmnmmnnnnmmmmmmmmmlkjihhhhgggggghggggfdcbbbcdeffghijkkkllmopqqqponnmmljiiiiiiiiijjjjjjjklmnpppqqrqpppppqqqqqponmlllkklmmmmmmmllllllmnnoopppqqqqqqqqrrrrqqppoomkiihgffffffffffffffhklnopqqrrrrrrrrrrrrrqqpooooonnnnnnonnnnmlllllmnoppqrssssssrrrpomkgdaXVT&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5994,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=273850|max=456837&chxp=1,1,60,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,1,7,6,19,20,47,77,117,195,273,378,495,649,854,1022,1162,1316,1414,1628,1660,1718,1634,1556,1469,1277,1129,963,806,667,580,454,364,310,190,136,128,87,64,38,27,17,14,9,2,3,4,0,1,1&chds=0,1718&chbh=5&chxt=x&chxl=0:|min=242151|avg=273850|max=314549&chxp=0,1,44,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:28.4,16.9,13.8,13.0,11.2,4.6,3.8,2.5,0.7,0.1,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 128.2s|shadow_word_pain 76.2s|mind_spike 62.4s|mind_blast 58.6s|vampiric_touch 50.4s|devouring_plague 20.7s|shadow_word_death 17.0s|halo 11.4s|shadowfiend 3.1s|mind_sear 0.3s|waiting 2.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 273850
devouring_plague 11100 (38057) 4.1% (13.9%) 19.9 22.21sec 861302 830573 186355 403369 251249 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 1.0370 0.0000 5007520.52 5007520.52 0.00 830572.53 830572.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.96 70.07% 186354.84 165521 297038 186356.84 166164 217429 2602395 2602395 0.00
crit 5.96 29.92% 403368.67 344876 742683 403369.68 0 618903 2405125 2405125 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9298 3.4% 89.9 4.76sec 46647 0 31427 82212 46711 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.91 89.79 0.00 0.00 0.0000 0.0000 4193988.39 4193988.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.74 69.88% 31426.68 27587 49507 31439.80 28099 35877 1971846 1971846 0.00
crit 27.03 30.10% 82211.71 69438 153492 82196.46 70901 102672 2222143 2222143 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17659 6.5% 19.9 22.21sec 399625 0 0 0 0 0.0% 0.0% 0.0% 0.0% 189.5 31210 67411 42037 29.9% 0.0% 25.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 189.47 189.47 0.0000 0.6072 7964764.24 7964764.24 0.00 69230.53 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.8 70.09% 31209.77 27587 83716 31222.57 28123 55250 4144893 4144893 0.00
crit 56.7 29.91% 67411.16 57481 174430 67387.53 58813 121244 3819872 3819872 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20969 7.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 181.2 24482 53394 33099 29.8% 0.0% 31.7%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 38.06 181.22 285.67 0.0000 0.7900 9455319.28 9455319.28 0.00 66043.99 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 200.5 70.18% 24481.59 21627 39475 24492.98 22482 27808 4907950 4907950 0.00
crit 85.2 29.81% 53394.47 45062 98700 53395.57 46996 63316 4547369 4547369 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (5855) 0.0% (2.1%) 11.0 42.45sec 239617 231098 0 0 0 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.02 0.00 0.00 1.0369 0.0000 0.00 0.00 0.00 231098.24 231098.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.76 70.41% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.26 29.58% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 5855 2.1% 11.0 42.45sec 239617 0 173375 373657 232867 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.34 0.00 0.00 0.0000 0.0000 2640297.38 2640297.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.97 70.26% 173374.65 157064 265830 173376.73 157064 220975 1381104 1381104 0.00
crit 3.37 29.72% 373656.65 327255 664654 365830.98 0 651362 1259193 1259193 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26010 9.5% 54.5 8.24sec 215114 200231 159811 346156 215113 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.51 54.51 0.00 0.00 1.0743 0.0000 11726537.07 11726537.07 0.00 200231.15 200231.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.32 70.29% 159810.65 132475 382319 159769.65 138791 187080 6123689 6123689 0.00
crit 16.19 29.69% 346155.98 276022 955911 346152.14 278733 470026 5602848 5602848 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 22522 (34219) 8.2% (12.5%) 92.7 4.75sec 166295 120298 0 0 0 0.0% 0.0% 0.0% 0.0% 185.9 40126 88024 54570 30.2% 0.0% 24.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.71 92.71 185.95 185.95 1.3824 0.5932 10147165.64 10147165.64 0.00 120298.18 120298.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.70 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.9 69.84% 40125.77 35102 62990 40151.22 36855 45424 5211123 5211123 0.00
crit 56.1 30.16% 88023.83 73139 157494 88058.38 76352 106094 4936043 4936043 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 11698 4.3% 88.2 4.96sec 59765 0 39914 106072 59795 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.18 88.13 0.00 0.00 0.0000 0.0000 5270008.72 5270008.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.63 69.93% 39913.64 35102 62990 39939.58 36460 45097 2459841 2459841 0.00
crit 26.49 30.06% 106072.25 88353 195295 106118.51 89040 137410 2810167 2810167 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 58 0.0% 0.2 148.61sec 141527 83955 0 0 0 0.0% 0.0% 0.0% 0.0% 0.4 22108 46624 29095 28.5% 0.0% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.19 0.19 0.43 0.91 1.6863 0.6281 26445.75 26445.75 0.00 83954.76 83954.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.6 71.44% 22108.35 20669 35417 3705.28 0 35417 14357 14357 0.00
crit 0.3 28.53% 46624.45 43064 73793 5931.70 0 73793 12089 12089 0.00
miss 0.0 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 31 0.0% 0.4 11.35sec 31959 0 22109 56200 31956 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.43 0.43 0.00 0.00 0.0000 0.0000 13897.47 13897.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.31 71.11% 22108.53 20669 35417 3056.31 0 35417 6836 6836 0.00
crit 0.13 28.89% 56200.03 52023 89144 4958.56 0 89144 7061 7061 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (31) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 24491 8.9% 60.2 7.22sec 183310 176718 135653 294406 183308 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.20 60.20 0.00 0.00 1.0373 0.0000 11035151.00 11035151.00 0.00 176717.93 176717.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.11 69.95% 135653.17 107763 312064 135748.97 116437 172733 5712632 5712632 0.00
crit 18.08 30.03% 294405.82 224533 780251 294629.19 228552 433501 5322519 5322519 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 9745 3.6% 198.5 2.25sec 22134 0 22134 0 22134 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.50 198.50 0.00 0.00 0.0000 0.0000 4393696.58 4393696.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.50 100.00% 22134.17 8570 351160 22144.15 16273 29852 4393697 4393697 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:36465.62
  • base_dd_max:36465.62
shadow_word_death 9033 3.3% 16.4 4.65sec 248840 239940 184645 398139 248846 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.39 16.39 0.00 0.00 1.0371 0.0000 4077773.14 4077773.14 0.00 239939.58 239939.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.46 69.91% 184645.08 148912 430751 184823.09 150088 254874 2115173 2115173 0.00
crit 4.93 30.08% 398138.95 310271 1077005 397081.59 0 853136 1962600 1962600 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 34995 (53289) 12.8% (19.5%) 73.5 6.10sec 327202 315633 0 0 0 0.0% 0.0% 0.0% 0.0% 405.9 28875 62523 38894 29.8% 0.0% 134.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.47 73.47 405.87 405.87 1.0367 1.4932 15786008.23 15786008.23 0.00 35236.01 315633.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.46 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 285.0 70.22% 28875.07 25710 46124 28884.68 26912 31829 8229929 8229929 0.00
crit 120.9 29.78% 62522.60 53569 115323 62524.85 56743 71085 7556079 7556079 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18295 6.7% 192.6 2.32sec 42850 0 28908 75850 42886 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.59 192.43 0.00 0.00 0.0000 0.0000 8252314.05 8252314.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.08 70.20% 28907.58 25710 46124 28915.56 26872 31828 3904913 3904913 0.00
crit 57.32 29.79% 75850.19 64713 143003 75862.13 67937 87351 4347401 4347401 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0487 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6553 2.4% 178.2 2.51sec 16584 0 15130 32895 20480 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 178.17 144.27 0.00 0.00 0.0000 0.0000 2954720.85 2954720.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.78 69.86% 15130.30 13192 24079 15132.51 13873 16796 1524890 1524890 0.00
crit 43.47 30.13% 32894.87 27487 60206 32895.97 29147 38948 1429831 1429831 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1762 0.6% 25.7 12.43sec 30438 0 20632 50912 30438 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.70 25.70 0.00 0.00 0.0000 0.0000 782152.21 782152.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 67.59% 20631.74 16220 29606 20714.14 16910 28805 358350 358350 0.00
crit 8.32 32.39% 50912.09 33796 74024 50540.92 0 74024 423802 423802 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16874.28
  • base_dd_max:16874.28
vampiric_touch 23430 (35677) 8.6% (13.0%) 48.2 9.25sec 333397 318961 0 0 0 0.0% 0.0% 0.0% 0.0% 244.3 31987 69509 43230 30.0% 0.0% 97.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.23 48.23 244.26 244.26 1.0453 1.8001 10559539.30 10559539.30 0.00 32806.47 318960.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.22 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.1 70.04% 31986.74 28140 51287 31999.75 29723 36475 5472013 5472013 0.00
crit 73.2 29.96% 69509.47 58633 128233 69521.61 61245 81561 5087526 5087526 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12247 4.5% 115.9 3.81sec 47638 0 32017 84244 47676 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.85 115.76 0.00 0.00 0.0000 0.0000 5518945.19 5518945.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.03 69.99% 32016.58 28140 51287 32025.92 29527 35448 2594142 2594142 0.00
crit 34.72 29.99% 84244.48 70830 159011 84275.34 73681 105634 2924803 2924803 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 102107 / 8101
melee 101756 2.9% 36.4 10.74sec 98978 112156 72944 171631 98977 30.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.38 36.38 0.00 0.00 0.8825 0.0000 3600655.20 3600655.20 0.00 112155.97 112155.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.50 45.35% 72944.33 56165 115903 73110.41 62753 99664 1203531 1203531 0.00
crit 11.14 30.63% 171630.99 127276 278167 171137.80 129140 270910 1912554 1912554 0.00
glance 8.73 24.00% 55500.81 42124 86927 55537.85 0 86927 484570 484570 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0426 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 351 0.0% 8.0 0.73sec 1540 0 1025 2533 1540 34.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12322.37 12322.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.26 65.79% 1024.78 852 1366 1034.23 0 1366 5393 5393 0.00
crit 2.74 34.20% 2533.05 2045 3278 2400.05 0 3278 6929 6929 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.0 2.9 16.0sec 14.4sec 8.57% 45.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.57%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.9 0.0 22.2sec 22.2sec 11.62% 15.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:11.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.7 0.0 132.8sec 132.8sec 16.24% 16.24%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.24%

    Trigger Attempt Success

    • trigger_pct:99.92%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.7 36.6sec 23.4sec 41.64% 41.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.64%

    Trigger Attempt Success

    • trigger_pct:99.46%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.3 0.0 9.7sec 9.7sec 15.48% 49.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.48%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 43.6 28.4 10.1sec 6.1sec 39.37% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:27.99%
  • surge_of_darkness_2:11.38%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.8 2.4 47.3sec 37.3sec 24.35% 54.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.35%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.9 0.0 55.9sec 55.8sec 17.44% 17.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.44%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.38% 78.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.72% 73.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.42% 16.42%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 19.9 59.8 3.0 3.0 287130.6
halo Mana 11.0 446261.4 40500.0 40499.8 5.9
mind_blast Mana 54.5 236064.6 4330.4 4330.4 49.7
mind_flay Mana 92.7 278130.1 3000.0 3000.0 55.4
mind_sear Mana 0.2 1681.6 9000.0 8999.0 15.7
shadow_word_death Mana 16.4 127824.5 7800.0 7800.3 31.9
shadow_word_pain Mana 73.5 969738.0 13200.0 13199.8 24.8
vampiric_touch Mana 48.2 434031.1 9000.0 8999.9 37.0
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.00 25.92 (0.00%) 18000.00 0.00 0.00%
shadowfiend Mana 36.37 255943.86 (10.73%) 7036.56 71417.10 21.82%
Shadow Orbs from Mind Blast Shadow Orb 54.50 52.97 (86.52%) 0.97 1.53 2.81%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.26 8.26 (13.48%) 1.00 0.00 0.00%
Devouring Plague Health Health 279.26 0.00 (0.00%) 0.00 5945123.85 100.00%
Vampiric Touch Mana Mana 360.02 1632713.23 (68.43%) 4535.01 180146.57 9.94%
halo_heal Health 11.02 0.00 (0.00%) 0.00 3478304.43 100.00%
external_healing Health 84.93 0.00 (0.00%) 0.00 27099631.66 100.00%
mp5_regen Mana 1803.88 497155.51 (20.84%) 275.60 44009.89 8.13%
pet - shadowfiend
external_healing Health 16.28 0.00 (0.00%) 0.00 5244303.31 100.00%
Resource RPS-Gain RPS-Loss
Mana 5288.99 5528.17
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 191698.37 1200.00 300000.00
Shadow Orb 1.46 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 8.2%
shadowfiend-Mana Cap 8.2%
mindbender-Mana Cap 8.2%

Procs

Count Interval
Shadowy Recall Extra Tick 486.5 0.9sec
Shadowy Apparition Procced 178.2 2.5sec
Divine Insight Mind Blast CD Reset 50.1 14.4sec
FDCL Mind Spike proc 72.0 6.1sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 273850.04
Minimum 242151.12
Maximum 314548.64
Spread ( max - min ) 72397.52
Range [ ( max - min ) / 2 * 100% ] 13.22%
Standard Deviation 8827.7197
5th Percentile 259892.19
95th Percentile 289016.37
( 95th Percentile - 5th Percentile ) 29124.18
Mean Distribution
Standard Deviation 55.8403
95.00% Confidence Intervall ( 273740.60 - 273959.49 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3991
0.1 Scale Factor Error with Delta=300 665243
0.05 Scale Factor Error with Delta=300 2660974
0.01 Scale Factor Error with Delta=300 66524365
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 273850.04
Minimum 242151.12
Maximum 314548.64
Spread ( max - min ) 72397.52
Range [ ( max - min ) / 2 * 100% ] 13.22%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 119806245.01
Minimum 86302660.11
Maximum 158128043.84
Spread ( max - min ) 71825383.73
Range [ ( max - min ) / 2 * 100% ] 29.98%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 8.13 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 4.32 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 58.31 mind_blast,if=active_enemies<=5&cooldown_react
F 8.26 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 38.09 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 33.56 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 11.81 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 17.39 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.61 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 13.83 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 11.02 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.03 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 19.55 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 46.37 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.19 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 53.54 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 23.56 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

AIPZEJWEUWUELNOKOUWEUWZZZZEJWUENPUIIIJEEJEIDEOUWZZZELWUWTEWKEJDEPEOIIIUZJEJJJNOUWWEWUKULWEWEINZJEWPEWUWIIEIJJJJINOEUUZZZOUWEJWTTTENWWPEKLWETTENUWAIIEIJJJIOUWEWENUWLOEKOPUZUZZEWLWTEIIIJEJJDEILOUUWIZZEJWPWENEUWLUKWEWUEIIIJDEJEJKOOUWENUPWLUWEUKEENUUWLUTEWIIIJIEJJULWUENPZEZWLTEUUWWUUWEKNULWIAIEIIJEJWPWFCEKNUUEWFCJWZZZZEDFCOUWLTEIIFCIJEJJIDEFCJ8OPUEDFCJWKEWUSFCNOTEOULSFCUKEIEID

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 267002 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
267002.4 267002.4 103.29 / 0.04% 13657 / 5.1% 45.4 5695.7 5475.0 Mana 0.29% 46.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.63 4.99 6.36 4.33 4.55 4.00
Normalized 1.00 0.75 0.96 0.65 0.69 0.60
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.14 0.14 0.15 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=6.63, SpellDamage=4.99, HitRating=6.36, CritRating=4.33, HasteRating=4.55, MasteryRating=4.00 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=6.63, SpellDamage=4.99, HitRating=0.00, CritRating=4.33, HasteRating=4.55, MasteryRating=4.00 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:842117|331157|316081|239161|236289|175977|171416|131595|119083&chds=0,1684233&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9&chm=t++842117++devouring_plague,9482C9,0,0,15|t++331157++vampiric_touch,9482C9,1,0,15|t++316081++shadow_word_pain,9482C9,2,0,15|t++239161++shadow_word_death,9482C9,3,0,15|t++236289++halo,9482C9,4,0,15|t++175977++mind_spike,4A79D3,5,0,15|t++171416++mind_blast,9482C9,6,0,15|t++131595++mind_flay,9482C9,7,0,15|t++119083++mind_sear,9482C9,8,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,10,10,8,7,6,5,5,5,4,4,3,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,9482C9,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_flay|mind_spike|vampiric_touch|essence_of_yulon|shadow_word_pain_mastery|mind_blast|mind_flay_mastery|vampiric_touch_mastery|devouring_plague_tick|multistrike_spell|shadow_word_death|shadowfiend: melee|devouring_plague|shadowy_apparition|devouring_plague_mastery|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.63,6.36,4.99,4.55,4.33,4.00|6.48,6.21,4.85,4.40,4.19,3.85|6.77,6.51,5.14,4.70,4.48,4.15&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.63++Int,FFFFFF,0,0,15,0.1,e|t++++6.36++Hit,FFFFFF,0,1,15,0.1,e|t++++4.99++SP,FFFFFF,0,2,15,0.1,e|t++++4.55++Haste,FFFFFF,0,3,15,0.1,e|t++++4.33++Crit,FFFFFF,0,4,15,0.1,e|t++++4.00++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,7.965& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bgjnqsvx023565668742zwusqponnmnnnonllkjhggghjkkjjihfedcbcccccdccaYYYYYYZZYZaaaaaZYYYZZabbbbccdcccccccddcbcbaaaZYWWVVUVVVWWXYYYYYYYZbdeijkkkkjjihhghhhhiihgdccccccccbcdddddcbaaaacdeeffhiihiihhiijjjjgffeedcaaZaaZZZZZaZYYYYXXXYacedddecbaaaZZZabcccbZYYYYYZabcdeeffeddccddffffffggfffffffffeefdddddcbbaaaaabbccdcbbbaaabcdfhgggggffffefggghggfdccccccccbcdccccbZYXXYZabcdefhijjkkkmnoppqonnmlkjhgfffffeeffeeeeeeeefgijijjjjiiiiijkkkkjjigggfffggggghgggggggghhijjkkklllklllllmllllkjjihfedddccccccdedddeeehjkloppqqqrqqqppppooonmmjjjjjiihhhhiihhihgggfghijkklmmmmlllkllkjhgcZWUSQ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5280,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=267002|max=505705&chxp=1,1,53,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:5,6,8,16,29,52,105,136,208,301,392,569,707,869,1044,1193,1376,1515,1569,1569,1581,1575,1509,1363,1256,1116,953,805,686,553,464,360,277,211,171,129,94,59,51,48,32,7,8,6,2,1,2,0,2,2&chds=0,1581&chbh=5&chxt=x&chxl=0:|min=239384|avg=267002|max=305836&chxp=0,1,42,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:30.4,17.9,14.9,11.8,9.5,3.8,3.2,2.5,0.7,0.1,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 137.0s|shadow_word_pain 80.8s|mind_spike 67.4s|vampiric_touch 53.3s|mind_blast 42.8s|shadow_word_death 17.1s|devouring_plague 14.4s|halo 11.4s|shadowfiend 3.1s|mind_sear 0.3s|waiting 1.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 267002
devouring_plague 7749 (26955) 2.9% (10.1%) 13.9 31.93sec 872968 842117 186557 403137 250913 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.93 13.93 0.00 0.00 1.0367 0.0000 3495849.19 3495849.19 0.00 842116.58 842116.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.79 70.26% 186557.38 165521 311890 186591.21 165521 247638 1826134 1826134 0.00
crit 4.14 29.73% 403137.46 344876 779817 399843.24 0 721991 1669715 1669715 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6669 2.5% 64.0 6.60sec 47045 0 31724 82924 47126 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.97 63.86 0.00 0.00 0.0000 0.0000 3009540.76 3009540.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.64 69.89% 31723.97 27587 51982 31738.45 27840 37436 1416030 1416030 0.00
crit 19.22 30.09% 82923.74 69438 161167 82899.27 69737 107003 1593510 1593510 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12537 4.7% 13.9 31.93sec 406048 0 0 0 0 0.0% 0.0% 0.0% 0.0% 134.8 31211 67288 41953 29.8% 0.0% 17.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.93 13.93 134.85 134.85 0.0000 0.5923 5657299.85 5657299.85 0.00 70834.01 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.7 70.22% 31210.73 27587 105694 31231.21 28055 57558 2955517 2955517 0.00
crit 40.2 29.78% 67288.30 57481 220222 67256.03 58031 131575 2701783 2701783 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20054 7.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 182.0 24715 54197 33499 29.8% 0.0% 31.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 38.10 182.02 270.01 0.0000 0.7907 9044782.42 9044782.42 0.00 62846.34 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.5 70.19% 24714.93 21627 41449 24726.64 22780 27828 4683839 4683839 0.00
crit 80.5 29.80% 54197.12 45062 103635 54209.05 48200 68313 4360944 4360944 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (5982) 0.0% (2.2%) 11.0 42.49sec 244974 236289 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.02 0.00 0.00 1.0368 0.0000 0.00 0.00 0.00 236288.51 236288.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.74 70.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.27 29.72% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 5982 2.2% 11.0 42.49sec 244974 0 175663 378404 235882 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.44 0.00 0.00 0.0000 0.0000 2698414.79 2698414.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.04 70.28% 175662.64 157064 279122 175770.58 157064 215829 1412272 1412272 0.00
crit 3.40 29.71% 378404.03 327255 697887 370218.06 0 664021 1286143 1286143 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 16288 6.1% 35.8 12.61sec 205204 171416 152994 330123 205205 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.79 35.79 0.00 0.00 1.1971 0.0000 7344502.64 7344502.64 0.00 171416.30 171416.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.23 70.50% 152993.85 132475 401435 152955.52 136239 178978 3860348 3860348 0.00
crit 10.55 29.49% 330123.31 276022 1003706 330180.09 276022 500219 3484155 3484155 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 26343 (40029) 9.9% (15.0%) 99.5 4.42sec 181296 131595 0 0 0 0.0% 0.0% 0.0% 0.0% 213.6 40762 89754 55551 30.2% 0.0% 26.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.45 99.45 213.60 213.60 1.3777 0.5660 11865768.27 11865768.27 0.00 131595.33 131595.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.44 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.1 69.81% 40762.37 35102 66140 40788.38 37690 46055 6078654 6078654 0.00
crit 64.5 30.19% 89754.36 73139 165368 89781.56 79503 110093 5787114 5787114 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 13686 5.1% 101.3 4.31sec 60841 0 40562 108182 60872 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.33 101.27 0.00 0.00 0.0000 0.0000 6164765.79 6164765.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.83 69.94% 40562.07 35102 66140 40585.74 37080 46956 2873099 2873099 0.00
crit 30.43 30.04% 108182.34 88353 205060 108223.04 93528 144567 3291666 3291666 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 88 0.0% 0.2 122.25sec 194020 119083 0 0 0 0.0% 0.0% 0.0% 0.0% 0.5 21698 45579 28510 28.5% 0.0% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.20 0.20 0.45 1.39 1.6330 0.6257 39654.76 39654.76 0.00 119083.36 119083.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.0 71.47% 21698.10 20669 37187 4111.93 0 36681 21571 21571 0.00
crit 0.4 28.53% 45578.75 43064 77483 7527.46 0 76007 18084 18084 0.00
miss 0.0 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 45 0.0% 0.7 9.54sec 31077 0 21686 55113 31077 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.65 0.65 0.00 0.00 0.0000 0.0000 20225.49 20225.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.47 71.88% 21685.95 20669 37187 3737.05 0 37187 10145 10145 0.00
crit 0.18 28.10% 55112.98 52023 93601 6500.05 0 91372 10080 10080 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (45) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 26324 9.9% 65.0 6.72sec 182527 175977 134899 293597 182528 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.99 64.99 0.00 0.00 1.0372 0.0000 11862105.33 11862105.33 0.00 175977.35 175977.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.47 69.96% 134899.22 107763 327667 134994.46 114785 158365 6133262 6133262 0.00
crit 19.51 30.03% 293597.11 224533 775784 293761.89 226014 378419 5728844 5728844 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 9325 3.5% 198.1 2.25sec 21225 0 21224 0 21224 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.11 198.11 0.00 0.00 0.0000 0.0000 4204779.48 4204779.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.11 100.00% 21224.47 8570 376952 21234.62 16155 29712 4204779 4204779 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:66710.18
  • base_dd_max:66710.18
power_infusion 0 0.0% 4.3 120.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9070 3.4% 16.5 4.63sec 248039 239161 183659 396255 248037 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.50 16.50 0.00 0.00 1.0372 0.0000 4093004.92 4093004.92 0.00 239161.21 239161.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.50 69.69% 183658.72 148912 452288 183849.17 150088 251854 2112142 2112142 0.00
crit 5.00 30.29% 396255.08 310271 1130856 395297.93 0 877900 1980863 1980863 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37228 (56623) 14.0% (21.2%) 78.0 5.75sec 327658 316081 0 0 0 0.0% 0.0% 0.0% 0.0% 428.2 29123 63140 39221 29.7% 0.0% 135.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.95 77.95 428.17 428.17 1.0366 1.4323 16793171.83 16793171.83 0.00 36800.95 316080.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.95 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.1 70.32% 29123.31 25710 48430 29132.85 27261 32314 8768346 8768346 0.00
crit 127.1 29.68% 63140.08 53569 121089 63147.03 57846 70622 8024826 8024826 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19395 7.3% 203.1 2.21sec 43086 0 29073 76428 43122 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.06 202.90 0.00 0.00 0.0000 0.0000 8749299.73 8749299.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 142.65 70.31% 29072.60 25710 48430 29079.66 27210 31900 4147240 4147240 0.00
crit 60.21 29.68% 76427.52 64713 150153 76448.54 69024 89484 4602059 4602059 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0487 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6880 2.6% 187.3 2.38sec 16559 0 15091 32859 20431 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.31 151.82 0.00 0.00 0.0000 0.0000 3101709.77 3101709.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.15 69.92% 15090.98 13192 24079 15093.65 14041 16754 1601925 1601925 0.00
crit 45.64 30.06% 32859.27 27487 60206 32865.21 28928 39026 1499785 1499785 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2048 0.8% 28.6 11.07sec 31765 0 21436 53161 31766 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.64 28.64 0.00 0.00 0.0000 0.0000 909767.01 909767.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.31 67.41% 21436.20 16220 31086 21526.05 17083 30590 413874 413874 0.00
crit 9.33 32.57% 53160.98 33796 77725 52711.10 33796 77725 495893 495893 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:21791.88
  • base_dd_max:21791.88
vampiric_touch 25798 (39185) 9.7% (14.7%) 51.2 8.72sec 345161 331157 0 0 0 0.0% 0.0% 0.0% 0.0% 265.6 32385 70471 43779 29.9% 0.0% 100.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.16 51.16 265.58 265.58 1.0423 1.7070 11626639.48 11626639.48 0.00 34853.36 331157.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.16 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 186.1 70.08% 32384.78 28140 53851 32399.48 29789 36555 6027774 6027774 0.00
crit 79.4 29.92% 70470.74 58633 134645 70479.06 62515 83572 5598865 5598865 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 13387 5.0% 125.9 3.51sec 47898 0 32208 84875 47936 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.95 125.85 0.00 0.00 0.0000 0.0000 6032651.59 6032651.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.24 70.11% 32208.36 28140 53851 32217.85 29735 36377 2841980 2841980 0.00
crit 37.59 29.87% 84875.29 70830 166962 84904.49 74446 100836 3190671 3190671 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 102191 / 8107
melee 101840 3.0% 36.4 10.74sec 99058 112246 72952 171887 99058 30.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.37 36.37 0.00 0.00 0.8825 0.0000 3603089.66 3603089.66 0.00 112245.78 112245.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.51 45.39% 72952.02 56165 115903 73125.59 62810 115903 1204429 1204429 0.00
crit 11.14 30.62% 171887.41 127276 278167 171368.14 129802 252580 1914516 1914516 0.00
glance 8.72 23.97% 55524.59 42124 86927 55558.32 0 85316 484144 484144 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0427 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 350 0.0% 8.0 0.73sec 1536 0 1023 2527 1536 34.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12287.03 12287.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.27 65.84% 1022.70 852 1366 1031.96 0 1366 5385 5385 0.00
crit 2.73 34.15% 2527.15 2045 3278 2390.82 0 3278 6902 6902 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.9 0.0 31.9sec 31.9sec 9.14% 11.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:9.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.7 0.0 135.6sec 135.6sec 15.96% 15.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.96%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.7 36.5sec 23.4sec 41.68% 41.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.68%

