close

SimulationCraft 530-8

for World of Warcraft 5.4.0 PTR (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 flying,first=0,duration=500,cooldown=500
1 position_switch,first=0,duration=500,cooldown=500
2 stun,duration=1.0,first=45.0,period=45.0
3 stun,duration=1.0,first=57.0,period=57.0
4 damage,first=6.0,period=6.0,last=59.5,amount=44000,type=shadow
5 damage,first=60.0,period=5.0,last=119.5,amount=44855,type=shadow
6 damage,first=120.0,period=4.0,last=179.5,amount=44855,type=shadow
7 damage,first=180.0,period=3.0,last=239.5,amount=44855,type=shadow
8 damage,first=240.0,period=2.0,last=299.5,amount=44855,type=shadow
9 damage,first=300.0,period=1.0,amount=44855,type=shadow
10 adds,count=1,first=30,cooldown=60,duration=20
HPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 7.53 - 5.93 - - - 6.80 - 4.79 4.47 4.37 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 7.64 - 6.01 - - - 6.87 - 4.83 4.52 4.48 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 7.45 - 6.00 - - - 7.16 - 4.60 4.57 4.36 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 7.77 - 6.05 - - - 7.22 - 5.04 4.34 5.04 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 7.55 - 5.86 - - - 7.19 - 4.82 3.84 4.80 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 7.68 - 6.20 - - - 7.55 - 4.91 4.60 4.96 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 7.98 - 6.36 - - - 8.69 - 5.12 4.76 5.81 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 7.86 - 6.18 - - - 9.05 - 4.88 5.50 5.55 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 7.79 - 6.23 - - - 8.26 - 4.79 6.04 5.22 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 315938 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
315938.4 315938.4 121.56 / 0.04% 16149 / 5.1% 65.5 8977.2 8977.2 69.71 / 0.78% 9137 / 101.8% 1.9 4693.2 4679.1 Mana 0.63% 48.1 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.53 5.93 6.80 4.79 4.47 4.37
Normalized 1.00 0.79 0.90 0.64 0.59 0.58
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit > Haste ~= Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.53, SpellDamage=5.93, HitRating=6.80, CritRating=4.79, HasteRating=4.47, MasteryRating=4.37 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.53, SpellDamage=5.93, HitRating=0.00, CritRating=4.79, HasteRating=4.47, MasteryRating=4.37 )