    Trigger Attempt Success

    • trigger_pct:99.45%
power_infusion 4.3 0.0 120.7sec 120.7sec 18.56% 18.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.3 0.0 9.7sec 9.7sec 15.57% 49.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.57%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 9.09%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 46.6 31.8 9.5sec 5.6sec 38.64% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:27.64%
  • surge_of_darkness_2:11.00%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.8 2.4 47.2sec 37.2sec 24.38% 44.78%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.38%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 57.2sec 57.1sec 17.07% 17.07%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.07%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.38% 78.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.96% 73.82%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.42% 16.42%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 13.9 41.8 3.0 3.0 291019.7
halo Mana 11.0 417465.9 37899.8 37899.5 6.5
mind_blast Mana 35.8 310375.2 8671.8 8671.8 23.7
mind_flay Mana 99.5 283906.9 2854.7 2854.7 63.5
mind_sear Mana 0.2 1835.8 8983.1 8982.0 21.6
shadow_word_death Mana 16.5 124027.1 7515.8 7516.1 33.0
shadow_word_pain Mana 78.0 990423.1 12705.3 12705.1 25.8
vampiric_touch Mana 51.2 441250.6 8624.6 8624.5 40.0
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 36.37 232671.25 (9.42%) 6397.76 94637.15 28.91%
Shadow Orbs from Mind Blast Shadow Orb 35.79 34.86 (80.74%) 0.97 0.92 2.58%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.31 8.31 (19.26%) 1.00 0.00 0.00%
Devouring Plague Health Health 198.71 0.00 (0.00%) 0.00 4230291.77 100.00%
Vampiric Touch Mana Mana 391.43 1744570.98 (70.64%) 4456.94 226451.22 11.49%
halo_heal Health 11.02 0.00 (0.00%) 0.00 3471581.66 100.00%
external_healing Health 84.93 0.00 (0.00%) 0.00 27110234.57 100.00%
mp5_regen Mana 1803.88 492493.56 (19.94%) 273.02 48671.84 8.99%
pet - shadowfiend
external_healing Health 16.30 0.00 (0.00%) 0.00 5253233.55 100.00%
Resource RPS-Gain RPS-Loss
Mana 5474.98 5695.66
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 200296.69 7440.00 300000.00
Shadow Orb 1.43 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.0%
shadowfiend-Mana Cap 9.0%
mindbender-Mana Cap 9.0%

Procs

Count Interval
Shadowy Recall Extra Tick 494.5 0.9sec
Shadowy Apparition Procced 187.3 2.4sec
FDCL Mind Spike proc 78.3 5.6sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 267002.41
Minimum 239384.24
Maximum 305835.67
Spread ( max - min ) 66451.44
Range [ ( max - min ) / 2 * 100% ] 12.44%
Standard Deviation 8331.4144
5th Percentile 253985.47
95th Percentile 281299.37
( 95th Percentile - 5th Percentile ) 27313.90
Mean Distribution
Standard Deviation 52.7009
95.00% Confidence Intervall ( 266899.12 - 267105.70 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3740
0.1 Scale Factor Error with Delta=300 592544
0.05 Scale Factor Error with Delta=300 2370178
0.01 Scale Factor Error with Delta=300 59254473
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 267002.41
Minimum 239384.24
Maximum 305835.67
Spread ( max - min ) 66451.44
Range [ ( max - min ) / 2 * 100% ] 12.44%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 116713933.08
Minimum 85095610.50
Maximum 153603276.45
Spread ( max - min ) 68507665.95
Range [ ( max - min ) / 2 * 100% ] 29.35%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 4.29 power_infusion,if=talent.power_infusion.enabled
C 8.19 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.49 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 45.15 mind_blast,if=active_enemies<=5&cooldown_react
F 8.31 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 36.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 37.18 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 12.96 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 16.47 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.44 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 14.69 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 11.02 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.01 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 5.54 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 50.30 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.20 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 51.27 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 28.51 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

ABIPZEJWEUUWJWEINOUWZZZUZEJWUWEIIIJJJJKEOPUWZZZENLUWEWLUEIUWUIIIZEJJJJOPUWENUWKLTEWBIUZEJWEIIIJJJJEINOPUWZZUUZELUWEUWKJTENWAIIEIJJJKOPUEUWELUWKUZZOUZENWLOOUWEIIIJJJKOEJPUWBIZZEJWUUUEWULUKENUWUIIIZZEJJJJPWTEWOUWKLTEUWUZZZENLOUWTEIIIJJJKOEJOPUWZZUZENWLWUUWEWUUKUWELWIABIEIIJJNPWEFCOUWKLESFCNUWZZUZFCELOUWSFCEIIIJJDFCEIJOP8FCNEOUWSFCJEIUUWFCNEWLWFCII

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 268330 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
268330.2 268330.2 102.66 / 0.04% 13576 / 5.1% 43.6 5964.1 5610.0 Mana 0.33% 46.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.68 5.08 6.75 4.34 5.86 4.08
Normalized 1.00 0.76 1.01 0.65 0.88 0.61
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.14 0.14 0.15 0.14 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Hit ~= Int > Haste > SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=6.68, SpellDamage=5.08, HitRating=6.75, CritRating=4.34, HasteRating=5.86, MasteryRating=4.08 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=6.68, SpellDamage=5.08, HitRating=0.00, CritRating=4.34, HasteRating=5.86, MasteryRating=4.08 )

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:878278|320597|314313|272552|245703|182198|178887|129396|127922&chds=0,1756557&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9&chm=t++878278++devouring_plague,9482C9,0,0,15|t++320597++vampiric_touch,9482C9,1,0,15|t++314313++shadow_word_pain,9482C9,2,0,15|t++272552++shadow_word_death,9482C9,3,0,15|t++245703++halo,9482C9,4,0,15|t++182198++mind_spike,4A79D3,5,0,15|t++178887++mind_blast,9482C9,6,0,15|t++129396++mind_sear,9482C9,7,0,15|t++127922++mind_flay,9482C9,8,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,10,10,8,7,7,5,5,5,4,4,3,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_spike|mind_flay|vampiric_touch|essence_of_yulon|shadow_word_pain_mastery|mind_blast|mind_flay_mastery|vampiric_touch_mastery|devouring_plague_tick|shadow_word_death|multistrike_spell|devouring_plague|shadowfiend: melee|devouring_plague_mastery|shadowy_apparition|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.75,6.68,5.86,5.08,4.34,4.08|6.60,6.53,5.71,4.93,4.20,3.94|6.90,6.82,6.01,5.22,4.48,4.23&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.75++Hit,FFFFFF,0,0,15,0.1,e|t++++6.68++Int,FFFFFF,0,1,15,0.1,e|t++++5.86++Haste,FFFFFF,0,2,15,0.1,e|t++++5.08++SP,FFFFFF,0,3,15,0.1,e|t++++4.34++Crit,FFFFFF,0,4,15,0.1,e|t++++4.08++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.109& http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bhknqsvx0245656687531ywvtsrrqqrrstsrqpomlklmopppoomljihghhhhhihhedccccddddefeeeedcbcddeffffghhhghhhhhiihggfffedbaZZYXXXXYYYZYYYYXXYabdgjjjkkkjjiiijjjkkllkhgffgffgggghhhhhgfeeefhijkkkmnnmnnmmnnoooolkjiiigeedeeeeeeeedddcccbbdehjiiiihgfeeddddeefedaYYYYYZabbceefffeedefghiiijklmllllllmnnmlmkkkkjihhhghhiiiijjjiihhhhikmoqppppppoooopqqrrqpolkkkkkkkkklmllkljhgfffhijjkkmnonoopoqstuuvtssrrqpnmlmmmnnnnoonnnnnnoprtvuvvvuuuuvuwwwxxwvurrqqqpqsrqrtrrrrqqqrstuvwwxxxyxwxxyyyyyxxywwvusponnmllkkkkllkjjjjjloqrtvvwwxyyxxxwxwxwxwvvtssssrrqqqqrrrrrqppoopqrtuuvwxxxxxxxy1zxvtplifcZ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6161,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=268330|max=435526&chxp=1,1,62,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,4,8,6,19,29,31,58,103,154,243,349,433,596,798,970,1163,1264,1427,1604,1648,1692,1668,1635,1506,1295,1161,1020,912,729,567,515,353,276,223,154,121,88,54,36,16,25,17,8,2,4,2,0,0,2&chds=0,1692&chbh=5&chxt=x&chxl=0:|min=237904|avg=268330|max=306654&chxp=0,1,44,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:30.8,18.0,14.3,11.9,9.5,3.8,3.2,2.5,0.7,0.1,0.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 138.9s|shadow_word_pain 81.0s|mind_spike 64.6s|vampiric_touch 53.7s|mind_blast 42.7s|shadow_word_death 17.1s|devouring_plague 14.4s|halo 11.4s|shadowfiend 3.1s|mind_sear 0.5s|dispersion 0.0s|waiting 1.5s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 268330
devouring_plague 8211 (28061) 3.1% (10.5%) 13.9 32.07sec 910476 878278 198055 428140 266331 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.90 13.90 0.00 0.00 1.0367 0.0000 3702386.91 3702386.91 0.00 878278.33 878278.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.77 70.30% 198054.69 165521 341594 198095.96 165521 262852 1935527 1935527 0.00
crit 4.13 29.69% 428140.32 344876 854086 424758.35 0 711738 1766860 1766860 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6898 2.6% 62.5 6.76sec 49818 0 33593 87723 49903 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.46 62.36 0.00 0.00 0.0000 0.0000 3111764.17 3111764.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.55 69.85% 33592.59 27587 56933 33608.80 28876 40856 1463061 1463061 0.00
crit 18.79 30.14% 87722.85 69438 176516 87695.31 71340 116475 1648704 1648704 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12952 4.8% 13.9 32.07sec 420298 0 0 0 0 0.0% 0.0% 0.0% 0.0% 131.6 33039 71136 44398 29.8% 0.0% 17.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.90 13.90 131.60 131.60 0.0000 0.6074 5842717.92 5842717.92 0.00 73100.68 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.4 70.18% 33038.51 27587 104806 33058.96 29438 46960 3051530 3051530 0.00
crit 39.2 29.82% 71136.49 57481 218371 71112.83 59875 112916 2791188 2791188 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20378 7.6% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 176.6 25691 56170 34776 29.8% 0.0% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.87 176.58 264.34 0.0000 0.7912 9192717.93 9192717.93 0.00 65801.39 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 185.5 70.18% 25690.79 21627 45397 25700.66 23284 29141 4765720 4765720 0.00
crit 78.8 29.82% 56169.79 45062 113505 56165.95 49300 66725 4426997 4426997 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6216) 0.0% (2.3%) 11.0 42.37sec 254742 245703 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.02 0.00 0.00 1.0368 0.0000 0.00 0.00 0.00 245703.18 245703.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.74 70.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.28 29.72% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6216 2.3% 11.0 42.37sec 254742 0 181231 391496 243326 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.54 0.00 0.00 0.0000 0.0000 2807650.25 2807650.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.13 70.44% 181231.42 157064 305705 181219.62 157064 229811 1473014 1473014 0.00
crit 3.41 29.54% 391496.22 327255 764352 383084.41 0 636960 1334636 1334636 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 16966 6.3% 35.7 12.63sec 214042 178887 159543 344519 214044 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.72 35.72 0.00 0.00 1.1965 0.0000 7646157.61 7646157.61 0.00 178886.78 178886.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.19 70.51% 159542.64 132475 439667 159513.86 139256 191349 4018447 4018447 0.00
crit 10.53 29.48% 344519.31 276022 1041202 344690.41 276022 523253 3627711 3627711 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 25938 (39433) 9.7% (14.7%) 98.8 4.46sec 179841 127922 0 0 0 0.0% 0.0% 0.0% 0.0% 206.6 41631 91171 56545 30.1% 0.0% 27.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.77 98.77 206.65 206.65 1.4059 0.5935 11684731.73 11684731.73 0.00 127921.58 127921.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.76 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.4 69.89% 41630.91 35102 72438 41654.41 37951 46977 6012883 6012883 0.00
crit 62.2 30.11% 91170.83 73139 181118 91206.35 80322 107171 5671848 5671848 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 13495 5.0% 98.0 4.46sec 62004 0 41459 109981 62035 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.04 97.99 0.00 0.00 0.0000 0.0000 6078970.88 6078970.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.55 69.95% 41459.22 35102 72438 41482.33 37226 47856 2841817 2841817 0.00
crit 29.43 30.04% 109980.63 88353 224589 110029.31 92865 137289 3237154 3237154 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 128 0.0% 0.3 117.95sec 208086 129396 0 0 0 0.0% 0.0% 0.0% 0.0% 0.6 22829 48051 30030 28.6% 0.0% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.28 0.28 0.61 1.94 1.6096 0.6294 58357.54 58357.54 0.00 129395.87 129395.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.28 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.4 71.44% 22829.07 20669 40729 5736.37 0 40729 31696 31696 0.00
crit 0.6 28.55% 48051.10 43064 84862 10643.96 0 84862 26662 26662 0.00
miss 0.0 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 67 0.0% 0.9 15.10sec 32858 0 22814 58247 32857 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.94 0.94 0.00 0.00 0.0000 0.0000 30771.69 30771.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.67 71.63% 22814.28 20669 40729 5312.74 0 40729 15303 15303 0.00
crit 0.27 28.36% 58246.81 52023 102515 9485.99 0 102515 15468 15468 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (67) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 26106 9.7% 62.3 6.99sec 188982 182198 139970 303572 188983 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.25 62.25 0.00 0.00 1.0372 0.0000 11764883.85 11764883.85 0.00 182197.92 182197.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.59 70.01% 139969.50 107763 358873 140067.05 120311 165379 6100672 6100672 0.00
crit 18.66 29.97% 303572.37 224533 849668 303754.02 234298 412204 5664212 5664212 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 9403 3.5% 191.1 2.33sec 22180 0 22181 0 22181 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 191.11 191.11 0.00 0.00 0.0000 0.0000 4238936.37 4238936.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 191.11 100.00% 22180.70 8570 390971 22193.19 16668 30483 4238936 4238936 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:42218.12
  • base_dd_max:42218.12
shadow_word_death 10319 3.8% 16.5 4.64sec 282668 272552 209282 451826 282670 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 1.0372 0.0000 4654914.79 4654914.79 0.00 272551.95 272551.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.48 69.72% 209282.09 171249 495364 209520.64 173824 284792 2402877 2402877 0.00
crit 4.98 30.27% 451825.82 356812 1238556 451082.73 0 1238556 2252038 2252038 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37081 (56445) 13.8% (21.1%) 78.1 5.74sec 325818 314313 0 0 0 0.0% 0.0% 0.0% 0.0% 413.5 30060 65055 40453 29.7% 0.0% 135.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.15 78.15 413.50 413.50 1.0366 1.4777 16727317.55 16727317.55 0.00 36792.41 314313.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.14 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 290.7 70.30% 30060.14 25710 53042 30067.67 28019 33443 8738345 8738345 0.00
crit 122.8 29.70% 65055.17 53569 132622 65055.34 59265 73882 7988973 7988973 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19364 7.2% 196.1 2.28sec 44539 0 30098 78948 44576 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.10 195.94 0.00 0.00 0.0000 0.0000 8733951.33 8733951.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.82 70.34% 30097.62 25710 53042 30104.25 28048 33003 4147996 4147996 0.00
crit 58.09 29.65% 78947.96 64713 164453 78962.84 70513 91780 4585955 4585955 0.00
miss 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0487 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6630 2.5% 180.9 2.46sec 16522 0 15072 32743 20376 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 180.89 146.68 0.00 0.00 0.0000 0.0000 2988722.15 2988722.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.61 69.96% 15071.78 13192 24079 15074.84 13899 16619 1546556 1546556 0.00
crit 44.05 30.03% 32742.50 27487 60206 32746.15 28638 38974 1442166 1442166 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1859 0.7% 26.4 12.07sec 31229 0 21246 52039 31230 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.37 26.37 0.00 0.00 0.0000 0.0000 823665.04 823665.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.82 67.55% 21245.98 16220 32221 21338.83 17061 30411 378541 378541 0.00
crit 8.55 32.43% 52039.27 33796 74024 51642.42 0 74024 445124 445124 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16219.80
  • base_dd_max:16219.80
vampiric_touch 25091 (38209) 9.4% (14.2%) 51.5 8.65sec 334193 320597 0 0 0 0.0% 0.0% 0.0% 0.0% 251.9 33250 72176 44889 29.9% 0.0% 100.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.52 51.52 251.90 251.90 1.0424 1.7978 11307628.95 11307628.95 0.00 33988.04 320597.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.52 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.6 70.10% 33250.06 28140 58980 33259.53 29981 37355 5871486 5871486 0.00
crit 75.3 29.90% 72176.27 58633 147468 72180.10 64510 83271 5436143 5436143 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 13118 4.9% 119.6 3.69sec 49435 0 33308 87475 49474 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.56 119.46 0.00 0.00 0.0000 0.0000 5910371.63 5910371.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.78 70.13% 33307.72 28140 58980 33317.17 30895 37155 2790547 2790547 0.00
crit 35.67 29.85% 87474.66 70830 182863 87510.94 75647 106001 3119824 3119824 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 102239 / 8111
melee 101889 3.0% 36.4 10.74sec 99106 112299 73026 171983 99106 30.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.37 36.37 0.00 0.00 0.8825 0.0000 3604915.83 3604915.83 0.00 112299.18 112299.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.50 45.37% 73026.50 56165 115903 73201.21 61696 100778 1205108 1205108 0.00
crit 11.13 30.60% 171982.54 127276 278167 171478.67 0 260025 1914523 1914523 0.00
glance 8.73 24.01% 55565.43 42124 86927 55615.65 0 86927 485285 485285 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0426 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 350 0.0% 8.0 0.73sec 1536 0 1023 2532 1536 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12282.07 12282.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.28 66.00% 1022.86 852 1366 1032.74 0 1366 5400 5400 0.00
crit 2.72 33.98% 2531.95 2045 3278 2389.74 0 3278 6882 6882 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.9 0.0 32.1sec 32.1sec 9.57% 11.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:9.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.6 0.0 136.2sec 136.2sec 15.88% 15.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.88%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.62% 41.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.62%

    Trigger Attempt Success

    • trigger_pct:99.47%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.3 0.0 9.7sec 9.7sec 15.55% 49.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.55%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 45.2 29.0 9.7sec 5.9sec 37.29% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:27.01%
  • surge_of_darkness_2:10.28%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.8 2.4 47.1sec 37.1sec 24.45% 54.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.45%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 57.2sec 57.2sec 17.08% 17.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.08%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 311.9 0.0sec 0.5sec 32.75% 32.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.38% 78.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.98% 73.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.42% 16.42%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 13.9 41.7 3.0 3.0 303519.7
halo Mana 11.0 446366.7 40500.0 40499.5 6.3
mind_blast Mana 35.7 321501.6 9000.0 8999.9 23.8
mind_flay Mana 98.8 296325.2 3000.0 3000.0 59.9
mind_sear Mana 0.3 2524.7 9000.0 9002.3 23.1
shadow_word_death Mana 16.5 128453.2 7800.0 7800.3 36.2
shadow_word_pain Mana 78.1 1031508.7 13200.0 13199.8 24.7
vampiric_touch Mana 51.5 463686.1 9000.0 8999.9 37.1
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.03 461.52 (0.02%) 18000.00 0.00 0.00%
shadowfiend Mana 36.37 279757.78 (11.05%) 7692.34 47557.46 14.53%
Shadow Orbs from Mind Blast Shadow Orb 35.72 34.77 (80.74%) 0.97 0.94 2.64%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.30 8.30 (19.26%) 1.00 0.00 0.00%
Devouring Plague Health Health 193.96 0.00 (0.00%) 0.00 4129069.16 100.00%
Vampiric Touch Mana Mana 371.37 1739324.06 (68.73%) 4683.56 130492.90 6.98%
halo_heal Health 11.02 0.00 (0.00%) 0.00 3636708.42 100.00%
external_healing Health 84.92 0.00 (0.00%) 0.00 26939580.06 100.00%
mp5_regen Mana 1803.88 511091.53 (20.20%) 283.33 30073.87 5.56%
pet - shadowfiend
external_healing Health 16.31 0.00 (0.00%) 0.00 5251730.13 100.00%
Resource RPS-Gain RPS-Loss
Mana 5609.98 5964.08
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 139124.62 600.00 297300.00
Shadow Orb 1.38 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.7%
shadowfiend-Mana Cap 5.7%
mindbender-Mana Cap 5.7%

Procs

Count Interval
Shadowy Recall Extra Tick 476.7 0.9sec
Shadowy Apparition Procced 180.9 2.5sec
FDCL Mind Spike proc 74.2 5.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 268330.19
Minimum 237904.26
Maximum 306654.38
Spread ( max - min ) 68750.11
Range [ ( max - min ) / 2 * 100% ] 12.81%
Standard Deviation 8280.6477
5th Percentile 255228.91
95th Percentile 282380.42
( 95th Percentile - 5th Percentile ) 27151.52
Mean Distribution
Standard Deviation 52.3798
95.00% Confidence Intervall ( 268227.53 - 268432.85 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3658
0.1 Scale Factor Error with Delta=300 585345
0.05 Scale Factor Error with Delta=300 2341382
0.01 Scale Factor Error with Delta=300 58534550
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 268330.19
Minimum 237904.26
Maximum 306654.38
Spread ( max - min ) 68750.11
Range [ ( max - min ) / 2 * 100% ] 12.81%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 117306618.29
Minimum 86230040.04
Maximum 153633590.40
Spread ( max - min ) 67403550.36
Range [ ( max - min ) / 2 * 100% ] 28.73%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 8.17 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.53 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 45.13 mind_blast,if=active_enemies<=5&cooldown_react
F 8.30 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 36.05 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 35.72 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 13.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 18.33 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.38 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 13.61 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 11.02 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 2.06 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 6.26 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 48.65 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.28 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 52.09 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 28.77 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

AIPZEJWEWULWEIUWUZZUZZEJNWUWPTEIIIJJJJEIOUWZZZEWLWTEWUUUWKEJNPUWIIIUEJJJLOKUWEUWLENWKWIZZEJPWUEIIIJJJLKEOOUWZZZZUELNUWTEWPWKLEUWUWAIIEIJJJIJOWENWOUTEULKWPZZZZEWUWLUTEIIIJJJKUENWLUIZZEJWPWEUUWLKEUWIIIZZEJJJJNOUOEUWUWKLEPUWUWZZZEWLUWEIIIJJJKELNOUUWZZZZPEWLUWEWKUUTELNWUIAIEIIJJUWEFCPWKWEDFCJUZZZZZEFCNWLWEFCIIIJJEIFCNLP8OUZEFCWUWEFCJNWUKEWFCWUIIIO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 278779 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
278779.3 278779.3 111.88 / 0.04% 14817 / 5.3% 43.5 5910.6 5724.3 Mana 0.51% 42.9 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.93 5.17 6.43 4.44 4.93 4.35
Normalized 1.00 0.75 0.93 0.64 0.71 0.63
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.16 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste > Crit ~= Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=6.93, SpellDamage=5.17, HitRating=6.43, CritRating=4.44, HasteRating=4.93, MasteryRating=4.35 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=6.93, SpellDamage=5.17, HitRating=0.00, CritRating=4.44, HasteRating=4.93, MasteryRating=4.35 )

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:826665|315059|297915|250620|243259|215326|122530|76549&chds=0,1653330&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++826665++devouring_plague,9482C9,0,0,15|t++315059++vampiric_touch,9482C9,1,0,15|t++297915++shadow_word_pain,9482C9,2,0,15|t++250620++shadow_word_death,9482C9,3,0,15|t++243259++halo,9482C9,4,0,15|t++215326++mind_blast,9482C9,5,0,15|t++122530++mind_flay,9482C9,6,0,15|t++76549++mind_sear,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,12,11,9,8,8,7,7,6,5,4,4,4,4,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,C79C6E,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_flay|mind_blast|vampiric_touch|mindbender: melee|essence_of_yulon|shadow_word_pain_mastery|devouring_plague_tick|mind_flay_mastery|vampiric_touch_mastery|devouring_plague|shadow_word_death|devouring_plague_mastery|multistrike_spell|shadowy_apparition|halo_damage|stormlash|mind_sear|mind_sear_mastery|mindbender: stormlash&
http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.93,6.43,5.17,4.93,4.44,4.35|6.78,6.27,5.02,4.77,4.29,4.20|7.09,6.59,5.33,5.08,4.60,4.51&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.93++Int,FFFFFF,0,0,15,0.1,e|t++++6.43++Hit,FFFFFF,0,1,15,0.1,e|t++++5.17++SP,FFFFFF,0,2,15,0.1,e|t++++4.93++Haste,FFFFFF,0,3,15,0.1,e|t++++4.44++Crit,FFFFFF,0,4,15,0.1,e|t++++4.35++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.329& http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:afjnrtvy0346777787530xusqponnnnooppppoooopqrtttttsrqonmmmmmmmmmlkjkjjjjkkkkkjjiihggffggghiiijjjijjjjjjjjihhgfedbaZZYZZabbcddeefgggikmpqrrqqqponmlkkjjjiiihgffffffffffggggggfeeefghikkllnooppqqqrrssrqonllkjihggffffeeeeeeeeeffgikllllkjihgfefeffgggfeeffffhijjkllllkjihhhhhhiijjkklkkkkkllllkjjiihgffedddeffgghijkklmnoprsuvvuuttsrqpooonnmlkjihhhhhhhhhiiihhhgedccccdeffghijklmmnprssttttsrqpomlkjjiiihiiiiiiiijklnpqpqqqppppooooopppponnooopqssssttttsrrqqqqrrrrrrrsssssssssssrrrqqpnkjihhggggghijjjkklmpsuwxyyzzzzyxwvuuttsrqponnnnnnnmmmmnnnmnmlllkllllmmnopppppqqqsqomkifdbYW&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6257,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=278779|max=445514&chxp=1,1,63,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,4,8,11,27,33,62,87,177,254,374,474,696,805,981,1208,1346,1503,1590,1645,1694,1556,1589,1473,1279,1171,986,862,689,588,452,389,270,202,129,104,83,60,36,39,24,11,6,6,2,1,0,1,3&chds=0,1694&chbh=5&chxt=x&chxl=0:|min=245924|avg=278779|max=320708&chxp=0,1,44,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:39.1,18.1,13.0,11.2,4.6,3.7,2.5,1.8,0.5,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 176.2s|shadow_word_pain 81.5s|mind_blast 58.5s|vampiric_touch 50.7s|devouring_plague 20.7s|shadow_word_death 16.8s|halo 11.4s|mindbender 8.2s|mind_sear 2.5s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 278779
devouring_plague 11045 (37856) 4.0% (13.6%) 19.9 22.15sec 857297 826665 185890 402136 250101 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.92 19.92 0.00 0.00 1.0371 0.0000 4980662.63 4980662.63 0.00 826664.79 826664.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.00 70.28% 185890.11 165521 297038 185919.82 165521 221047 2601897 2601897 0.00
crit 5.92 29.70% 402135.76 344876 742683 402069.51 0 618903 2378766 2378766 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9257 3.3% 89.7 4.73sec 46535 0 31368 82060 46597 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.72 89.60 0.00 0.00 0.0000 0.0000 4175315.27 4175315.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.67 69.94% 31368.38 27587 49507 31384.39 28316 36724 1965725 1965725 0.00
crit 26.93 30.05% 82060.01 69438 153492 82064.11 70033 104086 2209590 2209590 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17554 6.3% 19.9 22.15sec 397545 0 0 0 0 0.0% 0.0% 0.0% 0.0% 189.3 31096 67105 41828 29.8% 0.0% 25.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.92 19.92 189.28 189.28 0.0000 0.6075 7917130.09 7917130.09 0.00 68858.38 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.9 70.20% 31096.36 27587 126871 31111.51 28270 54354 4131607 4131607 0.00
crit 56.4 29.80% 67105.17 57481 264345 67084.48 58583 131575 3785523 3785523 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20596 7.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 172.3 24413 53161 32966 29.8% 0.0% 30.3%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.76 172.25 281.78 0.0000 0.7924 9289463.35 9289463.35 0.00 68058.67 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.9 70.23% 24413.33 21627 39475 24425.22 22456 27709 4831415 4831415 0.00
crit 83.9 29.76% 53161.35 45062 98700 53157.14 47123 63781 4458048 4458048 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6164) 0.0% (2.2%) 11.0 42.43sec 252221 243259 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.03 0.00 0.00 1.0369 0.0000 0.00 0.00 0.00 243259.14 243259.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.75 70.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.28 29.71% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6164 2.2% 11.0 42.43sec 252221 0 172953 372470 232157 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.99 0.00 0.00 0.0000 0.0000 2782641.29 2782641.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.43 70.30% 172953.32 157064 265830 173024.31 157064 215956 1457436 1457436 0.00
crit 3.56 29.68% 372470.39 327255 664654 365238.52 0 664654 1325205 1325205 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27919 10.0% 54.5 8.26sec 231100 215326 172179 371883 231098 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.47 54.47 0.00 0.00 1.0733 0.0000 12588393.65 12588393.65 0.00 215326.09 215326.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.38 70.47% 172178.99 132475 382319 172157.38 148665 200329 6609125 6609125 0.00
crit 16.08 29.52% 371882.51 276022 955911 371965.29 282800 515148 5979268 5979268 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 31549 (47950) 11.3% (17.2%) 125.3 3.52sec 172318 122530 0 0 0 0.0% 0.0% 0.0% 0.0% 262.6 39867 87230 54083 30.0% 0.0% 34.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.27 125.27 262.61 262.61 1.4063 0.5925 14203067.24 14203067.24 0.00 122529.77 122529.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.25 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 183.8 69.98% 39867.16 35102 62990 39889.09 37010 44883 7327174 7327174 0.00
crit 78.8 30.02% 87230.01 73139 157494 87259.78 77734 102808 6875893 6875893 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 16401 5.9% 124.6 3.51sec 59272 0 39711 105220 59302 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.56 124.50 0.00 0.00 0.0000 0.0000 7383002.33 7383002.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.23 70.07% 39711.05 35102 62990 39732.02 36409 44616 3464177 3464177 0.00
crit 37.24 29.92% 105219.56 88353 195295 105251.85 90713 129848 3918825 3918825 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 415 0.1% 1.2 113.13sec 155780 76549 0 0 0 0.0% 0.0% 0.0% 0.0% 3.4 22422 47620 29727 29.0% 0.0% 0.5%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.21 1.21 3.45 6.32 2.0357 0.6250 188005.41 188005.41 0.00 76549.44 76549.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.5 71.00% 22421.61 20669 37401 15927.68 0 37401 100675 100675 0.00
crit 1.8 29.00% 47620.36 43064 77928 29214.76 0 77928 87330 87330 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 215 0.1% 3.0 33.96sec 32610 0 22417 57431 32611 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 97495.28 97495.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.12 70.87% 22416.93 20669 37401 14344.38 0 37401 47499 47499 0.00
crit 0.87 29.12% 57430.56 52023 89144 26894.71 0 89144 49997 49997 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (215) 0.0% (0.1%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.91 7.91 0.00 0.00 1.0411 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 9043 3.2% 202.6 2.20sec 20127 0 20127 0 20127 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 202.55 202.55 0.00 0.00 0.0000 0.0000 4076794.78 4076794.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 202.55 100.00% 20127.38 8570 339975 20136.44 15090 27057 4076795 4076795 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:25710.19
  • base_dd_max:25710.19
shadow_word_death 9358 3.4% 16.2 4.68sec 259922 250620 192689 415370 259915 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.24 16.24 0.00 0.00 1.0371 0.0000 4221190.65 4221190.65 0.00 250619.88 250619.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.33 69.79% 192689.31 148912 430751 192946.83 152458 273790 2183942 2183942 0.00
crit 4.90 30.20% 415369.56 310271 1077005 414489.74 0 1019924 2037248 2037248 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 35329 (53825) 12.7% (19.3%) 78.6 5.70sec 308808 297915 0 0 0 0.0% 0.0% 0.0% 0.0% 413.1 28696 62074 38583 29.6% 0.0% 135.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.63 78.63 413.10 413.10 1.0366 1.4767 15938879.35 15938879.35 0.00 35113.15 297914.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.62 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 290.7 70.38% 28696.16 25710 46124 28706.49 26714 31443 8343104 8343104 0.00
crit 122.4 29.62% 62074.04 53569 115323 62081.87 56727 70819 7595775 7595775 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18496 6.6% 196.0 2.28sec 42569 0 28779 75449 42604 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.00 195.83 0.00 0.00 0.0000 0.0000 8343269.27 8343269.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.78 70.35% 28778.53 25710 46124 28787.62 26949 31827 3965028 3965028 0.00
crit 58.03 29.63% 75448.57 64713 143003 75463.35 67987 86591 4378241 4378241 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 6577 2.4% 180.4 2.47sec 16441 0 15030 32646 20310 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 180.39 146.03 0.00 0.00 0.0000 0.0000 2965866.82 2965866.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.23 70.00% 15030.01 13192 24079 15033.19 13780 16572 1536451 1536451 0.00
crit 43.78 29.98% 32646.29 27487 60206 32650.73 29122 38435 1429416 1429416 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1898 0.7% 27.9 11.42sec 30231 0 20474 50634 30231 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.88 27.88 0.00 0.00 0.0000 0.0000 842764.77 842764.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.85 67.62% 20473.87 16220 29606 20568.03 17061 28992 385970 385970 0.00
crit 9.02 32.36% 50634.40 33796 74024 50173.49 33796 74024 456795 456795 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:21791.88
  • base_dd_max:21791.88
vampiric_touch 23336 (35457) 8.4% (12.7%) 48.5 9.19sec 329545 315059 0 0 0 0.0% 0.0% 0.0% 0.0% 244.3 31890 69261 43061 29.9% 0.0% 97.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.50 48.50 244.25 244.25 1.0460 1.7991 10517709.77 10517709.77 0.00 32605.47 315059.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.49 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.2 70.11% 31890.02 28140 51287 31905.08 29481 35437 5460820 5460820 0.00
crit 73.0 29.89% 69261.27 58633 128233 69275.53 61720 79512 5056890 5056890 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12122 4.3% 115.9 3.80sec 47130 0 31784 83480 47167 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.93 115.83 0.00 0.00 0.0000 0.0000 5463663.57 5463663.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.34 70.22% 31784.29 28140 51287 31796.01 29522 35483 2585243 2585243 0.00
crit 34.48 29.77% 83480.06 70830 159011 83508.77 73598 106935 2878420 2878420 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 83097 / 21506
melee 82860 7.7% 118.5 3.69sec 81445 88282 63025 136671 81445 30.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.53 118.53 0.00 0.00 0.9226 0.0000 9653341.16 9653341.16 0.00 88281.72 88281.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.51 45.99% 63024.76 49425 101994 63083.32 56063 78974 3435714 3435714 0.00
crit 35.53 29.97% 136670.98 98850 244786 136651.31 114964 175136 4855311 4855311 0.00
glance 28.47 24.02% 47854.07 37069 76496 47873.33 41638 60518 1362316 1362316 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 1.0380 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 237 0.0% 20.3 12.56sec 1343 0 937 2204 1343 32.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.27 20.27 0.00 0.00 0.0000 0.0000 27220.68 27220.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.76 67.91% 936.74 749 1366 948.50 775 1366 12891 12891 0.00
crit 6.50 32.08% 2203.65 1498 3278 2204.87 0 3278 14329 14329 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1005.78
  • base_dd_max:1005.78

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.5 3.0 15.7sec 14.1sec 8.75% 46.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.75%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.9 0.0 22.1sec 22.1sec 24.54% 26.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.4 0.0 142.9sec 142.9sec 15.01% 15.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.01%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.7 36.6sec 23.4sec 41.65% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.65%

    Trigger Attempt Success

    • trigger_pct:99.43%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.2 0.0 9.8sec 9.8sec 15.36% 49.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.36%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.22%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.8 2.4 47.2sec 37.2sec 24.39% 54.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.39%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.6 0.0 58.7sec 58.6sec 16.64% 16.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.64%

    Trigger Attempt Success

    • trigger_pct:99.88%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.38% 85.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.5 0.0 180.0sec 180.0sec 20.28% 30.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.8 0.0 300.0sec 300.0sec 14.43% 14.43%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:14.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 19.9 59.7 3.0 3.0 285793.5
halo Mana 11.0 446817.1 40500.0 40499.8 6.2
mind_blast Mana 54.5 231679.1 4253.2 4253.2 54.3
mind_flay Mana 125.3 375808.0 3000.0 3000.0 57.4
mind_sear Mana 1.2 10860.8 9000.0 8999.2 17.3
shadow_word_death Mana 16.2 126678.9 7800.0 7800.3 33.3
shadow_word_pain Mana 78.6 1037927.1 13200.0 13199.8 23.4
vampiric_touch Mana 48.5 436453.9 9000.0 8999.9 36.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 118.51 500920.94 (19.40%) 4226.90 119834.62 19.30%
Shadow Orbs from Mind Blast Shadow Orb 54.46 53.00 (86.63%) 0.97 1.47 2.69%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.18 8.18 (13.37%) 1.00 0.00 0.00%
Devouring Plague Health Health 278.88 0.00 (0.00%) 0.00 5936955.81 100.00%
Vampiric Touch Mana Mana 360.08 1593841.57 (61.72%) 4426.30 219160.79 12.09%
halo_heal Health 11.03 0.00 (0.00%) 0.00 3477648.10 100.00%
external_healing Health 84.91 0.00 (0.00%) 0.00 27089417.15 100.00%
mp5_regen Mana 1803.88 487422.57 (18.88%) 270.21 53742.84 9.93%
pet - mindbender
external_healing Health 30.52 0.00 (0.00%) 0.00 9700211.45 100.00%
Resource RPS-Gain RPS-Loss
Mana 5724.26 5910.56
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 214893.82 36247.62 300000.00
Shadow Orb 1.47 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.0%
shadowfiend-Mana Cap 10.0%
mindbender-Mana Cap 10.0%

Procs

Count Interval
Shadowy Recall Extra Tick 528.8 0.8sec
Shadowy Apparition Procced 180.4 2.5sec
Divine Insight Mind Blast CD Reset 51.1 14.1sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 278779.27
Minimum 245924.19
Maximum 320708.13
Spread ( max - min ) 74783.93
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 9024.3720
5th Percentile 264561.08
95th Percentile 294195.30
( 95th Percentile - 5th Percentile ) 29634.22
Mean Distribution
Standard Deviation 57.0843
95.00% Confidence Intervall ( 278667.39 - 278891.16 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4025
0.1 Scale Factor Error with Delta=300 695212
0.05 Scale Factor Error with Delta=300 2780850
0.01 Scale Factor Error with Delta=300 69521261
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 278779.27
Minimum 245924.19
Maximum 320708.13
Spread ( max - min ) 74783.93
Range [ ( max - min ) / 2 * 100% ] 13.41%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 115975315.52
Minimum 84102263.50
Maximum 153095220.70
Spread ( max - min ) 68992957.20
Range [ ( max - min ) / 2 * 100% ] 29.74%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.91 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 8.06 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 4.37 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 58.27 mind_blast,if=active_enemies<=5&cooldown_react
F 8.18 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 37.79 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 33.80 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 11.26 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 17.34 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.55 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 11.03 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.88 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 17.64 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 1.21 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 58.60 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 29.58 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9IPZEJWEWLWEKWENTTTTZEZZZLWTEWPIIEIDEJJJIWEW9ZZWLENWWEWKWLPWTEWIIIZZEJJJLNWEWEILWTTEI9ZJPTTTTTTTENWEIIIJEJJJIENWZEZZZWLWEWWPWENWKJWEWI9IIEJJJJKWEWTENLWPWKZZZZEWLWEIIIJJJEKVLWTEIZ9JWENPWWTTTEWLKWEWEIIIJDEJJEIWWENWLPWEWKEZZ9WLWENWEIIIJJJKELWENZZZPZWEWLWWEWKWEJNWIII9EIJJEWPFCNEKWLSFCTENWZZZZFCEWLWFCEIIIJJDFCEIJPW8ZEDF9CWTELWFCNWKEWSFCLWIEDE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 274864 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
274864.4 274864.4 111.22 / 0.04% 14698 / 5.3% 41.3 6133.0 5946.3 Mana 0.21% 39.1 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.84 5.20 7.66 4.52 7.81 4.16
Normalized 1.00 0.76 1.12 0.66 1.14 0.61
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.16 0.16 0.15 0.16
Gear Ranking
Optimizers
Ranking
  • Haste ~= Hit > Int > SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=6.84, SpellDamage=5.20, HitRating=7.66, CritRating=4.52, HasteRating=7.81, MasteryRating=4.16 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=6.84, SpellDamage=5.20, HitRating=0.00, CritRating=4.52, HasteRating=7.81, MasteryRating=4.16 )

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:845893|327487|326091|294062|250958|190924|134950|94694&chds=0,1691785&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++845893++devouring_plague,9482C9,0,0,15|t++327487++halo,9482C9,1,0,15|t++326091++vampiric_touch,9482C9,2,0,15|t++294062++shadow_word_pain,9482C9,3,0,15|t++250958++shadow_word_death,9482C9,4,0,15|t++190924++mind_blast,9482C9,5,0,15|t++134950++mind_flay,9482C9,6,0,15|t++94694++mind_sear,9482C9,7,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,15,10,8,8,8,7,7,5,5,4,3,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_flay|vampiric_touch|mindbender: melee|shadow_word_pain_mastery|mind_flay_mastery|essence_of_yulon|mind_blast|vampiric_touch_mastery|devouring_plague_tick|shadow_word_death|multistrike_spell|halo_damage|devouring_plague|devouring_plague_mastery|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|mindbender: stormlash&
http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.81,7.66,6.84,5.20,4.52,4.16|7.66,7.50,6.68,5.04,4.37,4.01|7.97,7.82,6.99,5.36,4.68,4.32&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.81++Haste,FFFFFF,0,0,15,0.1,e|t++++7.66++Hit,FFFFFF,0,1,15,0.1,e|t++++6.84++Int,FFFFFF,0,2,15,0.1,e|t++++5.20++SP,FFFFFF,0,3,15,0.1,e|t++++4.52++Crit,FFFFFF,0,4,15,0.1,e|t++++4.16++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.384& http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Zeimqswy0345657687530xurnmlkjiijijihgfdcbbcdhhhhhgfedcccddefghhhddeeddeefeeedcbbZYXWWWWXXYYZZababbbbcccbbbaaZZXWVTTTTTUVWXYaabbbbbcefhlmmllkjigfededdeeedcYXXXWWWWWWXYXYYYXWWVVWYZZbbcdeffghhhhiijjjhgfeedbaZYYXXXXXXXXWXWWWWXYadeddddcbaZZYYZZacddcbabccdegghhjjjjihfeeeeeeddddddecdccccccbabZZZZYYXXWWWWXXYZabcccdddefgiklmlllkkjhggggfffeedbaaaaZZaaaabaaaaZYXWWWXXYaabcefghiijkmnoopoonmlkjhgeeeddcccccbbbbbccdeghhhhhggggffgffgggggfeffgghiiijkjjjjiihhiijjjkjjjjjjjjjkkkkjjjihhgedcbbbaaaaabcdeefghhkmoqsttuuuutsrqooommlkjigfgfffffeefffffffeedddeeefffghgggggghihfedaYWUTR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5132,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=274864|max=535590&chxp=1,1,51,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,4,8,9,25,45,55,94,168,236,359,465,605,774,910,1129,1254,1430,1495,1582,1639,1528,1514,1511,1339,1194,1066,903,750,664,500,453,330,270,179,133,125,65,58,38,29,15,15,6,9,8,0,0,1,1&chds=0,1639&chbh=5&chxt=x&chxl=0:|min=244152|avg=274864|max=315884&chxp=0,1,43,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:41.9,19.4,11.9,9.6,3.8,3.3,2.4,1.8,0.4,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 189.1s|shadow_word_pain 87.6s|vampiric_touch 53.5s|mind_blast 43.3s|shadow_word_death 17.0s|devouring_plague 14.9s|halo 11.0s|mindbender 8.2s|mind_sear 1.8s|waiting 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 274864
devouring_plague 7978 (27941) 2.9% (10.2%) 14.4 31.21sec 876879 845893 186199 403097 250341 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.37 14.37 0.00 0.00 1.0367 0.0000 3596585.78 3596585.78 0.00 845892.59 845892.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.11 70.40% 186199.34 165521 311890 186269.52 165521 237798 1883356 1883356 0.00
crit 4.25 29.58% 403096.68 344876 779817 400341.50 0 721991 1713230 1713230 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6943 2.5% 66.7 6.38sec 46969 0 31662 82916 47051 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.66 66.54 0.00 0.00 0.0000 0.0000 3130865.05 3130865.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.55 69.95% 31662.05 27587 51982 31682.23 27889 37021 1473805 1473805 0.00
crit 19.99 30.03% 82915.72 69438 161167 82887.77 69823 111796 1657061 1657061 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13021 4.7% 14.4 31.21sec 408613 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.4 31118 67155 41802 29.6% 0.0% 18.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.37 14.37 140.43 140.43 0.0000 0.5912 5870427.51 5870427.51 0.00 70712.71 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.8 70.35% 31117.58 27587 112001 31137.78 28036 58300 3074387 3074387 0.00
crit 41.6 29.65% 67154.85 57481 233362 67139.82 58351 123287 2796041 2796041 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18596 6.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 164.6 24586 53923 33295 29.7% 0.0% 29.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 33.80 164.64 252.07 0.0000 0.7947 8392892.84 8392892.84 0.00 64144.27 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.2 70.29% 24585.97 21627 41449 24595.30 22676 27726 4356489 4356489 0.00
crit 74.9 29.70% 53922.71 45062 103635 53926.57 48011 66720 4036404 4036404 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8003) 0.0% (2.9%) 10.6 44.09sec 339540 327487 0 0 0 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.65 10.65 0.00 0.00 1.0369 0.0000 0.00 0.00 0.00 327486.72 327486.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.50 70.45% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.15 29.54% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8003 2.9% 10.6 44.09sec 339540 0 171392 369507 229251 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.65 15.77 0.00 0.00 0.0000 0.0000 3615453.36 3615453.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.16 70.78% 171392.46 157064 279122 172183.33 157064 211447 1913109 1913109 0.00
crit 4.61 29.21% 369507.18 327255 697887 366917.13 0 650063 1702344 1702344 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18345 6.7% 37.0 12.18sec 223331 190924 166850 360405 223330 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.03 37.03 0.00 0.00 1.1697 0.0000 8269110.54 8269110.54 0.00 190924.03 190924.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.21 70.79% 166850.19 132475 401435 166790.86 136629 198358 4373575 4373575 0.00
crit 10.81 29.19% 360405.28 276022 1003706 360416.42 276022 589386 3895536 3895536 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 37282 (56702) 13.5% (20.6%) 133.6 3.30sec 191062 134950 0 0 0 0.0% 0.0% 0.0% 0.0% 305.0 40470 88866 55014 30.1% 0.0% 38.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.57 133.57 305.02 305.02 1.4158 0.5660 16780563.06 16780563.06 0.00 134949.60 134949.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 133.55 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 213.4 69.95% 40470.07 35102 66140 40493.81 37658 44855 8634670 8634670 0.00
crit 91.7 30.05% 88865.90 73139 165368 88902.05 79904 105071 8145893 8145893 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 19420 7.1% 144.7 3.03sec 60394 0 40336 107417 60424 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.72 144.64 0.00 0.00 0.0000 0.0000 8739891.14 8739891.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.29 70.03% 40336.41 35102 66140 40360.07 37121 45693 4085833 4085833 0.00
crit 43.33 29.95% 107416.78 88353 205060 107459.09 92624 138668 4654059 4654059 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 389 0.1% 0.9 127.38sec 188947 94694 0 0 0 0.0% 0.0% 0.0% 0.0% 2.6 22103 46732 29198 28.8% 0.0% 0.4%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.93 0.93 2.58 6.00 1.9956 0.6263 175089.12 175089.12 0.00 94693.95 94693.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.93 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.3 71.18% 22103.12 20669 35417 12661.73 0 35417 94344 94344 0.00
crit 1.7 28.81% 46732.44 43064 73793 24525.21 0 73793 80745 80745 0.00
miss 0.0 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 202 0.1% 2.9 35.44sec 31849 0 22102 56444 31851 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.86 2.86 0.00 0.00 0.0000 0.0000 91036.56 91036.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.05 71.58% 22102.43 20669 35417 11969.69 0 35417 45224 45224 0.00
crit 0.81 28.40% 56444.36 52023 89144 23382.58 0 89144 45813 45813 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (202) 0.0% (0.1%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.90 7.90 0.00 0.00 1.0411 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 8753 3.2% 205.7 2.17sec 19178 0 19178 0 19178 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.72 205.72 0.00 0.00 0.0000 0.0000 3945320.72 3945320.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 205.72 100.00% 19178.35 8570 376952 19185.98 14554 26103 3945321 3945321 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:27587.42
  • base_dd_max:27587.42
power_infusion 0 0.0% 4.3 120.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 4.28 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9448 3.4% 16.4 4.66sec 260280 250958 192826 416761 260282 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.37 16.37 0.00 0.00 1.0372 0.0000 4260773.41 4260773.41 0.00 250958.50 250958.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.44 69.86% 192825.95 148912 452288 193112.48 152441 291877 2205062 2205062 0.00
crit 4.93 30.13% 416760.80 310271 1130856 415967.23 0 1070921 2055711 2055711 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37505 (57085) 13.7% (20.8%) 84.5 5.30sec 304800 294062 0 0 0 0.0% 0.0% 0.0% 0.0% 436.8 28826 62391 38729 29.5% 0.0% 137.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.48 84.48 436.84 436.84 1.0365 1.4152 16918169.94 16918169.94 0.00 36484.93 294062.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.47 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 308.0 70.50% 28825.93 25710 48430 28834.84 26990 31575 8877124 8877124 0.00
crit 128.9 29.50% 62391.32 53569 121089 62398.78 56973 70944 8041046 8041046 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19580 7.1% 207.3 2.16sec 42608 0 28829 75668 42643 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 207.29 207.11 0.00 0.00 0.0000 0.0000 8831984.32 8831984.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 145.98 70.48% 28829.08 25710 48430 28835.23 27096 31516 4208575 4208575 0.00
crit 61.10 29.50% 75668.14 64713 150153 75685.40 67705 88624 4623409 4623409 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 6894 2.5% 190.0 2.35sec 16361 0 14939 32475 20175 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.98 154.06 0.00 0.00 0.0000 0.0000 3108221.66 3108221.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.02 70.11% 14938.61 13192 24079 14941.06 13941 16499 1613671 1613671 0.00
crit 46.02 29.87% 32475.22 27487 60206 32475.38 28853 39286 1494551 1494551 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2382 0.9% 33.4 9.47sec 31632 0 21330 53186 31631 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.44 33.44 0.00 0.00 0.0000 0.0000 1057774.30 1057774.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.62 67.64% 21329.70 16220 31086 21428.73 17538 30102 482441 482441 0.00
crit 10.82 32.35% 53185.71 33796 77725 52654.78 33796 77725 575334 575334 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16874.28
  • base_dd_max:16874.28
vampiric_touch 25556 (38721) 9.3% (14.1%) 51.3 8.69sec 339971 326091 0 0 0 0.0% 0.0% 0.0% 0.0% 264.7 32235 70106 43511 29.8% 0.0% 100.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.34 51.34 264.73 264.73 1.0426 1.7093 11518690.99 11518690.99 0.00 34490.41 326090.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.33 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 185.9 70.22% 32235.35 28140 53851 32246.82 29640 36598 5992649 5992649 0.00
crit 78.8 29.78% 70105.69 58633 134645 70109.65 62659 83253 5526042 5526042 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 13165 4.8% 125.6 3.52sec 47247 0 31879 83837 47283 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.60 125.50 0.00 0.00 0.0000 0.0000 5934008.56 5934008.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.27 70.33% 31879.41 28140 53851 31887.10 29419 35687 2813860 2813860 0.00
crit 37.22 29.65% 83836.78 70830 166962 83864.37 74188 100638 3120149 3120149 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 82804 / 21404
melee 82595 7.8% 118.4 3.70sec 81179 87997 63002 135882 81177 30.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.38 118.38 0.00 0.00 0.9225 0.0000 9610316.26 9610316.26 0.00 87996.89 87996.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.49 46.03% 63002.09 49425 101994 63067.75 56390 77317 3432939 3432939 0.00
crit 35.46 29.95% 135882.35 98850 244786 135867.17 113494 176058 4818656 4818656 0.00
glance 28.42 24.00% 47815.51 37069 76496 47835.63 41946 60035 1358721 1358721 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.36 23.36 0.00 0.00 1.0381 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 209 0.0% 17.5 9.78sec 1369 0 946 2254 1369 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.47 17.47 0.00 0.00 0.0000 0.0000 23910.55 23910.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.82 67.65% 945.98 749 1366 964.87 773 1366 11179 11179 0.00
crit 5.65 32.34% 2253.57 1498 3278 2260.68 0 3278 12731 12731 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:778.81
  • base_dd_max:778.81

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.4 0.0 31.2sec 31.2sec 25.35% 22.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.3 0.0 150.0sec 150.0sec 14.32% 14.32%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.32%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.7 36.6sec 23.4sec 41.64% 41.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.64%

    Trigger Attempt Success

    • trigger_pct:99.46%
power_infusion 4.3 0.0 120.8sec 120.8sec 18.54% 18.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.3 0.0 9.7sec 9.7sec 15.47% 49.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.47%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 9.43%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.8 2.4 47.2sec 37.2sec 24.37% 44.82%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.37%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.2 0.0 62.1sec 62.0sec 15.88% 15.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:15.88%

    Trigger Attempt Success

    • trigger_pct:99.87%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.36% 4.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.36%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 85.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.2 0.0 180.0sec 180.0sec 17.72% 28.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:17.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.5 0.0 300.0sec 300.0sec 12.06% 12.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 14.4 43.1 3.0 3.0 292318.0
halo Mana 10.6 409889.8 38494.2 38494.2 8.8
mind_blast Mana 37.0 320257.9 8649.5 8649.5 25.8
mind_flay Mana 133.6 381866.2 2858.9 2858.9 66.8
mind_sear Mana 0.9 8333.0 8992.7 8992.5 21.0
shadow_word_death Mana 16.4 123101.7 7519.6 7520.0 34.6
shadow_word_pain Mana 84.5 1080075.3 12784.8 12784.7 23.8
vampiric_touch Mana 51.3 443057.5 8630.6 8630.6 39.4
Resource Gains Type Count Total Average Overflow
mindbender Mana 118.37 498733.05 (18.59%) 4213.41 121289.81 19.56%
Shadow Orbs from Mind Blast Shadow Orb 37.02 36.21 (81.44%) 0.98 0.82 2.20%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.25 8.25 (18.56%) 1.00 0.00 0.00%
Devouring Plague Health Health 206.98 0.00 (0.00%) 0.00 4406343.27 100.00%
Vampiric Touch Mana Mana 390.23 1696986.74 (63.26%) 4348.71 267877.90 13.63%
halo_heal Health 10.65 0.00 (0.00%) 0.00 3331243.53 100.00%
external_healing Health 85.30 0.00 (0.00%) 0.00 27263925.23 100.00%
mp5_regen Mana 1803.88 486629.61 (18.14%) 269.77 54535.80 10.08%
pet - mindbender
external_healing Health 30.57 0.00 (0.00%) 0.00 9711421.35 100.00%
Resource RPS-Gain RPS-Loss
Mana 5946.30 6133.03
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 214613.18 64431.43 300000.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.1%
shadowfiend-Mana Cap 10.1%
mindbender-Mana Cap 10.1%

Procs

Count Interval
Shadowy Recall Extra Tick 546.7 0.8sec
Shadowy Apparition Procced 190.0 2.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 274864.45
Minimum 244152.19
Maximum 315883.67
Spread ( max - min ) 71731.48
Range [ ( max - min ) / 2 * 100% ] 13.05%
Standard Deviation 8971.1366
5th Percentile 260792.19
95th Percentile 290188.40
( 95th Percentile - 5th Percentile ) 29396.20
Mean Distribution
Standard Deviation 56.7475
95.00% Confidence Intervall ( 274753.22 - 274975.67 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4092
0.1 Scale Factor Error with Delta=300 687034
0.05 Scale Factor Error with Delta=300 2748138
0.01 Scale Factor Error with Delta=300 68703459
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 274864.45
Minimum 244152.19
Maximum 315883.67
Spread ( max - min ) 71731.48
Range [ ( max - min ) / 2 * 100% ] 13.05%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 114236858.86
Minimum 82522414.09
Maximum 152936519.59
Spread ( max - min ) 70414105.50
Range [ ( max - min ) / 2 * 100% ] 30.82%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.90 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 4.28 power_infusion,if=talent.power_infusion.enabled
C 8.12 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.69 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 45.15 mind_blast,if=active_enemies<=5&cooldown_react
F 8.25 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 35.61 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 37.60 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 12.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 16.26 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.68 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 10.65 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.98 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 4.92 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.93 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 49.18 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 35.90 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9BIPZEJWEWLWEINWZZZZZEJWPEIIIJJJJKEW9ZZELNWEWKLEPWIIIZEJJJLWTEWKELNWBI9ZEJPWEIIIJJJJIEVWZZZZELNWEWPWKLWEWII9EIJJJKNWEWTELWKPWZZZZENWLWEIIIJJJKVELWIBZZ9EJWPWTENWLKWEWIIIZZEJJJJWENWPWKLTEWZZZE9LWEIIIJJJKDEJWZPZZZEWLWENWKWELWIIBIEI9JJWPWTEFCNWKWLESFCWZZZZFCELNWFCEIIIJJIFCEJNP8ZFCEW9WLFCENWKSFCEWLWIFCI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 272848 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
272848.2 272848.2 105.20 / 0.04% 13901 / 5.1% 39.2 6406.8 6136.1 Mana 0.25% 39.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.93 5.26 6.95 4.43 6.63 4.33
Normalized 1.00 0.76 1.00 0.64 0.96 0.62
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.15 0.15 0.15 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Hit ~= Int > Haste > SP > Crit ~= Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=6.93, SpellDamage=5.26, HitRating=6.95, CritRating=4.43, HasteRating=6.63, MasteryRating=4.33 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=6.93, SpellDamage=5.26, HitRating=0.00, CritRating=4.43, HasteRating=6.63, MasteryRating=4.33 )

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:873113|314013|294172|286842|270911|197953|130411|108182&chds=0,1746225&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++873113++devouring_plague,9482C9,0,0,15|t++314013++vampiric_touch,9482C9,1,0,15|t++294172++shadow_word_pain,9482C9,2,0,15|t++286842++shadow_word_death,9482C9,3,0,15|t++270911++halo,9482C9,4,0,15|t++197953++mind_blast,9482C9,5,0,15|t++130411++mind_flay,9482C9,6,0,15|t++108182++mind_sear,9482C9,7,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,14,10,8,8,8,8,7,5,5,4,3,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_flay|vampiric_touch|mindbender: melee|shadow_word_pain_mastery|essence_of_yulon|mind_blast|mind_flay_mastery|devouring_plague_tick|vampiric_touch_mastery|shadow_word_death|multistrike_spell|devouring_plague|devouring_plague_mastery|halo_damage|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|mindbender: stormlash&
http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.95,6.93,6.63,5.26,4.43,4.33|6.80,6.78,6.48,5.12,4.29,4.18|7.10,7.07,6.78,5.41,4.58,4.47&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.95++Hit,FFFFFF,0,0,15,0.1,e|t++++6.93++Int,FFFFFF,0,1,15,0.1,e|t++++6.63++Haste,FFFFFF,0,2,15,0.1,e|t++++5.26++SP,FFFFFF,0,3,15,0.1,e|t++++4.43++Crit,FFFFFF,0,4,15,0.1,e|t++++4.33++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.354& http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bhlptvx0246787767631yurolkkkkklnpqqrrqqpppqruvvuusqoljjhijjlmnnnlklllllmnmmnlkkjigfeeefffghhijjiiiiiijjiiigggfdcbZYYYZaabcdeeefggfhikmprqpqponmkkjjiiijjjifddcdccdddefeffgfeddddghikkklmnnppqpqqrsssponmllkihgffeffffffeeeeeeefhkmkkkjigfeedddefghihfegghhjkllmoooonmkjiiiiiiiiijkkjkkjjklllkljjjiihggffefghhijllllmnnoqrtwyyyxxwwvutsttssssrpmmmmllllllmnmmmmkiihgghijkklmoppqrssuwxyz0zzxxwvusrppoooooooonnnnnooqsvwwwwwvvvvuuvvvvwwwvtsttuuvxxxy0yzzyxxwwxxzz000000zzz0001100z0yyxwtrpoonnmmlmmoppopqqruy01465667765432321zzxwvtttuuuuttttuttttsrrrrrsttttuvwvvuvwvvzxvtrnkhecZ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6538,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=272848|max=417344&chxp=1,1,65,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,4,10,14,16,43,100,177,272,408,552,767,931,1174,1398,1593,1755,1807,1812,1788,1771,1588,1406,1142,1063,815,666,532,368,313,210,154,110,64,60,30,33,8,15,4,7,1,2,1,1,1,1,0,1&chds=0,1812&chbh=5&chxt=x&chxl=0:|min=241777|avg=272848|max=319376&chxp=0,1,40,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:41.4,19.4,12.0,9.5,3.8,3.3,2.5,1.8,0.7,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 186.9s|shadow_word_pain 87.4s|vampiric_touch 54.2s|mind_blast 43.0s|shadow_word_death 16.9s|devouring_plague 14.8s|halo 11.5s|mindbender 8.2s|mind_sear 3.3s|waiting 1.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 272848
devouring_plague 8389 (28667) 3.1% (10.5%) 14.3 30.73sec 905096 873113 196985 426467 264817 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 0.00 0.00 1.0367 0.0000 3781015.49 3781015.49 0.00 873112.55 873112.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.06 70.43% 196985.31 165521 341594 197050.09 166806 249792 1980784 1980784 0.00
crit 4.22 29.56% 426467.33 344876 854086 424016.31 0 809236 1800231 1800231 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 7068 2.6% 64.2 6.49sec 49634 0 33488 87605 49720 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.21 64.10 0.00 0.00 0.0000 0.0000 3186898.39 3186898.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.86 69.98% 33487.86 27587 56933 33510.13 29398 40305 1502190 1502190 0.00
crit 19.23 30.00% 87605.12 69438 176516 87626.48 71657 122592 1684708 1684708 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13209 4.8% 14.3 30.73sec 417078 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.3 32788 70647 44000 29.6% 0.0% 18.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 135.34 135.34 0.0000 0.6082 5955024.99 5955024.99 0.00 72350.50 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.3 70.39% 32788.49 27587 66933 32814.03 29412 44344 3123479 3123479 0.00
crit 40.1 29.61% 70646.97 57481 142349 70647.55 60618 99404 2831546 2831546 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18909 6.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 160.1 25647 56091 34678 29.7% 0.0% 28.2%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.85 160.09 245.97 0.0000 0.7948 8529674.63 8529674.63 0.00 67035.06 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.0 70.32% 25646.73 21627 45397 25653.02 23393 29644 4436050 4436050 0.00
crit 73.0 29.67% 56091.20 45062 113505 56073.57 49420 68825 4093625 4093625 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6850) 0.0% (2.5%) 11.0 42.42sec 280898 270911 0 0 0 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 11.04 0.00 0.00 1.0369 0.0000 0.00 0.00 0.00 270911.37 270911.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.78 70.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.26 29.53% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6850 2.5% 11.0 42.42sec 280898 0 179761 387510 240891 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 12.88 0.00 0.00 0.0000 0.0000 3101935.24 3101935.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.08 70.55% 179760.73 157064 305705 180063.40 157064 238805 1633010 1633010 0.00
crit 3.79 29.44% 387509.66 327255 764352 381096.67 0 727261 1468926 1468926 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18885 6.9% 36.8 12.27sec 231401 197953 172994 373303 231401 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.76 36.76 0.00 0.00 1.1690 0.0000 8506843.14 8506843.14 0.00 197953.25 197953.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.03 70.81% 172994.35 132475 439667 172942.27 145064 207275 4503437 4503437 0.00
crit 10.72 29.17% 373303.09 276022 1099297 373334.06 0 648831 4003406 4003406 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 35603 (54132) 13.0% (19.8%) 129.4 3.41sec 188375 130411 0 0 0 0.0% 0.0% 0.0% 0.0% 287.1 41237 90013 55838 29.9% 0.0% 37.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.39 129.39 287.10 287.10 1.4445 0.5925 16030731.25 16030731.25 0.00 130411.24 130411.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.37 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 201.2 70.07% 41237.31 35102 72438 41255.14 38357 45051 8295220 8295220 0.00
crit 85.9 29.93% 90012.73 73139 181118 90033.39 80931 105155 7735511 7735511 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 18528 6.8% 136.1 3.23sec 61283 0 41128 108711 61315 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.14 136.07 0.00 0.00 0.0000 0.0000 8342868.34 8342868.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.39 70.11% 41127.63 35102 72438 41142.80 37519 45909 3923126 3923126 0.00
crit 40.66 29.88% 108710.71 88353 224589 108740.58 94381 143953 4419743 4419743 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 783 0.3% 1.7 100.27sec 208269 108182 0 0 0 0.0% 0.0% 0.0% 0.0% 4.6 22932 48560 30320 28.8% 0.0% 0.6%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.71 1.71 4.57 11.72 1.9256 0.6261 355486.88 355486.88 0.00 108182.25 108182.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.71 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.3 71.16% 22932.10 20669 40729 20228.53 0 40729 191334 191334 0.00
crit 3.4 28.83% 48560.31 43064 84862 40535.52 0 84862 164152 164152 0.00
miss 0.0 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 408 0.2% 5.6 33.27sec 33248 0 22930 58664 33249 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.56 5.56 0.00 0.00 0.0000 0.0000 184977.70 184977.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.96 71.11% 22929.99 20669 40729 19522.93 0 40729 90710 90710 0.00
crit 1.61 28.88% 58664.35 52023 102515 41052.73 0 102515 94268 94268 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (408) 0.0% (0.2%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.90 7.90 0.00 0.00 1.0411 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 8694 3.2% 196.4 2.28sec 19962 0 19962 0 19962 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.36 196.36 0.00 0.00 0.0000 0.0000 3919666.89 3919666.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 196.36 100.00% 19962.45 8570 403834 19968.07 15224 28811 3919667 3919667 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:66102.67
  • base_dd_max:66102.67
shadow_word_death 10782 4.0% 16.3 4.67sec 297484 286842 220074 475848 297487 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.34 16.34 0.00 0.00 1.0372 0.0000 4861678.59 4861678.59 0.00 286841.62 286841.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.39 69.70% 220073.97 171249 495364 220388.53 172376 314839 2507027 2507027 0.00
crit 4.95 30.28% 475847.89 356812 1238556 474836.22 0 1032130 2354652 2354652 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37399 (56996) 13.7% (20.9%) 84.3 5.31sec 304914 294172 0 0 0 0.0% 0.0% 0.0% 0.0% 421.3 29835 64494 40058 29.5% 0.0% 136.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.34 84.34 421.26 421.26 1.0365 1.4585 16874732.36 16874732.36 0.00 36641.86 294171.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.33 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 297.0 70.50% 29834.55 25710 53042 29842.20 27755 32767 8860993 8860993 0.00
crit 124.3 29.50% 64494.06 53569 132622 64494.16 58624 75044 8013739 8013739 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19597 7.2% 200.0 2.24sec 44196 0 29926 78376 44233 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.04 199.88 0.00 0.00 0.0000 0.0000 8841187.98 8841187.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.81 70.45% 29925.91 25710 53042 29932.67 27737 32711 4213886 4213886 0.00
crit 59.04 29.54% 78376.18 64713 164453 78394.06 70901 92679 4627302 4627302 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 6630 2.4% 183.3 2.44sec 16311 0 14924 32389 20129 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.30 148.53 0.00 0.00 0.0000 0.0000 2989767.49 2989767.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.22 70.17% 14924.24 13192 24079 14927.40 13849 16606 1555447 1555447 0.00
crit 44.28 29.82% 32388.60 27487 60206 32389.04 28825 37761 1434321 1434321 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1967 0.7% 28.4 11.19sec 30655 0 20925 51266 30656 32.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.44 28.44 0.00 0.00 0.0000 0.0000 871852.53 871852.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.31 67.90% 20925.11 16220 32221 21018.60 17201 30363 404109 404109 0.00
crit 9.12 32.08% 51266.42 33796 74024 50765.59 0 74024 467744 467744 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16874.28
  • base_dd_max:16874.28
vampiric_touch 24856 (37734) 9.1% (13.8%) 52.0 8.57sec 327283 314013 0 0 0 0.0% 0.0% 0.0% 0.0% 250.9 33115 71844 44649 29.8% 0.0% 100.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.97 51.97 250.95 250.95 1.0423 1.7971 11204614.66 11204614.66 0.00 33670.34 314013.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.96 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.2 70.22% 33114.84 28140 58980 33123.64 30565 36787 5835136 5835136 0.00
crit 74.7 29.78% 71844.03 58633 147468 71841.58 63093 84158 5369479 5369479 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12878 4.7% 119.0 3.71sec 48754 0 32980 86426 48791 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.03 118.94 0.00 0.00 0.0000 0.0000 5803285.48 5803285.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.73 70.39% 32979.96 28140 58980 32989.18 30541 36373 2761254 2761254 0.00
crit 35.20 29.59% 86425.94 70830 182863 86459.99 74766 106805 3042031 3042031 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 82831 / 21411
melee 82623 7.8% 118.4 3.70sec 81205 88026 63000 135922 81206 30.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.38 118.38 0.00 0.00 0.9225 0.0000 9613480.54 9613480.54 0.00 88025.86 88025.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.44 45.98% 62999.62 49425 101994 63065.41 56612 76444 3429559 3429559 0.00
crit 35.49 29.98% 135921.86 98850 244786 135901.08 113949 180184 4823468 4823468 0.00
glance 28.44 24.03% 47831.78 37069 76496 47850.46 40868 61816 1360454 1360454 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.36 23.36 0.00 0.00 1.0381 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 209 0.0% 17.5 9.76sec 1366 0 945 2252 1366 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.49 17.49 0.00 0.00 0.0000 0.0000 23894.57 23894.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.85 67.77% 945.39 749 1366 964.14 766 1366 11205 11205 0.00
crit 5.63 32.21% 2252.39 1498 3278 2258.78 0 3278 12690 12690 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:778.81
  • base_dd_max:778.81

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.3 0.0 30.7sec 30.7sec 24.64% 21.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.2 0.0 150.8sec 150.8sec 14.10% 14.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.10%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.4sec 41.67% 41.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.67%

    Trigger Attempt Success

    • trigger_pct:99.46%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.2 0.0 9.8sec 9.8sec 15.44% 49.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.44%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.8 2.4 47.2sec 37.1sec 24.42% 54.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.42%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.2 0.0 61.7sec 61.6sec 15.88% 15.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:15.88%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 323.6 0.0sec 0.5sec 32.76% 32.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.36% 4.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.36%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 85.22%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.2 0.0 180.0sec 180.0sec 17.82% 28.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:17.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.5 0.0 300.0sec 300.0sec 12.07% 12.07%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:12.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 14.3 42.8 3.0 3.0 301713.9
halo Mana 11.0 447236.6 40500.0 40499.8 6.9
mind_blast Mana 36.8 330863.0 9000.0 9000.0 25.7
mind_flay Mana 129.4 388166.9 3000.0 3000.0 62.8
mind_sear Mana 1.7 15361.6 9000.0 8999.9 23.1
shadow_word_death Mana 16.3 127478.2 7800.0 7800.3 38.1
shadow_word_pain Mana 84.3 1113251.6 13200.0 13199.8 23.1
vampiric_touch Mana 52.0 467698.3 9000.0 8999.9 36.4
Resource Gains Type Count Total Average Overflow
mindbender Mana 118.37 543816.32 (19.65%) 4594.28 76206.75 12.29%
Shadow Orbs from Mind Blast Shadow Orb 36.76 35.94 (81.35%) 0.98 0.82 2.23%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.24 8.24 (18.65%) 1.00 0.00 0.00%
Devouring Plague Health Health 199.44 0.00 (0.00%) 0.00 4245810.37 100.00%
Vampiric Touch Mana Mana 369.89 1717183.01 (62.04%) 4642.43 145325.11 7.80%
halo_heal Health 11.04 0.00 (0.00%) 0.00 3626763.50 100.00%
external_healing Health 84.90 0.00 (0.00%) 0.00 26947663.96 100.00%
mp5_regen Mana 1803.88 506957.42 (18.32%) 281.04 34207.99 6.32%
pet - mindbender
external_healing Health 30.57 0.00 (0.00%) 0.00 9708690.12 100.00%
Resource RPS-Gain RPS-Loss
Mana 6136.08 6406.75
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 177422.98 490.48 300000.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.4%
shadowfiend-Mana Cap 6.4%
mindbender-Mana Cap 6.4%

Procs

Count Interval
Shadowy Recall Extra Tick 524.5 0.9sec
Shadowy Apparition Procced 183.3 2.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 272848.16
Minimum 241777.30
Maximum 319376.38
Spread ( max - min ) 77599.08
Range [ ( max - min ) / 2 * 100% ] 14.22%
Standard Deviation 8485.2984
5th Percentile 259468.93
95th Percentile 287271.48
( 95th Percentile - 5th Percentile ) 27802.56
Mean Distribution
Standard Deviation 53.6743
95.00% Confidence Intervall ( 272742.96 - 272953.36 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3715
0.1 Scale Factor Error with Delta=300 614635
0.05 Scale Factor Error with Delta=300 2458543
0.01 Scale Factor Error with Delta=300 61463587
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 272848.16
Minimum 241777.30
Maximum 319376.38
Spread ( max - min ) 77599.08
Range [ ( max - min ) / 2 * 100% ] 14.22%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 113342242.03
Minimum 82611654.61
Maximum 149719743.84
Spread ( max - min ) 67108089.23
Range [ ( max - min ) / 2 * 100% ] 29.60%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.90 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 8.11 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.78 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 45.15 mind_blast,if=active_enemies<=5&cooldown_react
F 8.24 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 35.79 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 36.08 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 12.76 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 18.06 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.50 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 11.04 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.89 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 5.50 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 1.71 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 51.08 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 35.79 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9IPZEJWEWLWEKWZZZZZEJNWPEIIIJJJJKEW9ZZELNWEWKLTEPWIIIZEJJJLNWEWWEILWI9ZEJNPWTEIIIJJJLKEVWZZZZZELWTTENWPWKLEWII9EIJJJJKWTEWENLWKPZZZZEWLWEIIIJJJKVENLWIZZ9EJWPWEWKJTENWIIIZZEJJJLWEWPKLENWZZZE9WLWEIIIJJJKEVLWZZPZZENWLWEWKWEWLWIIIEI9JJNWPWEFCWKWELFCNWZZZZEFCWLWEFCIIIJJJDEFCIJP8ZZZEDF9CWLEWFCWKENWFCLIIIZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 279285 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
279284.6 279284.6 132.50 / 0.05% 17429 / 6.2% 48.0 5637.2 5167.6 Mana 0.69% 41.8 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.93 5.24 7.67 4.39 4.69 5.03
Normalized 1.00 0.76 1.11 0.63 0.68 0.73
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP > Mastery > Haste > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=6.93, SpellDamage=5.24, HitRating=7.67, CritRating=4.39, HasteRating=4.69, MasteryRating=5.03 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=6.93, SpellDamage=5.24, HitRating=0.00, CritRating=4.39, HasteRating=4.69, MasteryRating=5.03 )

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:826548|335129|288650|252514|249473|214550|212847|126984|73411&chds=0,1653097&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++826548++devouring_plague,9482C9,0,0,15|t++335129++vampiric_touch,9482C9,1,0,15|t++288650++shadow_word_pain,9482C9,2,0,15|t++252514++halo,9482C9,3,0,15|t++249473++shadow_word_death,9482C9,4,0,15|t++214550++mind_blast,9482C9,5,0,15|t++212847++mind_flay_insanity,9482C9,6,0,15|t++126984++mind_flay,9482C9,7,0,15|t++73411++mind_sear,9482C9,8,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:12,10,10,8,8,8,6,6,5,4,4,4,4,3,3,3,2,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|mind_flay_insanity|vampiric_touch|essence_of_yulon|mind_flay|shadow_word_pain_mastery|devouring_plague_tick|mind_flay_insanity_mastery|vampiric_touch_mastery|devouring_plague|mind_flay_mastery|multistrike_spell|devouring_plague_mastery|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.67,6.93,5.24,5.03,4.69,4.39|7.48,6.75,5.06,4.84,4.50,4.21|7.86,7.12,5.43,5.22,4.88,4.58&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.67++Hit,FFFFFF,0,0,15,0.1,e|t++++6.93++Int,FFFFFF,0,1,15,0.1,e|t++++5.24++SP,FFFFFF,0,2,15,0.1,e|t++++5.03++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.69++Haste,FFFFFF,0,4,15,0.1,e|t++++4.39++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.215& http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bgjmpruwz135767777530xvttsrrqqrrrssrrqqpqqrtvvvvvvtrqonmmlkkkkjigfeeddeefffggggggffghhijkllllmmlmmmlmmmmllkjjhgedcbaaZZZaaaabaaabbdegilmmnooonmmllllllllkkihhhhggghhhiiiiihgfffgijkmmnopqqqqqqrstttsrponmljihgggggggggffffffgghjlmmmmmljihhggffffffecbbbbacdeefgghhhggfgghiijklllmnmnnnnnnonnnmllkjihgfffffggghhhhhhhhiklmoppppppoonnmmmmmmmmljjjiiiiijjjkkkkkjhfeeefghijklmnnooooprsuuutsrqqpnlkjjjjjjkkkkkkkkkllmopqqqqqpoooononnnnnnmlllllklnnnnoooopoooooppqqrrrsssssssssssssssrrqomlkjiihhhhhhhhggggghklmooooopoonnmmmmmmmllkkjjjjjjjjjjkjjjjigggghiijkkllnoonnnnnonljhecZWUS&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6256,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=279285|max=446453&chxp=1,1,63,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,0,1,3,0,4,9,18,20,25,37,62,92,144,201,333,449,678,868,1193,1384,1764,1927,2018,2092,2091,1871,1719,1424,1178,956,764,540,390,283,164,110,67,42,29,23,4,6,2,2,0,1,1,0,1&chds=0,2092&chbh=5&chxt=x&chxl=0:|min=225746|avg=279285|max=334397&chxp=0,1,49,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:24.5,18.6,17.6,12.7,9.4,4.5,3.6,2.3,0.7,0.3,0.1,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 110.7s|mind_flay_insanity 83.9s|shadow_word_pain 79.5s|mind_blast 57.1s|vampiric_touch 42.5s|devouring_plague 20.1s|shadow_word_death 16.2s|halo 10.5s|shadowfiend 3.1s|mind_sear 1.5s|dispersion 0.5s|waiting 3.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 279285
devouring_plague 10781 (36929) 3.9% (13.2%) 19.4 22.64sec 857140 826548 185931 402237 250219 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.42 19.42 0.00 0.00 1.0371 0.0000 4860325.23 4860325.23 0.00 826548.49 826548.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.65 70.25% 185930.60 165521 297038 185952.89 165521 220483 2537057 2537057 0.00
crit 5.78 29.74% 402237.39 344876 742683 401954.67 0 618903 2323268 2323268 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9032 3.2% 87.6 4.84sec 46482 0 31342 81984 46543 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.61 87.49 0.00 0.00 0.0000 0.0000 4072077.13 4072077.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.21 69.96% 31342.26 27587 49507 31356.57 28188 36791 1918472 1918472 0.00
crit 26.27 30.02% 81983.62 69438 153492 81979.52 70520 104383 2153606 2153606 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17117 6.1% 19.4 22.64sec 397278 0 0 0 0 0.0% 0.0% 0.0% 0.0% 184.7 31066 67060 41788 29.8% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.42 19.42 184.66 184.66 0.0000 0.6071 7716763.98 7716763.98 0.00 68831.46 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.7 70.21% 31065.83 27587 103389 31080.17 27933 42181 4027808 4027808 0.00
crit 55.0 29.79% 67060.32 57481 215419 67039.84 58608 89538 3688956 3688956 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20524 7.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 171.6 24398 53143 32948 29.8% 0.0% 30.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.58 171.57 280.80 0.0000 0.7926 9252076.03 9252076.03 0.00 68033.97 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.2 70.24% 24398.30 21627 39475 24408.68 22444 27442 4812026 4812026 0.00
crit 83.5 29.75% 53143.05 45062 98700 53135.09 46843 63169 4440050 4440050 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (5888) 0.0% (2.1%) 10.1 45.77sec 261816 252514 0 0 0 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 10.12 0.00 0.00 1.0368 0.0000 0.00 0.00 0.00 252514.07 252514.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.14 70.50% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.98 29.48% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 5888 2.1% 10.1 45.77sec 261816 0 172007 368666 230003 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 11.52 0.00 0.00 0.0000 0.0000 2649630.18 2649630.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.12 70.49% 172006.66 157064 265830 172147.05 157064 227635 1396715 1396715 0.00
crit 3.40 29.50% 368665.65 327255 664654 359784.45 0 632401 1252915 1252915 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27173 9.7% 53.0 8.45sec 230900 214550 172172 371909 230899 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.04 53.04 0.00 0.00 1.0762 0.0000 12248011.52 12248011.52 0.00 214549.92 214549.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.43 70.57% 172171.59 132475 382319 172132.72 148075 199704 6445079 6445079 0.00
crit 15.60 29.42% 371908.65 276022 955911 371923.10 280670 498037 5802933 5802933 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 20536 (31243) 7.3% (11.2%) 77.2 5.55sec 182137 126984 0 0 0 0.0% 0.0% 0.0% 0.0% 170.0 39891 88057 54353 30.0% 0.0% 22.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.18 77.18 169.99 169.99 1.4343 0.5851 9239191.31 9239191.31 0.00 126983.84 126983.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.17 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.0 69.98% 39891.23 35102 62990 39923.68 36193 46083 4745059 4745059 0.00
crit 51.0 30.02% 88057.42 73139 157494 88077.29 76010 109920 4494132 4494132 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 26108 (39616) 9.4% (14.2%) 55.1 7.70sec 324151 212847 0 0 0 0.0% 0.0% 0.0% 0.0% 121.5 71892 155227 96885 30.0% 0.0% 16.4%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.12 55.12 121.53 121.53 1.5229 0.6080 11774985.07 11774985.07 0.00 212847.13 212847.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.11 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.1 70.01% 71892.27 35102 125980 71983.27 61392 88149 6116959 6116959 0.00
crit 36.4 29.99% 155226.76 73139 314987 155296.16 120173 197476 5658026 5658026 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 13508 4.8% 57.7 7.28sec 105660 0 71453 186559 105764 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.65 57.60 0.00 0.00 0.0000 0.0000 6091615.83 6091615.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.41 70.17% 71452.65 35102 125980 71551.87 56899 89340 2887747 2887747 0.00
crit 17.17 29.82% 186559.38 88353 390590 186604.79 125908 258054 3203869 3203869 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 10707 3.8% 80.7 5.23sec 59703 0 39744 106334 59720 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.70 80.68 0.00 0.00 0.0000 0.0000 4817919.76 4817919.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.46 69.98% 39743.89 35102 62990 39776.37 35869 46600 2243798 2243798 0.00
crit 24.21 30.01% 106333.78 88353 195295 106366.17 89145 140972 2574121 2574121 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 248 0.1% 0.7 125.53sec 157185 73411 0 0 0 0.0% 0.0% 0.0% 0.0% 2.2 22420 47510 29669 28.9% 0.0% 0.3%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.72 0.72 2.16 3.79 2.1423 0.6264 112391.64 112391.64 0.00 73410.61 73410.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.71 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.7 71.10% 22420.33 20669 35417 11785.28 0 35417 60383 60383 0.00
crit 1.1 28.90% 47510.35 43064 73793 20603.47 0 73793 52009 52009 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 129 0.0% 1.8 27.18sec 32594 0 22397 57589 32591 29.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.79 1.79 0.00 0.00 0.0000 0.0000 58336.32 58336.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.27 70.97% 22396.53 20669 35417 10281.32 0 35417 28445 28445 0.00
crit 0.52 29.00% 57588.98 52023 89144 17706.49 0 89144 29892 29892 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (129) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 9521 3.4% 198.1 2.25sec 21651 0 21651 0 21651 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.13 198.13 0.00 0.00 0.0000 0.0000 4289615.30 4289615.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.13 100.00% 21650.81 8570 359002 21662.69 16041 30897 4289615 4289615 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:28140.49
  • base_dd_max:28140.49
shadow_word_death 8974 3.2% 15.6 4.87sec 258728 249473 191837 414416 258730 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.61 15.61 0.00 0.00 1.0371 0.0000 4038468.35 4038468.35 0.00 249472.96 249472.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.91 69.92% 191837.22 148912 430751 192010.16 149752 269901 2093856 2093856 0.00
crit 4.69 30.06% 414416.33 310271 1077005 412967.80 0 877900 1944612 1944612 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 33408 (50930) 12.0% (18.3%) 76.7 5.81sec 299225 288650 0 0 0 0.0% 0.0% 0.0% 0.0% 391.2 28642 61952 38495 29.6% 0.0% 127.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.73 76.73 391.24 391.24 1.0366 1.4659 15060978.53 15060978.53 0.00 35156.28 288650.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.72 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 275.5 70.42% 28642.16 25710 46124 28652.30 26775 31327 7891418 7891418 0.00
crit 115.7 29.58% 61952.32 53569 115323 61958.73 56644 69976 7169560 7169560 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 17522 6.3% 185.6 2.40sec 42548 0 28749 75398 42579 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.65 185.51 0.00 0.00 0.0000 0.0000 7898846.44 7898846.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.47 70.33% 28749.40 25710 46124 28758.13 26785 31242 3750995 3750995 0.00
crit 55.01 29.65% 75397.81 64713 143003 75413.67 67614 86323 4147851 4147851 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0486 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6288 2.3% 170.7 2.61sec 16595 0 15012 32609 20277 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 170.74 139.74 0.00 0.00 0.0000 0.0000 2833435.79 2833435.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.89 70.06% 15012.49 13192 24079 15015.58 13823 16559 1469644 1469644 0.00
crit 41.82 29.93% 32608.56 27487 60206 32609.62 29028 38561 1363792 1363792 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 1974 0.7% 29.3 10.87sec 29920 0 20364 50057 29920 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.28 29.28 0.00 0.00 0.0000 0.0000 876184.10 876184.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.85 67.79% 20364.25 16220 29606 20448.22 16910 28870 404296 404296 0.00
crit 9.43 32.19% 50057.07 33796 74024 49622.93 0 74024 471888 471888 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16874.28
  • base_dd_max:16874.28
vampiric_touch 20812 (31653) 7.4% (11.3%) 40.4 10.96sec 352902 335129 0 0 0 0.0% 0.0% 0.0% 0.0% 218.1 31814 69178 42960 29.8% 0.0% 86.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.38 40.38 218.11 218.11 1.0530 1.7931 9370231.15 9370231.15 0.00 32865.03 335129.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.38 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.0 70.17% 31813.84 28140 51287 31830.95 29143 36006 4868956 4868956 0.00
crit 65.1 29.83% 69178.16 58633 128233 69192.89 61624 83389 4501275 4501275 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10841 3.9% 103.5 4.23sec 47176 0 31780 83615 47206 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.45 103.39 0.00 0.00 0.0000 0.0000 4880473.45 4880473.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.60 70.22% 31780.45 28140 51287 31793.57 29269 35214 2307125 2307125 0.00
crit 30.78 29.77% 83614.87 70830 159011 83644.41 71463 101827 2573348 2573348 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 103250 / 8193
melee 102902 2.9% 36.4 10.74sec 100094 113418 73589 173416 100093 30.8% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.38 36.38 0.00 0.00 0.8825 0.0000 3641633.06 3641633.06 0.00 113418.25 113418.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.44 45.18% 73589.26 56165 115903 73778.94 62957 103588 1209622 1209622 0.00
crit 11.20 30.80% 173416.16 127276 278167 172886.78 128505 259017 1943017 1943017 0.00
glance 8.74 24.01% 55977.33 42124 86927 55984.49 0 86927 488994 488994 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0426 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 348 0.0% 8.0 0.73sec 1528 0 1018 2517 1528 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12218.36 12218.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.28 66.01% 1018.27 852 1366 1028.39 0 1366 5376 5376 0.00
crit 2.72 33.98% 2517.30 2045 3278 2383.61 0 3278 6842 6842 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 26.1 2.7 16.4sec 14.8sec 8.57% 45.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.57%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.4 0.0 22.6sec 22.6sec 25.13% 26.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.4 0.0 144.0sec 144.0sec 14.89% 14.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.89%

    Trigger Attempt Success

    • trigger_pct:99.92%
jade_serpent_potion 2.0 0.0 419.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.6sec 23.5sec 41.65% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.65%

    Trigger Attempt Success

    • trigger_pct:99.45%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.1sec 10.1sec 14.89% 49.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.89%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.8 2.4 47.2sec 37.2sec 24.38% 54.07%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.38%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.6 0.0 58.8sec 58.7sec 16.63% 16.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.63%

    Trigger Attempt Success

    • trigger_pct:99.91%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.38% 78.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.83% 73.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.41% 16.41%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 19.4 58.3 3.0 3.0 285743.5
halo Mana 10.1 409864.9 40500.0 40499.7 6.5
mind_blast Mana 53.0 231706.1 4368.2 4368.1 52.9
mind_flay Mana 77.2 231533.8 3000.0 3000.0 60.7
mind_flay_insanity Mana 55.1 165353.9 3000.0 3000.0 108.1
mind_sear Mana 0.7 6436.4 9000.0 9001.7 17.5
shadow_word_death Mana 15.6 121754.9 7800.0 7800.3 33.2
shadow_word_pain Mana 76.7 1012837.6 13200.0 13199.9 22.7
vampiric_touch Mana 40.4 363429.0 9000.0 8999.9 39.2
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.78 14057.24 (0.60%) 17999.03 0.76 0.01%
shadowfiend Mana 36.38 278683.09 (11.96%) 7660.89 48713.15 14.88%
Shadow Orbs from Mind Blast Shadow Orb 53.04 51.74 (86.75%) 0.98 1.29 2.44%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.90 7.90 (13.25%) 1.00 0.00 0.00%
Devouring Plague Health Health 272.16 0.00 (0.00%) 0.00 5793831.94 100.00%
Vampiric Touch Mana Mana 321.49 1519732.24 (65.19%) 4727.09 99084.32 6.12%
halo_heal Health 10.12 0.00 (0.00%) 0.00 3175455.44 100.00%
external_healing Health 85.82 0.00 (0.00%) 0.00 27399439.57 100.00%
mp5_regen Mana 1803.88 518586.82 (22.25%) 287.48 22578.59 4.17%
pet - shadowfiend
external_healing Health 16.29 0.00 (0.00%) 0.00 5241276.53 100.00%
Resource RPS-Gain RPS-Loss
Mana 5167.55 5637.20
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 85682.55 0.00 298800.00
Shadow Orb 1.40 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.3%
shadowfiend-Mana Cap 4.3%
mindbender-Mana Cap 4.3%

Procs

Count Interval
Shadowy Recall Extra Tick 516.4 0.9sec
Shadowy Apparition Procced 170.7 2.6sec
Divine Insight Mind Blast CD Reset 48.4 14.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 279284.59
Minimum 225745.59
Maximum 334396.71
Spread ( max - min ) 108651.12
Range [ ( max - min ) / 2 * 100% ] 19.45%
Standard Deviation 10687.1814
5th Percentile 262023.51
95th Percentile 296882.08
( 95th Percentile - 5th Percentile ) 34858.57
Mean Distribution
Standard Deviation 67.6025
95.00% Confidence Intervall ( 279152.09 - 279417.08 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5625
0.1 Scale Factor Error with Delta=300 975012
0.05 Scale Factor Error with Delta=300 3900048
0.01 Scale Factor Error with Delta=300 97501215
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 279284.59
Minimum 225745.59
Maximum 334396.71
Spread ( max - min ) 108651.12
Range [ ( max - min ) / 2 * 100% ] 19.45%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 122141557.09
Minimum 87119606.96
Maximum 160808031.07
Spread ( max - min ) 73688424.11
Range [ ( max - min ) / 2 * 100% ] 30.17%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 7.71 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 4.30 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 56.99 mind_blast,if=active_enemies<=5&cooldown_react
F 7.90 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 6.17 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 22.92 mind_flay_insanity,interrupt=1,chain=1
I 38.91 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 33.37 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 7.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 10.04 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.13 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 10.12 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 9.07 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 15.68 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.72 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 33.67 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 29.85 shadow_word_pain,moving=1
a 0.10 dispersion

Sample Sequence

AIPZEJWTTEWEJKNHEZZZZZWLEWPWIEIIJJJIJWENHZZZEWLWEWKELNHIIIPZEJJJLWTEWWKENHIZZEJEWPIEIIJDEHGIJZZZZZEJWTEWELKNHEHAIIEIJJJKPWENHGEJWKZZEZENHEJIIIJJJKEPVWLWIZZEJNHWEWLWEIWIEIIEJDEHEHIJPWTTENHGELKWEZZWENHHIEIIIJPEWZENZEHGLWEWWEINHJEEAIIIIJJEPWFCNEHGFCIEZZENZFCHEJWFCIIIEJJDFCHG8IPFCEJNHFCEWKWLFCENHEII

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 275620 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
275620.5 275620.5 120.75 / 0.04% 15937 / 5.8% 44.2 6044.1 5614.4 Mana 0.33% 39.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.03 5.21 8.25 4.53 4.67 4.81
Normalized 1.00 0.74 1.17 0.64 0.66 0.68
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP > Mastery ~= Haste ~= Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.03, SpellDamage=5.21, HitRating=8.25, CritRating=4.53, HasteRating=4.67, MasteryRating=4.81 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.03, SpellDamage=5.21, HitRating=0.00, CritRating=4.53, HasteRating=4.67, MasteryRating=4.81 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:847442|329920|318167|288878|251039|231334|188300|139328|77164&chds=0,1694884&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++847442++devouring_plague,9482C9,0,0,15|t++329920++vampiric_touch,9482C9,1,0,15|t++318167++halo,9482C9,2,0,15|t++288878++shadow_word_pain,9482C9,3,0,15|t++251039++shadow_word_death,9482C9,4,0,15|t++231334++mind_flay_insanity,9482C9,5,0,15|t++188300++mind_blast,9482C9,6,0,15|t++139328++mind_flay,9482C9,7,0,15|t++77164++mind_sear,9482C9,8,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,8,7,7,7,5,5,5,4,3,3,3,3,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_flay|vampiric_touch|mind_flay_insanity|shadow_word_pain_mastery|essence_of_yulon|mind_blast|mind_flay_mastery|devouring_plague_tick|vampiric_touch_mastery|mind_flay_insanity_mastery|multistrike_spell|shadow_word_death|shadowfiend: melee|devouring_plague|halo_damage|devouring_plague_mastery|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.25,7.03,5.21,4.81,4.67,4.53|8.07,6.86,5.04,4.64,4.50,4.36|8.42,7.20,5.38,4.99,4.84,4.70&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.25++Hit,FFFFFF,0,0,15,0.1,e|t++++7.03++Int,FFFFFF,0,1,15,0.1,e|t++++5.21++SP,FFFFFF,0,2,15,0.1,e|t++++4.81++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.67++Haste,FFFFFF,0,4,15,0.1,e|t++++4.53++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.908& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:afimpsvx0235546578653zxusrqonmnnnomljhfcbccdiihiihgffddccddefgggcbbbbabbbbbcbbbaYXWVVWXXXYZZacdceeeeffffeedddcbZYWVUTTTVWXZbbbabaabdegikkjkjhfdcbbcbbccccbZYYYXXXYYYYaZabbaaZZZacdefffgiihiihhhijiiigfeeedcbaZZZZaaaaaaZZZYYYYZbefeeeecbaaZZZaabcdedbaaaaabbcddeeefedbaabbdddddddeedeeedeeedccbbccbbaZYYYYZZaabccbbaaZZabdghggggffedddeeefgggfdccccbbcccdeddddbZYXXYZbcdefgikkklllnppqrrqponmljhgeeeeddddedddddccdefgihiiihgggggggggghhhfeeeeeefffghgghhhggggghijjjjjkkkkkkkllllllkkkkihgeddccccdefggfffffhjklnoooooonmlkkkjjiihhgfffffeeeeeefeeeeeddcccdeffffgghhhghhiljihfcaYWUS&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5209,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=275620|max=529151&chxp=1,1,52,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,0,1,2,9,9,13,26,50,65,119,160,236,331,439,661,843,1079,1214,1372,1501,1734,1709,1785,1726,1666,1461,1371,1168,941,774,615,502,417,263,223,163,98,93,50,35,24,15,9,5,4,3,2,3&chds=0,1785&chbh=5&chxt=x&chxl=0:|min=233834|avg=275620|max=318620&chxp=0,1,49,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:29.4,19.4,14.3,11.2,9.7,3.7,3.3,2.4,0.7,0.5,0.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 132.4s|shadow_word_pain 87.6s|mind_flay_insanity 64.7s|vampiric_touch 50.5s|mind_blast 43.6s|shadow_word_death 16.6s|devouring_plague 14.8s|halo 10.6s|shadowfiend 3.1s|mind_sear 2.1s|dispersion 0.2s|waiting 1.5s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 275620
devouring_plague 7926 (27827) 2.9% (10.1%) 14.3 31.45sec 878439 847442 186180 402198 250136 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 0.00 0.00 1.0366 0.0000 3572186.91 3572186.91 0.00 847442.04 847442.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.05 70.36% 186179.52 165521 311890 186243.13 165521 232753 1870735 1870735 0.00
crit 4.23 29.62% 402197.87 344876 779817 399605.64 0 762941 1701452 1701452 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6913 2.5% 66.5 6.40sec 46896 0 31642 82677 46975 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.47 66.36 0.00 0.00 0.0000 0.0000 3117361.02 3117361.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.41 69.93% 31642.36 27587 51982 31660.23 27928 37210 1468480 1468480 0.00
crit 19.94 30.05% 82676.63 69438 161167 82648.46 70060 108569 1648881 1648881 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12987 4.7% 14.3 31.45sec 410005 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.3 31112 66978 41743 29.6% 0.0% 18.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 140.27 140.27 0.0000 0.5896 5855136.52 5855136.52 0.00 70798.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.7 70.36% 31111.67 27587 85794 31132.59 27897 38428 3070352 3070352 0.00
crit 41.6 29.64% 66978.39 57481 214510 66960.02 57853 82517 2784785 2784785 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18270 6.6% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 163.9 24583 53946 33303 29.7% 0.0% 28.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 33.64 163.89 247.41 0.0000 0.7947 8239511.31 8239511.31 0.00 63260.18 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.9 70.29% 24582.68 21627 41449 24592.01 22651 28053 4274807 4274807 0.00
crit 73.5 29.71% 53946.16 45062 103635 53949.82 48023 69266 3964704 3964704 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7490) 0.0% (2.7%) 10.2 45.68sec 329841 318167 0 0 0 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.24 10.24 0.00 0.00 1.0367 0.0000 0.00 0.00 0.00 318166.53 318166.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.23 70.61% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.01 29.38% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7490 2.7% 10.2 45.68sec 329841 0 170586 366764 227616 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.24 14.84 0.00 0.00 0.0000 0.0000 3378292.22 3378292.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.52 70.91% 170586.06 157064 279122 171244.77 157064 234084 1795234 1795234 0.00
crit 4.32 29.08% 366764.01 327255 697887 363417.36 0 664021 1583058 1583058 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18237 6.6% 36.9 12.21sec 222355 188300 166285 358710 222355 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.94 36.94 0.00 0.00 1.1809 0.0000 8212904.77 8212904.77 0.00 188300.27 188300.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.16 70.84% 166284.91 132475 401435 166239.32 139391 192117 4350659 4350659 0.00
crit 10.77 29.15% 358710.42 276022 981845 358730.34 0 545922 3862246 3862246 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 26956 (41012) 9.8% (14.9%) 92.7 4.65sec 199039 139328 0 0 0 0.0% 0.0% 0.0% 0.0% 219.0 40582 89845 55388 30.1% 0.0% 27.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.70 92.70 218.97 218.97 1.4286 0.5571 12128239.28 12128239.28 0.00 139327.57 139327.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.69 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.2 69.94% 40581.73 35102 66140 40618.36 37282 46700 6215243 6215243 0.00
crit 65.8 30.06% 89844.95 73139 165368 89873.17 78632 112517 5912996 5912996 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 21838 (33175) 7.9% (12.1%) 43.5 9.82sec 344203 231334 0 0 0 0.0% 0.0% 0.0% 0.0% 98.7 74160 159684 99825 30.0% 0.0% 12.9%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.48 43.48 98.69 98.69 1.4879 0.5884 9851423.02 9851423.02 0.00 231334.23 231334.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.47 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.1 69.99% 74160.34 35102 132279 74270.54 63681 90171 5122485 5122485 0.00
crit 29.6 30.01% 159683.89 73139 330737 159741.83 119873 207004 4728938 4728938 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 11337 4.1% 46.8 9.01sec 109171 0 73917 192401 109303 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.84 46.78 0.00 0.00 0.0000 0.0000 5113356.98 5113356.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.80 70.11% 73917.10 35102 132279 74021.06 59923 95376 2424253 2424253 0.00
crit 13.98 29.88% 192401.09 88353 410120 192529.82 94883 272860 2689104 2689104 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 14056 5.1% 103.9 4.10sec 60871 0 40453 108679 60887 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.87 103.85 0.00 0.00 0.0000 0.0000 6322910.30 6322910.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.72 70.03% 40453.17 35102 66140 40486.39 36706 47630 2941722 2941722 0.00
crit 31.11 29.96% 108679.14 88353 205060 108724.02 91455 153388 3381188 3381188 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 367 0.1% 0.9 118.13sec 185392 77164 0 0 0 0.0% 0.0% 0.0% 0.0% 3.1 22237 47119 29381 28.7% 0.0% 0.4%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.89 0.89 3.06 5.64 2.4031 0.6289 165593.59 165593.59 0.00 77163.83 77163.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.89 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.0 71.27% 22237.38 20669 35417 12701.19 0 35417 89327 89327 0.00
crit 1.6 28.72% 47119.08 43064 73793 24388.15 0 73793 76266 76266 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 191 0.1% 2.7 29.60sec 32119 0 22250 56951 32120 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.69 2.69 0.00 0.00 0.0000 0.0000 86256.72 86256.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.92 71.54% 22249.76 20669 35417 11980.09 0 35417 42749 42749 0.00
crit 0.76 28.45% 56951.38 52023 89144 22707.14 0 89144 43508 43508 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (191) 0.0% (0.1%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 9247 3.4% 204.5 2.18sec 20376 0 20376 0 20376 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 204.48 204.48 0.00 0.00 0.0000 0.0000 4166572.97 4166572.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 204.48 100.00% 20376.00 8570 368718 20388.12 15582 27247 4166573 4166573 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:31258.53
  • base_dd_max:31258.53
power_infusion 0 0.0% 4.3 120.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 4.28 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9227 3.3% 16.0 4.77sec 260353 251039 192775 416986 260350 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.97 15.97 0.00 0.00 1.0371 0.0000 4156706.69 4156706.69 0.00 251039.18 251039.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.15 69.83% 192775.02 148912 452288 193025.07 149892 276786 2149109 2149109 0.00
crit 4.81 30.15% 416986.19 310271 1130856 415523.00 0 1106154 2007598 2007598 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 36865 (56091) 13.4% (20.4%) 84.5 5.29sec 299425 288878 0 0 0 0.0% 0.0% 0.0% 0.0% 429.4 28807 62396 38716 29.5% 0.0% 134.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.48 84.48 429.41 429.41 1.0365 1.4077 16625177.24 16625177.24 0.00 36553.16 288877.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.47 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 302.7 70.50% 28806.73 25710 48430 28817.97 26936 32356 8720589 8720589 0.00
crit 126.7 29.50% 62395.70 53569 121089 62407.95 56782 71244 7904588 7904588 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19227 7.0% 203.7 2.19sec 42558 0 28785 75608 42590 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.74 203.59 0.00 0.00 0.0000 0.0000 8670995.73 8670995.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.51 70.49% 28784.67 25710 48430 28792.73 27101 31397 4131039 4131039 0.00
crit 60.05 29.49% 75607.78 64713 150153 75629.11 68761 87347 4539957 4539957 0.00
miss 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0487 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6803 2.5% 186.7 2.39sec 16422 0 14922 32454 20151 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 186.73 152.18 0.00 0.00 0.0000 0.0000 3066535.04 3066535.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.75 70.15% 14922.50 13192 24079 14926.01 13755 16469 1592975 1592975 0.00
crit 45.40 29.84% 32454.47 27487 60206 32456.89 28570 37941 1473560 1473560 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2450 0.9% 34.7 9.10sec 31306 0 21173 52615 31306 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.75 34.75 0.00 0.00 0.0000 0.0000 1087785.91 1087785.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.54 67.75% 21173.09 16220 31086 21263.11 17678 29755 498426 498426 0.00
crit 11.20 32.24% 52614.64 33796 77725 52114.71 33796 77725 589360 589360 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16219.80
  • base_dd_max:16219.80
vampiric_touch 24418 (37023) 8.9% (13.4%) 48.3 9.18sec 345275 329920 0 0 0 0.0% 0.0% 0.0% 0.0% 253.6 32126 69907 43367 29.8% 0.0% 95.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.29 48.29 253.55 253.55 1.0465 1.7036 10995900.24 10995900.24 0.00 34554.96 329920.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.28 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 178.1 70.25% 32126.27 28140 53851 32143.00 29724 35743 5722156 5722156 0.00
crit 75.4 29.75% 69907.17 58633 134645 69913.39 62211 82858 5273744 5273744 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12605 4.6% 120.2 3.65sec 47213 0 31846 83824 47244 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.23 120.15 0.00 0.00 0.0000 0.0000 5676626.30 5676626.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.53 70.35% 31845.60 28140 53851 31855.28 29671 35482 2691880 2691880 0.00
crit 35.61 29.63% 83824.25 70830 166962 83857.48 73369 102999 2984746 2984746 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 103491 / 8210
melee 103145 2.9% 36.4 10.74sec 100344 113706 73704 173772 100343 30.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.37 36.37 0.00 0.00 0.8825 0.0000 3649178.34 3649178.34 0.00 113706.36 113706.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.40 45.09% 73704.46 56165 115903 73906.85 62618 111865 1208664 1208664 0.00
crit 11.22 30.87% 173771.62 127276 278167 173176.03 129060 256970 1950585 1950585 0.00
glance 8.74 24.03% 56071.26 42124 86927 56093.77 0 86927 489929 489929 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.0426 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 346 0.0% 8.0 0.73sec 1518 0 1014 2506 1518 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12139.21 12139.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.29 66.19% 1013.55 852 1366 1023.66 0 1366 5366 5366 0.00
crit 2.70 33.79% 2505.58 2045 3278 2369.59 0 3278 6773 6773 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:852.09
  • base_dd_max:852.09

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.77%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.3 0.0 31.4sec 31.4sec 25.42% 21.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.3 0.0 151.7sec 151.7sec 14.20% 14.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:14.20%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 418.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.7 36.6sec 23.5sec 41.60% 41.60%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.60%

    Trigger Attempt Success

    • trigger_pct:99.45%
power_infusion 4.3 0.0 120.7sec 120.7sec 18.56% 18.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.1 0.0 9.9sec 9.9sec 15.17% 49.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.17%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 9.48%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.8 2.4 47.2sec 37.1sec 24.44% 44.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.44%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.2 0.0 62.3sec 62.2sec 15.87% 15.87%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:15.87%

    Trigger Attempt Success

    • trigger_pct:99.88%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.38% 78.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.34% 74.03%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.42% 16.42%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 14.3 42.8 3.0 3.0 292844.2
halo Mana 10.2 394767.1 38543.0 38543.2 8.6
mind_blast Mana 36.9 320885.4 8687.6 8687.6 25.6
mind_flay Mana 92.7 263313.2 2840.5 2840.4 70.1
mind_flay_insanity Mana 43.5 125965.7 2897.3 2897.3 118.8
mind_sear Mana 0.9 8040.5 8999.9 9001.9 20.6
shadow_word_death Mana 16.0 119987.8 7515.1 7515.4 34.6
shadow_word_pain Mana 84.5 1076984.1 12748.2 12748.0 23.5
vampiric_touch Mana 48.3 416536.3 8626.2 8626.1 40.0
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.38 6927.26 (0.27%) 17998.48 0.58 0.01%
shadowfiend Mana 36.36 264374.71 (10.44%) 7270.75 62877.89 19.21%
Shadow Orbs from Mind Blast Shadow Orb 36.93 36.08 (81.72%) 0.98 0.85 2.30%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.07 8.07 (18.28%) 1.00 0.00 0.00%
Devouring Plague Health Health 206.63 0.00 (0.00%) 0.00 4398897.34 100.00%
Vampiric Touch Mana Mana 373.71 1746161.91 (68.95%) 4672.51 135629.37 7.21%
halo_heal Health 10.24 0.00 (0.00%) 0.00 3190467.75 100.00%
external_healing Health 85.70 0.00 (0.00%) 0.00 27389710.01 100.00%
mp5_regen Mana 1803.88 515150.75 (20.34%) 285.58 26014.66 4.81%
pet - shadowfiend
external_healing Health 16.34 0.00 (0.00%) 0.00 5261415.99 100.00%
Resource RPS-Gain RPS-Loss
Mana 5614.37 6044.13
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 106783.31 0.00 288000.00
Shadow Orb 1.33 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.8%
shadowfiend-Mana Cap 4.8%
mindbender-Mana Cap 4.8%

Procs

Count Interval
Shadowy Recall Extra Tick 543.4 0.8sec
Shadowy Apparition Procced 186.7 2.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 275620.48
Minimum 233834.19
Maximum 318619.56
Spread ( max - min ) 84785.36
Range [ ( max - min ) / 2 * 100% ] 15.38%
Standard Deviation 9739.2560
5th Percentile 260160.44
95th Percentile 292034.72
( 95th Percentile - 5th Percentile ) 31874.28
Mean Distribution
Standard Deviation 61.6063
95.00% Confidence Intervall ( 275499.73 - 275741.23 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4796
0.1 Scale Factor Error with Delta=300 809720
0.05 Scale Factor Error with Delta=300 3238882
0.01 Scale Factor Error with Delta=300 80972067
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 275620.48
Minimum 233834.19
Maximum 318619.56
Spread ( max - min ) 84785.36
Range [ ( max - min ) / 2 * 100% ] 15.38%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 120489472.77
Minimum 86440310.16
Maximum 156409855.97
Spread ( max - min ) 69969545.81
Range [ ( max - min ) / 2 * 100% ] 29.04%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 4.28 power_infusion,if=talent.power_infusion.enabled
C 7.90 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.52 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 45.00 mind_blast,if=active_enemies<=5&cooldown_react
F 8.07 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 3.68 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 15.36 mind_flay_insanity,interrupt=1,chain=1
I 37.13 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 39.03 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 10.83 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 12.22 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.76 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 10.24 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 5.61 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 5.25 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.89 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 32.94 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 36.51 shadow_word_pain,moving=1
a 0.04 dispersion

Sample Sequence

ABIPZEJWEWJKENHZZZZZEJWPEIIIJJJJEIWZZZELNHGEWKLEPWIIIZEJJJJNHEGWKWLEWBIZZEJNHEIIIJJJJEIPWZZZZZELWTTENHGEIJWAIIEIJJJLKPWENHGWEWLWKZZZZZEWLWEIIIJJJKDEHGIBPZEJWEWLWKENHIIIZZEJJJJWPEWLWEINHZZZELWTEIIIJJJKLEPWZZZZENHJWEWKWEWLWIABIEIIJJPWTENFCHKLEWFCNHZZZZZEFCJWEIFCIIJJJEDFCH8IPZEFCJNHEFCWKLEDFCHIIIZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 269336 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
269335.6 269335.6 155.36 / 0.06% 20803 / 7.7% 42.7 6098.9 5562.6 Mana 1.65% 44.2 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.65 4.86 7.48 4.09 2.01 5.38
Normalized 1.00 0.73 1.12 0.61 0.30 0.81
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.22 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Hit > Int > Mastery > SP > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=6.65, SpellDamage=4.86, HitRating=7.48, CritRating=4.09, HasteRating=2.01, MasteryRating=5.38 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=6.65, SpellDamage=4.86, HitRating=0.00, CritRating=4.09, HasteRating=2.01, MasteryRating=5.38 )

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:871436|320235|308906|286467|285758|232253|196696|132235|95732&chds=0,1742872&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++871436++devouring_plague,9482C9,0,0,15|t++320235++vampiric_touch,9482C9,1,0,15|t++308906++halo,9482C9,2,0,15|t++286467++shadow_word_pain,9482C9,3,0,15|t++285758++shadow_word_death,9482C9,4,0,15|t++232253++mind_flay_insanity,9482C9,5,0,15|t++196696++mind_blast,9482C9,6,0,15|t++132235++mind_flay,9482C9,7,0,15|t++95732++mind_sear,9482C9,8,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,9,7,7,7,5,5,5,4,4,3,3,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_flay|vampiric_touch|mind_flay_insanity|shadow_word_pain_mastery|mind_blast|essence_of_yulon|mind_flay_mastery|devouring_plague_tick|vampiric_touch_mastery|mind_flay_insanity_mastery|shadow_word_death|multistrike_spell|devouring_plague|shadowfiend: melee|halo_damage|devouring_plague_mastery|shadowy_apparition|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.48,6.65,5.38,4.86,4.09,2.01|7.25,6.43,5.16,4.64,3.87,1.79|7.70,6.87,5.60,5.08,4.31,2.23&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.48++Hit,FFFFFF,0,0,15,0.1,e|t++++6.65++Int,FFFFFF,0,1,15,0.1,e|t++++5.38++Mastery,FFFFFF,0,2,15,0.1,e|t++++4.86++SP,FFFFFF,0,3,15,0.1,e|t++++4.09++Crit,FFFFFF,0,4,15,0.1,e|t++++2.01++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.980& http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:djnqsuxz246787766630xtronmmmmnqtvxxyxwwuuvwx02100yurnljiijiklmnmjhihhhiiiijkjjjigfedeegghijjklmlmmmlmmmmlmkkkjhgecbaZZZabcdfedeeddefhjmpopponmkjjijjklnoooljkjjiijjjklkkjigedcdegijkllnoqprsttuvwwwwtsrqpomljihgghhiiiighggffghjmonnnnlihhhghgghijjifeedccdeeefhgiiihgffghjjkllmopqprqqqqrrpopnnnnmlkiggghijkmnoonnnmlmnoquwuuttsqppooppqqrsrqnllllllllmnoopppnljijjlmopqqsuvuvvvuwyz002zzyywvtrqpppqqrstttssssrrstvyzyyyyxvuuuuuuuvvvvusqqqqpqssstuttttttsstuvvwxxxxxxwxwwwwxxwwwvuutrponllkjjiihhhgffeedeghijkkkkklllllllmnnoooonnoopppppppqppoonmmlmnopqqqqrsutuuwwz31zxvroljgd&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6670,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=562|1:|0|avg=269336|max=403788&chxp=1,1,67,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,0,1,2,2,2,10,11,13,25,41,71,84,122,149,202,251,308,385,458,561,750,843,1041,1129,1334,1454,1671,1718,1716,1671,1621,1488,1305,1106,948,683,516,412,296,199,155,86,70,40,19,12,6,2,1&chds=0,1718&chbh=5&chxt=x&chxl=0:|min=210521|avg=269336|max=313351&chxp=0,1,57,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:28.7,19.1,14.7,10.8,9.4,3.4,3.2,2.3,0.7,0.5,0.5,1.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 129.3s|shadow_word_pain 86.1s|mind_flay_insanity 66.4s|vampiric_touch 48.5s|mind_blast 42.4s|shadow_word_death 15.2s|devouring_plague 14.4s|halo 10.2s|shadowfiend 3.1s|dispersion 2.2s|mind_sear 2.1s|waiting 7.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 269336
devouring_plague 8133 (27923) 3.0% (10.4%) 13.9 31.42sec 903300 871436 195705 423426 263049 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.91 0.00 0.00 1.0366 0.0000 3659358.27 3659358.27 0.00 871436.01 871436.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.79 70.41% 195705.25 165521 341594 195764.56 165521 243028 1916853 1916853 0.00
crit 4.12 29.58% 423425.69 344876 854086 419931.27 0 711738 1742505 1742505 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6917 2.6% 62.9 6.55sec 49461 0 33375 87235 49538 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.94 62.84 0.00 0.00 0.0000 0.0000 3113061.14 3113061.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.97 69.97% 33374.68 27587 56933 33398.00 29207 40403 1467417 1467417 0.00
crit 18.86 30.02% 87234.85 69438 176516 87211.74 71856 114137 1645644 1645644 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12873 4.8% 13.9 31.42sec 416473 0 0 0 0 0.0% 0.0% 0.0% 0.0% 132.8 32553 70118 43641 29.5% 0.0% 17.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.91 132.76 132.76 0.0000 0.6073 5793687.90 5793687.90 0.00 71863.26 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.6 70.48% 32552.68 27587 56933 32576.42 28995 38743 3046067 3046067 0.00
crit 39.2 29.52% 70117.55 57481 142349 70103.59 58768 87747 2747620 2747620 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18380 6.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 157.4 25586 55997 34594 29.6% 0.0% 27.7%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.25 157.36 239.40 0.0000 0.7951 8281700.25 8281700.25 0.00 66194.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 168.4 70.36% 25586.05 21627 45397 25591.39 23395 29236 4309889 4309889 0.00
crit 70.9 29.63% 55996.73 45062 113505 55977.53 48368 70215 3971811 3971811 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6955) 0.0% (2.6%) 9.8 46.62sec 320275 308906 0 0 0 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 9.80 0.00 0.00 1.0369 0.0000 0.00 0.00 0.00 308905.52 308905.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.92 70.60% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.88 29.39% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6955 2.6% 9.8 46.62sec 320275 0 176991 381133 236635 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 13.27 0.00 0.00 0.0000 0.0000 3139715.75 3139715.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.39 70.77% 176991.30 157064 305705 177443.86 157064 233366 1661810 1661810 0.00
crit 3.88 29.23% 381133.46 327255 764352 375023.60 0 727261 1477906 1477906 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18551 6.9% 36.3 12.36sec 230112 196696 172168 371564 230108 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.27 36.27 0.00 0.00 1.1699 0.0000 8346220.14 8346220.14 0.00 196696.36 196696.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.72 70.92% 172168.08 132475 439667 172084.49 145500 213448 4428365 4428365 0.00
crit 10.54 29.07% 371563.68 276022 1099297 371567.72 276022 590707 3917855 3917855 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 24966 (37961) 9.3% (14.1%) 88.2 4.88sec 193770 132235 0 0 0 0.0% 0.0% 0.0% 0.0% 201.9 41011 90087 55686 29.9% 0.0% 26.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.24 88.24 201.93 201.93 1.4653 0.5877 11244756.57 11244756.57 0.00 132235.25 132235.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.23 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.5 70.10% 41011.20 35102 72438 41037.41 37242 46614 5805052 5805052 0.00
crit 60.4 29.90% 90087.23 73139 181118 90089.49 78950 110203 5439705 5439705 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 22525 (34229) 8.4% (12.7%) 42.6 9.72sec 361566 232253 0 0 0 0.0% 0.0% 0.0% 0.0% 99.2 76031 163784 102306 29.9% 0.0% 13.3%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.63 42.63 99.15 99.15 1.5568 0.6048 10144192.79 10144192.79 0.00 232252.67 232252.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.63 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.5 70.06% 76030.67 35102 144877 76153.72 62960 95186 5281488 5281488 0.00
crit 29.7 29.94% 163783.85 73139 362235 163849.68 122071 216174 4862705 4862705 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 11704 4.3% 47.0 8.71sec 112154 0 75849 197487 112274 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.99 46.94 0.00 0.00 0.0000 0.0000 5270648.89 5270648.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.88 70.03% 75848.70 35102 144877 75973.18 59997 97824 2493674 2493674 0.00
crit 14.06 29.95% 197487.33 88353 449179 197506.93 119462 278664 2776975 2776975 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 12995 4.8% 95.8 4.45sec 61093 0 40875 108830 61112 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.80 95.78 0.00 0.00 0.0000 0.0000 5852996.81 5852996.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.23 70.20% 40874.70 35102 72438 40899.50 36891 48609 2748051 2748051 0.00
crit 28.53 29.79% 108830.15 88353 224589 108848.74 90750 143507 3104946 3104946 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 434 0.2% 0.9 106.45sec 212297 95732 0 0 0 0.0% 0.0% 0.0% 0.0% 2.9 23477 49756 31033 28.8% 0.0% 0.4%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.93 0.93 2.92 6.39 2.2184 0.6291 198357.33 198357.33 0.00 95732.30 95732.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.93 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.6 71.23% 23477.26 20669 40729 15297.86 0 40729 106895 106895 0.00
crit 1.8 28.76% 49756.01 43064 84862 29567.32 0 84862 91463 91463 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 227 0.1% 3.0 24.19sec 34150 0 23490 60129 34152 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 3.04 0.00 0.00 0.0000 0.0000 103868.15 103868.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.16 70.88% 23489.71 20669 40729 14475.69 0 40729 50637 50637 0.00
crit 0.89 29.11% 60128.99 52023 102515 27899.57 0 102515 53231 53231 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (227) 0.0% (0.1%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 9042 3.4% 192.3 2.31sec 21162 0 21162 0 21162 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.33 192.33 0.00 0.00 0.0000 0.0000 4070084.95 4070084.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 192.33 100.00% 21162.17 8570 412852 21172.41 15353 28544 4070085 4070085 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:81964.77
  • base_dd_max:81964.77
shadow_word_death 9658 3.6% 14.6 5.20sec 296351 285758 219343 474003 296347 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 14.61 0.00 0.00 1.0371 0.0000 4329234.38 4329234.38 0.00 285758.04 285758.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.19 69.73% 219342.60 148912 495364 219467.57 171249 325200 2234497 2234497 0.00
crit 4.42 30.25% 474002.57 310271 1238556 471158.57 0 1172913 2094737 2094737 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 35933 (54744) 13.4% (20.3%) 83.0 5.32sec 296926 286467 0 0 0 0.0% 0.0% 0.0% 0.0% 407.0 29632 64054 39760 29.4% 0.0% 131.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.03 83.03 407.00 407.00 1.0365 1.4516 16182350.91 16182350.91 0.00 36423.45 286467.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.02 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 287.2 70.58% 29631.54 25710 53042 29640.46 27380 32629 8511386 8511386 0.00
crit 119.8 29.42% 64053.78 53569 132622 64057.95 58487 72431 7670965 7670965 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18811 7.0% 193.0 2.30sec 43884 0 29733 77908 43911 29.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 193.03 192.91 0.00 0.00 0.0000 0.0000 8471005.33 8471005.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.09 70.55% 29732.65 25710 53042 29742.17 27548 32222 4046343 4046343 0.00
crit 56.79 29.44% 77908.22 64713 164453 77927.57 69920 90115 4424662 4424662 0.00
miss 0.03 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0486 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6444 2.4% 176.6 2.50sec 16436 0 14890 32291 20074 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.55 144.55 0.00 0.00 0.0000 0.0000 2901713.21 2901713.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.45 70.18% 14889.64 13192 24079 14892.73 13814 16534 1510575 1510575 0.00
crit 43.08 29.80% 32291.47 27487 60206 32293.73 28519 39718 1391139 1391139 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2056 0.8% 30.0 10.60sec 30396 0 20838 50783 30396 31.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.96 29.96 0.00 0.00 0.0000 0.0000 910528.26 910528.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.39 68.05% 20838.06 16220 32221 20924.16 17021 30581 424797 424797 0.00
crit 9.56 31.93% 50782.70 33796 74024 50337.39 33796 74024 485731 485731 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16219.80
  • base_dd_max:16219.80
vampiric_touch 22707 (34541) 8.4% (12.8%) 46.3 9.41sec 335369 320235 0 0 0 0.0% 0.0% 0.0% 0.0% 231.4 32764 71135 44133 29.6% 0.0% 91.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.31 46.31 231.36 231.36 1.0473 1.7910 10210588.97 10210588.97 0.00 33553.49 320235.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.31 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.8 70.37% 32764.11 28140 58980 32773.24 29481 36867 5334459 5334459 0.00
crit 68.5 29.63% 71135.36 58633 147468 71130.48 61364 85486 4876130 4876130 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11834 4.4% 109.7 3.93sec 48480 0 32757 85967 48507 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.74 109.68 0.00 0.00 0.0000 0.0000 5320182.16 5320182.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.19 70.38% 32757.03 28140 58980 32764.21 30045 36395 2528604 2528604 0.00
crit 32.47 29.61% 85967.07 70830 182863 85986.30 73593 104291 2791579 2791579 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 103193 / 8190
melee 102847 3.0% 36.4 10.74sec 100057 113377 73585 173325 100057 30.8% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.38 36.38 0.00 0.00 0.8825 0.0000 3640542.53 3640542.53 0.00 113377.22 113377.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.45 45.22% 73585.26 56165 115903 73767.02 62837 106926 1210783 1210783 0.00
crit 11.20 30.77% 173325.38 127276 278167 172774.67 132162 255244 1940696 1940696 0.00
glance 8.73 23.99% 56030.02 42124 86927 56042.45 0 84092 489064 489064 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0427 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 347 0.0% 8.0 0.73sec 1521 0 1014 2507 1521 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 12165.87 12165.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.28 66.03% 1013.75 852 1366 1023.91 0 1366 5354 5354 0.00
crit 2.72 33.96% 2507.37 2045 3278 2368.72 0 3278 6812 6812 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.9 0.0 31.4sec 31.4sec 24.48% 21.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.2 0.0 151.1sec 151.1sec 13.98% 13.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:13.98%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 419.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.5sec 41.68% 41.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.68%

    Trigger Attempt Success

    • trigger_pct:99.48%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.5 0.0 10.6sec 10.6sec 14.19% 48.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.8 2.4 47.2sec 37.3sec 24.38% 54.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.38%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.1 0.0 62.4sec 62.4sec 15.71% 15.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:15.71%

    Trigger Attempt Success

    • trigger_pct:99.87%
twist_of_fate 1.0 298.6 143.8sec 0.5sec 32.76% 32.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.4sec 74.4sec 83.38% 78.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.16% 73.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.41% 16.41%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 13.9 41.7 3.0 3.0 301119.3
halo Mana 9.8 397028.0 40500.0 40499.9 7.9
mind_blast Mana 36.3 326431.8 9000.0 9000.0 25.6
mind_flay Mana 88.2 264710.9 3000.0 3000.0 64.6
mind_flay_insanity Mana 42.6 127903.6 3000.0 3000.1 120.5
mind_sear Mana 0.9 8407.8 9000.0 8998.7 23.6
shadow_word_death Mana 14.6 113953.0 7800.0 7800.5 38.0
shadow_word_pain Mana 83.0 1095971.7 13200.0 13199.9 22.5
vampiric_touch Mana 46.3 416783.2 9000.0 9000.0 37.3
Resource Gains Type Count Total Average Overflow
dispersion Mana 3.45 62031.43 (2.47%) 17999.53 1.61 0.00%
shadowfiend Mana 36.38 288212.26 (11.49%) 7922.28 39207.38 11.97%
Shadow Orbs from Mind Blast Shadow Orb 36.27 35.50 (82.55%) 0.98 0.77 2.11%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.50 7.50 (17.45%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.60 0.00 (0.00%) 0.00 4164110.34 100.00%
Vampiric Touch Mana Mana 341.04 1634421.04 (65.14%) 4792.42 82795.40 4.82%
halo_heal Health 9.80 0.00 (0.00%) 0.00 3189815.18 100.00%
external_healing Health 86.14 0.00 (0.00%) 0.00 27387586.79 100.00%
mp5_regen Mana 1803.88 524604.07 (20.91%) 290.82 16561.33 3.06%
pet - shadowfiend
external_healing Health 16.32 0.00 (0.00%) 0.00 5258344.08 100.00%
Resource RPS-Gain RPS-Loss
Mana 5562.61 6098.91
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 709623.00 709623.00 709623.00
Mana 59476.06 0.00 255000.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.1%
shadowfiend-Mana Cap 3.1%
mindbender-Mana Cap 3.1%

Procs

Count Interval
Shadowy Recall Extra Tick 511.2 0.9sec
Shadowy Apparition Procced 176.6 2.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 269335.56
Minimum 210521.18
Maximum 313351.36
Spread ( max - min ) 102830.17
Range [ ( max - min ) / 2 * 100% ] 19.09%
Standard Deviation 12531.1987
5th Percentile 247266.89
95th Percentile 288872.79
( 95th Percentile - 5th Percentile ) 41605.89
Mean Distribution
Standard Deviation 79.2669
95.00% Confidence Intervall ( 269180.20 - 269490.92 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8315
0.1 Scale Factor Error with Delta=300 1340506
0.05 Scale Factor Error with Delta=300 5362025
0.01 Scale Factor Error with Delta=300 134050642
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 269335.56
Minimum 210521.18
Maximum 313351.36
Spread ( max - min ) 102830.17
Range [ ( max - min ) / 2 * 100% ] 19.09%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 117544252.16
Minimum 81495442.36
Maximum 157286124.60
Spread ( max - min ) 75790682.24
Range [ ( max - min ) / 2 * 100% ] 32.24%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 7.10 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.57 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 44.10 mind_blast,if=active_enemies<=5&cooldown_react
F 7.50 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 4.63 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 15.11 mind_flay_insanity,interrupt=1,chain=1
I 35.30 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 37.32 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 11.45 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 12.11 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 12.34 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 9.80 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 37.00 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 21.95 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.93 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 33.42 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 36.28 shadow_word_pain,moving=1
a 0.40 dispersion

Sample Sequence

AIPZEJWEWLWEINHZZZZELWEIIIJJJLKENHPZZELWTEWKEJWIIIZEJJJLNHEGPWKWEJWIZZEJNHGEIIIJJJJKEWPZZZZZENHJEWKEWLWAIIEIJJJKPWELWENHIZZZZEJWEIIIJJJKEJPWIZZEJNHWEWLKTEWIIIZZEJJJJPWTEWKWEJNHZZZEWLWEIIIJJJKPELWZZZZZENHJEJWKTEWAIIEIIJJNHEFCPWKWLEDFCHZZZZZEFCLNHEFCIIIJJIEDFCH8PTTTSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEDSSSSSHSSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 343 - 563 ( 451.1 )

Performance:
Total Events Processed: 984056053
Max Event Queue: 261
Sim Seconds: 11277382
CPU Seconds: 2055.1200
Physical Seconds: 263.9010
Speed Up: 5487

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
Standard Deviation 57.1256
5th Percentile 366.15
95th Percentile 540.00
( 95th Percentile - 5th Percentile ) 173.86
Mean Distribution
Standard Deviation 0.3614
95.00% Confidence Intervall ( 450.39 - 451.80 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 616
0.1% Error 61605
0.1 Scale Factor Error with Delta=300 27
0.05 Scale Factor Error with Delta=300 111
0.01 Scale Factor Error with Delta=300 2785
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 5007521 11101 2.65 186355 403369 19.9 19.9 29.9% 0.0% 0.0% 0.0% 22.21sec 5007521 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 4193988 9297 11.94 31427 82212 89.9 89.8 30.1% 0.0% 0.0% 0.0% 4.76sec 4193988 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 7964764 17699 25.26 31210 67411 19.9 189.5 29.9% 0.0% 0.0% 0.0% 22.21sec 7964764 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 9455319 21012 24.16 24482 53394 0.0 181.2 29.8% 0.0% 0.0% 0.0% 0.00sec 9455319 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.47 0 0 11.0 11.0 29.6% 0.0% 0.0% 0.0% 42.45sec 0 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 2640297 5853 1.51 173375 373657 11.0 11.3 29.7% 0.0% 0.0% 0.0% 42.45sec 2640297 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 0 0 15.97 0 0 11.0 120.1 32.6% 0.0% 0.0% 0.0% 42.45sec 37904230 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 11726537 25996 7.25 159811 346156 54.5 54.5 29.7% 0.0% 0.0% 0.0% 8.24sec 11726537 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 10147166 22549 24.79 40126 88024 92.7 185.9 30.2% 0.0% 0.0% 0.0% 4.75sec 10147166 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 5270009 11683 11.72 39914 106072 88.2 88.1 30.1% 0.0% 0.0% 0.0% 4.96sec 5270009 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear ticks -48045 26446 59 0.06 22108 46624 0.2 0.4 28.5% 0.0% 0.0% 0.0% 148.61sec 26446 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_mastery 124469 13897 31 0.06 22109 56200 0.4 0.4 28.9% 0.0% 0.0% 0.0% 11.35sec 13897 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 11035151 24463 8.01 135653 294406 60.2 60.2 30.0% 0.0% 0.0% 0.0% 7.22sec 11035151 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 4393697 9740 26.40 22134 0 198.5 198.5 0.0% 0.0% 0.0% 0.0% 2.25sec 4393697 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 4077773 9040 2.18 184645 398139 16.4 16.4 30.1% 0.0% 0.0% 0.0% 4.65sec 4077773 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 15786008 35080 54.12 28875 62523 73.5 405.9 29.8% 0.0% 0.0% 0.0% 6.10sec 15786008 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 8252314 18294 25.59 28908 75850 192.6 192.4 29.8% 0.0% 0.0% 0.0% 2.32sec 8252314 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.79sec 0 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 2954721 6550 19.19 15130 32895 178.2 144.3 30.1% 0.0% 0.0% 0.0% 2.51sec 2954721 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 782152 1734 3.42 20632 50912 25.7 25.7 32.4% 0.0% 0.0% 0.0% 12.43sec 782152 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 10559539 23466 32.57 31987 69509 48.2 244.3 30.0% 0.0% 0.0% 0.0% 9.25sec 10559539 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 5518945 12235 15.40 32017 84244 115.9 115.8 30.0% 0.0% 0.0% 0.0% 3.81sec 5518945 451.10sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 3600655 101659 61.63 72944 171631 36.4 36.4 30.6% 0.0% 24.0% 0.0% 10.74sec 3600655 35.42sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.37sec 0 35.42sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 12322 348 13.55 1025 2533 8.0 8.0 34.2% 0.0% 0.0% 0.0% 0.73sec 12322 35.42sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 3495849 7750 1.85 186557 403137 13.9 13.9 29.7% 0.0% 0.0% 0.0% 31.93sec 3495849 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 3009541 6672 8.49 31724 82924 64.0 63.9 30.1% 0.0% 0.0% 0.0% 6.60sec 3009541 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 5657300 12572 17.98 31211 67288 13.9 134.8 29.8% 0.0% 0.0% 0.0% 31.93sec 5657300 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 9044782 20100 24.27 24715 54197 0.0 182.0 29.8% 0.0% 0.0% 0.0% 0.00sec 9044782 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 1.47 0 0 11.0 11.0 29.7% 0.0% 0.0% 0.0% 42.49sec 0 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 2698415 5982 1.52 175663 378404 11.0 11.4 29.7% 0.0% 0.0% 0.0% 42.49sec 2698415 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 0 0 16.04 0 0 11.0 120.6 32.6% 0.0% 0.0% 0.0% 42.49sec 37949553 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 7344503 16281 4.76 152994 330123 35.8 35.8 29.5% 0.0% 0.0% 0.0% 12.61sec 7344503 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 11865768 26368 28.48 40762 89754 99.5 213.6 30.2% 0.0% 0.0% 0.0% 4.42sec 11865768 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 6164766 13666 13.47 40562 108182 101.3 101.3 30.0% 0.0% 0.0% 0.0% 4.31sec 6164766 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear ticks -48045 39655 88 0.06 21698 45579 0.2 0.5 28.5% 0.0% 0.0% 0.0% 122.25sec 39655 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_mastery 124469 20225 45 0.09 21686 55113 0.7 0.7 28.1% 0.0% 0.0% 0.0% 9.54sec 20225 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 11862105 26296 8.64 134899 293597 65.0 65.0 30.0% 0.0% 0.0% 0.0% 6.72sec 11862105 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 4204779 9321 26.35 21224 0 198.1 198.1 0.0% 0.0% 0.0% 0.0% 2.25sec 4204779 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.73sec 0 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 4093005 9073 2.19 183659 396255 16.5 16.5 30.3% 0.0% 0.0% 0.0% 4.63sec 4093005 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 16793172 37318 57.09 29123 63140 78.0 428.2 29.7% 0.0% 0.0% 0.0% 5.75sec 16793172 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 8749300 19396 26.99 29073 76428 203.1 202.9 29.7% 0.0% 0.0% 0.0% 2.21sec 8749300 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.81sec 0 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 3101710 6876 20.19 15091 32859 187.3 151.8 30.1% 0.0% 0.0% 0.0% 2.38sec 3101710 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 909767 2017 3.81 21436 53161 28.6 28.6 32.6% 0.0% 0.0% 0.0% 11.07sec 909767 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 11626639 25837 35.41 32385 70471 51.2 265.6 29.9% 0.0% 0.0% 0.0% 8.72sec 11626639 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 6032652 13373 16.74 32208 84875 125.9 125.8 29.9% 0.0% 0.0% 0.0% 3.51sec 6032652 451.10sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 3603090 101740 61.62 72952 171887 36.4 36.4 30.6% 0.0% 24.0% 0.0% 10.74sec 3603090 35.41sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.37sec 0 35.41sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 12287 347 13.55 1023 2527 8.0 8.0 34.1% 0.0% 0.0% 0.0% 0.73sec 12287 35.41sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 3702387 8208 1.85 198055 428140 13.9 13.9 29.7% 0.0% 0.0% 0.0% 32.07sec 3702387 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 3111764 6898 8.29 33593 87723 62.5 62.4 30.1% 0.0% 0.0% 0.0% 6.76sec 3111764 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 5842718 12984 17.55 33039 71136 13.9 131.6 29.8% 0.0% 0.0% 0.0% 32.07sec 5842718 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 9192718 20428 23.54 25691 56170 0.0 176.6 29.8% 0.0% 0.0% 0.0% 0.00sec 9192718 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 1.47 0 0 11.0 11.0 29.7% 0.0% 0.0% 0.0% 42.37sec 0 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 2807650 6224 1.53 181231 391496 11.0 11.5 29.5% 0.0% 0.0% 0.0% 42.37sec 2807650 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 0 0 16.08 0 0 11.0 120.9 32.6% 0.0% 0.0% 0.0% 42.37sec 39807487 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 7646158 16950 4.75 159543 344519 35.7 35.7 29.5% 0.0% 0.0% 0.0% 12.63sec 7646158 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 11684732 25966 27.55 41631 91171 98.8 206.6 30.1% 0.0% 0.0% 0.0% 4.46sec 11684732 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 6078971 13476 13.03 41459 109981 98.0 98.0 30.0% 0.0% 0.0% 0.0% 4.46sec 6078971 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear ticks -48045 58358 130 0.08 22829 48051 0.3 0.6 28.6% 0.0% 0.0% 0.0% 117.95sec 58358 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_mastery 124469 30772 68 0.12 22814 58247 0.9 0.9 28.4% 0.0% 0.0% 0.0% 15.10sec 30772 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 11764884 26081 8.28 139970 303572 62.3 62.3 30.0% 0.0% 0.0% 0.0% 6.99sec 11764884 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 4238936 9397 25.42 22181 0 191.1 191.1 0.0% 0.0% 0.0% 0.0% 2.33sec 4238936 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 4654915 10319 2.19 209282 451826 16.5 16.5 30.3% 0.0% 0.0% 0.0% 4.64sec 4654915 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 16727318 37172 55.13 30060 65055 78.1 413.5 29.7% 0.0% 0.0% 0.0% 5.74sec 16727318 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 8733951 19362 26.06 30098 78948 196.1 195.9 29.6% 0.0% 0.0% 0.0% 2.28sec 8733951 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.81sec 0 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 2988722 6625 19.51 15072 32743 180.9 146.7 30.0% 0.0% 0.0% 0.0% 2.46sec 2988722 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 823665 1826 3.51 21246 52039 26.4 26.4 32.4% 0.0% 0.0% 0.0% 12.07sec 823665 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 11307629 25128 33.59 33250 72176 51.5 251.9 29.9% 0.0% 0.0% 0.0% 8.65sec 11307629 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 5910372 13102 15.89 33308 87475 119.6 119.5 29.9% 0.0% 0.0% 0.0% 3.69sec 5910372 451.10sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 3604916 101788 61.62 73026 171983 36.4 36.4 30.6% 0.0% 24.0% 0.0% 10.74sec 3604916 35.42sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.37sec 0 35.42sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 12282 347 13.55 1023 2532 8.0 8.0 34.0% 0.0% 0.0% 0.0% 0.73sec 12282 35.42sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 4980663 11041 2.65 185890 402136 19.9 19.9 29.7% 0.0% 0.0% 0.0% 22.15sec 4980663 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 4175315 9256 11.92 31368 82060 89.7 89.6 30.1% 0.0% 0.0% 0.0% 4.73sec 4175315 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 7917130 17594 25.24 31096 67105 19.9 189.3 29.8% 0.0% 0.0% 0.0% 22.15sec 7917130 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 9289463 20643 22.97 24413 53161 0.0 172.3 29.8% 0.0% 0.0% 0.0% 0.00sec 9289463 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.47 0 0 11.0 11.0 29.7% 0.0% 0.0% 0.0% 42.43sec 0 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 2782641 6169 1.59 172953 372470 11.0 12.0 29.7% 0.0% 0.0% 0.0% 42.43sec 2782641 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 0 0 16.01 0 0 11.0 120.4 32.7% 0.0% 0.0% 0.0% 42.43sec 37991202 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 12588394 27906 7.25 172179 371883 54.5 54.5 29.5% 0.0% 0.0% 0.0% 8.26sec 12588394 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 14203067 31562 35.02 39867 87230 125.3 262.6 30.0% 0.0% 0.0% 0.0% 3.52sec 14203067 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 7383002 16367 16.56 39711 105220 124.6 124.5 29.9% 0.0% 0.0% 0.0% 3.51sec 7383002 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear ticks -48045 188005 418 0.46 22422 47620 1.2 3.4 29.0% 0.0% 0.0% 0.0% 113.13sec 188005 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_mastery 124469 97495 216 0.40 22417 57431 3.0 3.0 29.1% 0.0% 0.0% 0.0% 33.96sec 97495 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.80sec 0 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 4076795 9038 26.94 20127 0 202.6 202.6 0.0% 0.0% 0.0% 0.0% 2.20sec 4076795 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 4221191 9358 2.16 192689 415370 16.2 16.2 30.2% 0.0% 0.0% 0.0% 4.68sec 4221191 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 15938879 35420 55.08 28696 62074 78.6 413.1 29.6% 0.0% 0.0% 0.0% 5.70sec 15938879 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 8343269 18496 26.05 28779 75449 196.0 195.8 29.6% 0.0% 0.0% 0.0% 2.28sec 8343269 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 2965867 6575 19.42 15030 32646 180.4 146.0 30.0% 0.0% 0.0% 0.0% 2.47sec 2965867 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 842765 1868 3.71 20474 50634 27.9 27.9 32.4% 0.0% 0.0% 0.0% 11.42sec 842765 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 10517710 23373 32.57 31890 69261 48.5 244.3 29.9% 0.0% 0.0% 0.0% 9.19sec 10517710 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 5463664 12112 15.41 31784 83480 115.9 115.8 29.8% 0.0% 0.0% 0.0% 3.80sec 5463664 451.10sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 9653341 82770 60.98 63025 136671 118.5 118.5 30.0% 0.0% 24.0% 0.0% 3.69sec 9653341 116.63sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.63sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 27221 233 10.43 937 2204 20.3 20.3 32.1% 0.0% 0.0% 0.0% 12.56sec 27221 116.63sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 3596586 7973 1.91 186199 403097 14.4 14.4 29.6% 0.0% 0.0% 0.0% 31.21sec 3596586 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3130865 6941 8.85 31662 82916 66.7 66.5 30.0% 0.0% 0.0% 0.0% 6.38sec 3130865 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 5870428 13045 18.72 31118 67155 14.4 140.4 29.6% 0.0% 0.0% 0.0% 31.21sec 5870428 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 8392893 18651 21.95 24586 53923 0.0 164.6 29.7% 0.0% 0.0% 0.0% 0.00sec 8392893 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.42 0 0 10.6 10.6 29.5% 0.0% 0.0% 0.0% 44.09sec 0 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 3615453 8015 2.10 171392 369507 10.6 15.8 29.2% 0.0% 0.0% 0.0% 44.09sec 3615453 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 0 0 15.88 0 0 10.6 119.4 32.5% 0.0% 0.0% 0.0% 44.09sec 37481881 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 8269111 18331 4.92 166850 360405 37.0 37.0 29.2% 0.0% 0.0% 0.0% 12.18sec 8269111 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 16780563 37290 40.67 40470 88866 133.6 305.0 30.1% 0.0% 0.0% 0.0% 3.30sec 16780563 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 8739891 19375 19.24 40336 107417 144.7 144.6 30.0% 0.0% 0.0% 0.0% 3.03sec 8739891 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear ticks -48045 175089 389 0.34 22103 46732 0.9 2.6 28.8% 0.0% 0.0% 0.0% 127.38sec 175089 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_mastery 124469 91037 202 0.38 22102 56444 2.9 2.9 28.4% 0.0% 0.0% 0.0% 35.44sec 91037 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.89sec 0 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 3945321 8746 27.36 19178 0 205.7 205.7 0.0% 0.0% 0.0% 0.0% 2.17sec 3945321 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.84sec 0 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 4260773 9445 2.18 192826 416761 16.4 16.4 30.1% 0.0% 0.0% 0.0% 4.66sec 4260773 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 16918170 37596 58.24 28826 62391 84.5 436.8 29.5% 0.0% 0.0% 0.0% 5.30sec 16918170 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 8831984 19579 27.55 28829 75668 207.3 207.1 29.5% 0.0% 0.0% 0.0% 2.16sec 8831984 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 3108222 6890 20.49 14939 32475 190.0 154.1 29.9% 0.0% 0.0% 0.0% 2.35sec 3108222 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 1057774 2345 4.45 21330 53186 33.4 33.4 32.3% 0.0% 0.0% 0.0% 9.47sec 1057774 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 11518691 25597 35.30 32235 70106 51.3 264.7 29.8% 0.0% 0.0% 0.0% 8.69sec 11518691 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 5934009 13155 16.69 31879 83837 125.6 125.5 29.7% 0.0% 0.0% 0.0% 3.52sec 5934009 451.10sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 9610316 82502 60.98 63002 135882 118.4 118.4 30.0% 0.0% 24.0% 0.0% 3.70sec 9610316 116.49sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.32sec 0 116.49sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 23911 205 9.00 946 2254 17.5 17.5 32.3% 0.0% 0.0% 0.0% 9.78sec 23911 116.49sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 3781015 8382 1.90 196985 426467 14.3 14.3 29.6% 0.0% 0.0% 0.0% 30.73sec 3781015 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3186898 7065 8.53 33488 87605 64.2 64.1 30.0% 0.0% 0.0% 0.0% 6.49sec 3186898 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 5955025 13233 18.05 32788 70647 14.3 135.3 29.6% 0.0% 0.0% 0.0% 30.73sec 5955025 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 8529675 18955 21.35 25647 56091 0.0 160.1 29.7% 0.0% 0.0% 0.0% 0.00sec 8529675 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 1.47 0 0 11.0 11.0 29.5% 0.0% 0.0% 0.0% 42.42sec 0 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 3101935 6876 1.71 179761 387510 11.0 12.9 29.4% 0.0% 0.0% 0.0% 42.42sec 3101935 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 0 0 16.11 0 0 11.0 121.1 32.6% 0.0% 0.0% 0.0% 42.42sec 39798362 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 8506843 18858 4.89 172994 373303 36.8 36.8 29.2% 0.0% 0.0% 0.0% 12.27sec 8506843 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 16030731 35624 38.28 41237 90013 129.4 287.1 29.9% 0.0% 0.0% 0.0% 3.41sec 16030731 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 8342868 18495 18.10 41128 108711 136.1 136.1 29.9% 0.0% 0.0% 0.0% 3.23sec 8342868 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear ticks -48045 355487 790 0.61 22932 48560 1.7 4.6 28.8% 0.0% 0.0% 0.0% 100.27sec 355487 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_mastery 124469 184978 410 0.74 22930 58664 5.6 5.6 28.9% 0.0% 0.0% 0.0% 33.27sec 184978 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.89sec 0 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 3919667 8689 26.12 19962 0 196.4 196.4 0.0% 0.0% 0.0% 0.0% 2.28sec 3919667 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 4861679 10777 2.17 220074 475848 16.3 16.3 30.3% 0.0% 0.0% 0.0% 4.67sec 4861679 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 16874732 37499 56.17 29835 64494 84.3 421.3 29.5% 0.0% 0.0% 0.0% 5.31sec 16874732 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 8841188 19599 26.59 29926 78376 200.0 199.9 29.5% 0.0% 0.0% 0.0% 2.24sec 8841188 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 2989767 6628 19.76 14924 32389 183.3 148.5 29.8% 0.0% 0.0% 0.0% 2.44sec 2989767 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 871853 1933 3.78 20925 51266 28.4 28.4 32.1% 0.0% 0.0% 0.0% 11.19sec 871853 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 11204615 24899 33.46 33115 71844 52.0 250.9 29.8% 0.0% 0.0% 0.0% 8.57sec 11204615 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 5803285 12865 15.82 32980 86426 119.0 118.9 29.6% 0.0% 0.0% 0.0% 3.71sec 5803285 451.10sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 9613481 82528 60.98 63000 135922 118.4 118.4 30.0% 0.0% 24.0% 0.0% 3.70sec 9613481 116.49sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.31sec 0 116.49sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 23895 205 9.01 945 2252 17.5 17.5 32.2% 0.0% 0.0% 0.0% 9.76sec 23895 116.49sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 4860325 10774 2.58 185931 402237 19.4 19.4 29.7% 0.0% 0.0% 0.0% 22.64sec 4860325 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 4072077 9027 11.64 31342 81984 87.6 87.5 30.0% 0.0% 0.0% 0.0% 4.84sec 4072077 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 7716764 17148 24.62 31066 67060 19.4 184.7 29.8% 0.0% 0.0% 0.0% 22.64sec 7716764 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI dispersion 47585 0 0 0.01 0 0 0.1 0.1 0.0% 0.0% 0.0% 0.0% 154.51sec 0 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 9252076 20560 22.88 24398 53143 0.0 171.6 29.8% 0.0% 0.0% 0.0% 0.00sec 9252076 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 1.35 0 0 10.1 10.1 29.5% 0.0% 0.0% 0.0% 45.77sec 0 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 2649630 5874 1.53 172007 368666 10.1 11.5 29.5% 0.0% 0.0% 0.0% 45.77sec 2649630 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 0 0 14.54 0 0 10.1 109.3 32.6% 0.0% 0.0% 0.0% 45.77sec 34359796 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 12248012 27152 7.06 172172 371909 53.0 53.0 29.4% 0.0% 0.0% 0.0% 8.45sec 12248012 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 9239191 20532 22.66 39891 88057 77.2 170.0 30.0% 0.0% 0.0% 0.0% 5.55sec 9239191 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 4817920 10680 10.73 39744 106334 80.7 80.7 30.0% 0.0% 0.0% 0.0% 5.23sec 4817920 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 11774985 26167 16.20 71892 155227 55.1 121.5 30.0% 0.0% 0.0% 0.0% 7.70sec 11774985 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 6091616 13504 7.66 71453 186559 57.7 57.6 29.8% 0.0% 0.0% 0.0% 7.28sec 6091616 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear ticks -48045 112392 250 0.29 22420 47510 0.7 2.2 28.9% 0.0% 0.0% 0.0% 125.53sec 112392 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_mastery 124469 58336 129 0.24 22397 57589 1.8 1.8 29.0% 0.0% 0.0% 0.0% 27.18sec 58336 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 4289615 9509 26.35 21651 0 198.1 198.1 0.0% 0.0% 0.0% 0.0% 2.25sec 4289615 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 4038468 8953 2.08 191837 414416 15.6 15.6 30.1% 0.0% 0.0% 0.0% 4.87sec 4038468 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 15060979 33469 52.17 28642 61952 76.7 391.2 29.6% 0.0% 0.0% 0.0% 5.81sec 15060979 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 7898846 17510 24.67 28749 75398 185.6 185.5 29.7% 0.0% 0.0% 0.0% 2.40sec 7898846 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.78sec 0 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 2833436 6281 18.59 15012 32609 170.7 139.7 29.9% 0.0% 0.0% 0.0% 2.61sec 2833436 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 876184 1942 3.90 20364 50057 29.3 29.3 32.2% 0.0% 0.0% 0.0% 10.87sec 876184 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 9370231 20823 29.08 31814 69178 40.4 218.1 29.8% 0.0% 0.0% 0.0% 10.96sec 9370231 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 4880473 10819 13.75 31780 83615 103.5 103.4 29.8% 0.0% 0.0% 0.0% 4.23sec 4880473 451.10sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 3641633 102798 61.62 73589 173416 36.4 36.4 30.8% 0.0% 24.0% 0.0% 10.74sec 3641633 35.43sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.34sec 0 35.43sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 12218 345 13.55 1018 2517 8.0 8.0 34.0% 0.0% 0.0% 0.0% 0.73sec 12218 35.43sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 3572187 7919 1.90 186180 402198 14.3 14.3 29.6% 0.0% 0.0% 0.0% 31.45sec 3572187 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 3117361 6911 8.83 31642 82677 66.5 66.4 30.1% 0.0% 0.0% 0.0% 6.40sec 3117361 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 5855137 13011 18.70 31112 66978 14.3 140.3 29.6% 0.0% 0.0% 0.0% 31.45sec 5855137 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI dispersion 47585 0 0 0.01 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 8239511 18310 21.85 24583 53946 0.0 163.9 29.7% 0.0% 0.0% 0.0% 0.00sec 8239511 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 1.36 0 0 10.2 10.2 29.4% 0.0% 0.0% 0.0% 45.68sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 3378292 7489 1.97 170586 366764 10.2 14.8 29.1% 0.0% 0.0% 0.0% 45.68sec 3378292 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 0 0 15.12 0 0 10.2 113.7 32.5% 0.0% 0.0% 0.0% 45.68sec 35489770 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 8212905 18207 4.91 166285 358710 36.9 36.9 29.2% 0.0% 0.0% 0.0% 12.21sec 8212905 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 12128239 26952 29.20 40582 89845 92.7 219.0 30.1% 0.0% 0.0% 0.0% 4.65sec 12128239 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 6322910 14017 13.81 40453 108679 103.9 103.8 30.0% 0.0% 0.0% 0.0% 4.10sec 6322910 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 9851423 21892 13.16 74160 159684 43.5 98.7 30.0% 0.0% 0.0% 0.0% 9.82sec 9851423 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 5113357 11335 6.22 73917 192401 46.8 46.8 29.9% 0.0% 0.0% 0.0% 9.01sec 5113357 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear ticks -48045 165594 368 0.41 22237 47119 0.9 3.1 28.7% 0.0% 0.0% 0.0% 118.13sec 165594 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_mastery 124469 86257 191 0.36 22250 56951 2.7 2.7 28.4% 0.0% 0.0% 0.0% 29.60sec 86257 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 4166573 9237 27.20 20376 0 204.5 204.5 0.0% 0.0% 0.0% 0.0% 2.18sec 4166573 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.74sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 4156707 9215 2.12 192775 416986 16.0 16.0 30.2% 0.0% 0.0% 0.0% 4.77sec 4156707 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 16625177 36945 57.25 28807 62396 84.5 429.4 29.5% 0.0% 0.0% 0.0% 5.29sec 16625177 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 8670996 19222 27.08 28785 75608 203.7 203.6 29.5% 0.0% 0.0% 0.0% 2.19sec 8670996 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 3066535 6798 20.24 14922 32454 186.7 152.2 29.8% 0.0% 0.0% 0.0% 2.39sec 3066535 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 1087786 2411 4.62 21173 52615 34.7 34.7 32.2% 0.0% 0.0% 0.0% 9.10sec 1087786 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 10995900 24435 33.81 32126 69907 48.3 253.6 29.8% 0.0% 0.0% 0.0% 9.18sec 10995900 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 5676626 12584 15.98 31846 83824 120.2 120.2 29.6% 0.0% 0.0% 0.0% 3.65sec 5676626 451.10sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 3649178 103055 61.62 73704 173772 36.4 36.4 30.9% 0.0% 24.0% 0.0% 10.74sec 3649178 35.41sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.38sec 0 35.41sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 12139 343 13.55 1014 2506 8.0 8.0 33.8% 0.0% 0.0% 0.0% 0.73sec 12139 35.41sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 3659358 8112 1.85 195705 423426 13.9 13.9 29.6% 0.0% 0.0% 0.0% 31.42sec 3659358 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3113061 6901 8.36 33375 87235 62.9 62.8 30.0% 0.0% 0.0% 0.0% 6.55sec 3113061 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 5793688 12875 17.70 32553 70118 13.9 132.8 29.5% 0.0% 0.0% 0.0% 31.42sec 5793688 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF dispersion 47585 0 0 0.05 0 0 0.4 0.4 0.0% 0.0% 0.0% 0.0% 161.42sec 0 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 8281700 18404 20.98 25586 55997 0.0 157.4 29.6% 0.0% 0.0% 0.0% 0.00sec 8281700 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 1.30 0 0 9.8 9.8 29.4% 0.0% 0.0% 0.0% 46.62sec 0 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 3139716 6960 1.76 176991 381133 9.8 13.3 29.2% 0.0% 0.0% 0.0% 46.62sec 3139716 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 0 0 14.30 0 0 9.8 107.5 32.5% 0.0% 0.0% 0.0% 46.62sec 35055683 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 8346220 18502 4.82 172168 371564 36.3 36.3 29.1% 0.0% 0.0% 0.0% 12.36sec 8346220 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 11244757 24988 26.92 41011 90087 88.2 201.9 29.9% 0.0% 0.0% 0.0% 4.88sec 11244757 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 5852997 12975 12.74 40875 108830 95.8 95.8 29.8% 0.0% 0.0% 0.0% 4.45sec 5852997 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 10144193 22543 13.22 76031 163784 42.6 99.2 29.9% 0.0% 0.0% 0.0% 9.72sec 10144193 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 5270649 11684 6.24 75849 197487 47.0 46.9 30.0% 0.0% 0.0% 0.0% 8.71sec 5270649 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear ticks -48045 198357 441 0.39 23477 49756 0.9 2.9 28.8% 0.0% 0.0% 0.0% 106.45sec 198357 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_mastery 124469 103868 230 0.40 23490 60129 3.0 3.0 29.1% 0.0% 0.0% 0.0% 24.19sec 103868 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 4070085 9023 25.58 21162 0 192.3 192.3 0.0% 0.0% 0.0% 0.0% 2.31sec 4070085 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 4329234 9597 1.94 219343 474003 14.6 14.6 30.3% 0.0% 0.0% 0.0% 5.20sec 4329234 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 16182351 35961 54.27 29632 64054 83.0 407.0 29.4% 0.0% 0.0% 0.0% 5.32sec 16182351 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 8471005 18779 25.66 29733 77908 193.0 192.9 29.4% 0.0% 0.0% 0.0% 2.30sec 8471005 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.82sec 0 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 2901713 6433 19.23 14890 32291 176.6 144.6 29.8% 0.0% 0.0% 0.0% 2.50sec 2901713 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 910528 2018 3.98 20838 50783 30.0 30.0 31.9% 0.0% 0.0% 0.0% 10.60sec 910528 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 10210589 22690 30.85 32764 71135 46.3 231.4 29.6% 0.0% 0.0% 0.0% 9.41sec 10210589 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 5320182 11794 14.59 32757 85967 109.7 109.7 29.6% 0.0% 0.0% 0.0% 3.93sec 5320182 451.10sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 3640543 102761 61.62 73585 173325 36.4 36.4 30.8% 0.0% 24.0% 0.0% 10.74sec 3640543 35.43sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.35sec 0 35.43sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 12166 343 13.55 1014 2507 8.0 8.0 34.0% 0.0% 0.0% 0.0% 0.73sec 12166 35.43sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

DPS Taken Timeline Chart
http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=562|1:|0|&chxp=1,1,-nan,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.40% 8.40%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.48% 8.48%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.65% 10.65%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.65%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.01% 11.01%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.29% 11.29%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.96% 10.96%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.13% 11.13%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.84% 11.84%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.87% 9.87%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.37% 6.37%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.37%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:0.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:0.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:0.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:0.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:0.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals {$m2=100}% weapon damage, absorbs the next ${{$m1=100}/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:0.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:0.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2259467.12
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 451.10
Minimum 342.64
Maximum 562.72
Spread ( max - min ) 220.07
Range [ ( max - min ) / 2 * 100% ] 24.39%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 2263741.56
Minimum 2137409.56
Maximum 2417392.03
Spread ( max - min ) 279982.47
Range [ ( max - min ) / 2 * 100% ] 6.18%
Standard Deviation 36856.1188
5th Percentile 2204217.58
95th Percentile 2325166.77
( 95th Percentile - 5th Percentile ) 120949.18
Mean Distribution
Standard Deviation 233.1359
95.00% Confidence Intervall ( 2263284.63 - 2264198.50 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1018
0.1 Scale Factor Error with Delta=300 11595857
0.05 Scale Factor Error with Delta=300 46383429
0.01 Scale Factor Error with Delta=300 1159585745
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 814302841 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
350816.1 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=562|1:|0|&chxp=1,1,-nan,100 http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.3s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 350816.14
Combat End Resource Mean Min Max
Health 1016490083.17 810887439.38 1219120894.68

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 94.24
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.53%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 350754.28
Minimum 298803.60
Maximum 431328.37
Spread ( max - min ) 132524.77
Range [ ( max - min ) / 2 * 100% ] 18.89%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add2 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
305446.4 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add2 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=562|1:|0|&chxp=1,1,-nan,100 http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add2 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.3s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 305446.45
Combat End Resource Mean Min Max
Health 1016905374.96 811443300.45 1219427197.20

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 24992
Mean 94.24
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.53%
DPS
Sample Data Add2 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add2 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 24992
Mean 305030.91
Minimum 241258.21
Maximum 380820.52
Spread ( max - min ) 139562.31
Range [ ( max - min ) / 2 * 100% ] 22.88%
HPS
Sample Data Add2 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add2 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add3 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
284509.0 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add3 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=562|1:|0|&chxp=1,1,-nan,100 http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add3 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.3s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 284508.98
Combat End Resource Mean Min Max
Health 1017227879.36 810795665.16 1219765507.38

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 24992
Mean 94.24
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.53%
DPS
Sample Data Add3 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add3 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 24992
Mean 284141.17
Minimum 229411.30
Maximum 358399.02
Spread ( max - min ) 128987.72
Range [ ( max - min ) / 2 * 100% ] 22.70%
HPS
Sample Data Add3 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add3 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.