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:896697|555232|500441|305226|245729|214225|184990|132354&chds=0,1793394&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++896697++devouring_plague,9482C9,0,0,15|t++555232++shadow_word_pain,9482C9,1,0,15|t++500441++vampiric_touch,9482C9,2,0,15|t++305226++halo,9482C9,3,0,15|t++245729++shadow_word_death,9482C9,4,0,15|t++214225++mind_blast,9482C9,5,0,15|t++184990++mind_spike,4A79D3,6,0,15|t++132354++mind_flay,9482C9,7,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,10,9,9,7,6,6,5,5,5,4,4,4,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,336600&chl=mind_spike|shadow_word_pain|vampiric_touch|mind_blast|mind_flay|devouring_plague_tick|essence_of_yulon|shadow_word_pain_mastery|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadowfiend: melee|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.53,6.80,5.93,4.79,4.47,4.37|7.36,6.62,5.76,4.62,4.30,4.19|7.70,6.98,6.10,4.96,4.64,4.54&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.53++Int,FFFFFF,0,0,15,0.1,e|t++++6.80++Hit,FFFFFF,0,1,15,0.1,e|t++++5.93++SP,FFFFFF,0,2,15,0.1,e|t++++4.79++Crit,FFFFFF,0,3,15,0.1,e|t++++4.47++Haste,FFFFFF,0,4,15,0.1,e|t++++4.37++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.049& http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dhknqsvxz02557787532zxvvtuuuwxxxxxzyxxxxxyyyxwvtrqpnmkhhgfffeeeddddeeddddddddeeedcccccdeefghiijjjkkkklllkkjjihhggfeeeddcdddefeeeeffffffffffggffggijjjkklmmnooopqqpppponnmmkjiiiijjjjjllllllllllmmlkkjihgfeeeffgghiijjklklllkllllkkjihggffedeeeeeeeeedddeeffffggghhhihhhhiijjkmnoppqqqrrsttuuvvwvvuutssrssrrrrrrrrpppoooonnnnmmllkkjjjkllmmnnnnoppqqqqrrrrrqqpomllllligecbZXVTR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6339,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=315938|max=498434&chxp=1,1,63,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,1,5,17,26,33,64,122,189,256,391,541,698,903,1157,1346,1488,1749,1743,1765,1713,1689,1646,1403,1205,1074,911,717,571,406,343,263,171,130,86,53,34,29,15,13,12,3,2,3,1,1,0,0,1&chds=0,1765&chbh=5&chxt=x&chxl=0:|min=278910|avg=315938|max=366243&chxp=0,1,42,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:32.3,17.7,13.3,9.2,8.8,6.0,5.1,2.5,0.8,0.6&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 118.4s|mind_spike 64.7s|mind_blast 48.7s|vampiric_touch 33.7s|shadow_word_pain 32.3s|shadow_word_death 22.0s|devouring_plague 18.7s|halo 9.3s|shadowfiend 3.1s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 315938
devouring_plague 12973 (45717) 4.1% (14.5%) 18.0 19.76sec 930894 896697 196178 423571 264163 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 0.00 0.00 1.0382 0.0000 4748163.43 4748163.43 0.00 896697.17 896697.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.60 70.08% 196178.14 173797 311890 196129.01 173797 231507 2471127 2471127 0.00
crit 5.38 29.91% 423571.38 362119 779817 423086.17 0 649848 2277037 2277037 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 11256 3.6% 84.3 4.05sec 48875 0 33007 86027 48933 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.29 84.19 0.00 0.00 0.0000 0.0000 4119785.76 4119785.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.88 69.94% 33007.19 28967 51982 33010.99 29694 37157 1943447 1943447 0.00
crit 25.30 30.05% 86026.95 72910 161167 85985.98 74042 106884 2176339 2176339 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 21487 6.8% 18.0 19.76sec 437532 0 0 0 0 0.0% 0.0% 0.0% 0.0% 177.7 32881 70837 44254 30.0% 0.0% 29.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 177.71 177.71 0.0000 0.6017 7864419.93 7864419.93 0.00 73544.62 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.5 70.04% 32880.96 28967 93043 32884.79 29782 62993 4092416 4092416 0.00
crit 53.2 29.96% 70836.98 60355 193863 70782.80 61991 130480 3772004 3772004 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19316 6.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 152.7 25905 56082 34949 30.0% 0.0% 33.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.85 152.65 202.29 0.0000 0.7914 7069743.42 7069743.42 0.00 58522.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.6 70.01% 25904.52 22500 41449 25911.07 23727 29218 3668703 3668703 0.00
crit 60.6 29.98% 56082.29 46880 103635 56063.07 49476 65541 3401040 3401040 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7775) 0.0% (2.5%) 9.0 42.79sec 317419 305226 0 0 0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.96 8.96 0.00 0.00 1.0400 0.0000 0.00 0.00 0.00 305226.08 305226.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.27 69.94% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.69 30.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7775 2.5% 9.0 42.79sec 317419 0 181169 386001 242182 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.96 11.75 0.00 0.00 0.0000 0.0000 2845622.78 2845622.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.25 70.19% 181168.91 157064 279122 181194.87 160990 235300 1494152 1494152 0.00
crit 3.50 29.80% 386001.32 327255 697887 379865.52 0 581573 1351471 1351471 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 28518 9.0% 46.9 7.81sec 222361 214225 165221 357039 222363 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.94 46.94 0.00 0.00 1.0380 0.0000 10437457.75 10437457.75 0.00 214224.74 214224.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.94 70.18% 165220.72 139099 401435 165156.44 145124 196585 5442786 5442786 0.00
crit 13.99 29.80% 357038.60 289823 1003706 356966.53 289823 499177 4994671 4994671 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 28175 (42802) 8.9% (13.5%) 83.7 4.31sec 187060 132354 0 0 0 0.0% 0.0% 0.0% 0.0% 179.0 42172 93247 57596 30.2% 0.0% 28.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.75 83.75 179.04 179.04 1.4133 0.5918 10311980.35 10311980.35 0.00 132354.42 132354.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.73 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.0 69.80% 42172.20 36858 66140 42180.01 38626 47540 5270494 5270494 0.00
crit 54.1 30.20% 93246.73 76796 165368 93216.19 81598 111887 5041486 5041486 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 14627 4.6% 84.9 4.18sec 63081 0 41941 112388 63115 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.87 84.82 0.00 0.00 0.0000 0.0000 5353621.38 5353621.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.31 69.92% 41940.56 36858 66140 41946.97 37896 47356 2487425 2487425 0.00
crit 25.50 30.07% 112387.83 92771 205060 112343.29 93754 141460 2866196 2866196 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 32691 10.3% 62.3 5.68sec 192076 184990 142307 308786 192076 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.29 62.29 0.00 0.00 1.0383 0.0000 11964793.51 11964793.51 0.00 184990.16 184990.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.65 70.08% 142307.05 113151 327667 142381.14 123175 167292 6212045 6212045 0.00
crit 18.63 29.91% 308786.46 235760 819264 308875.16 245093 436191 5752749 5752749 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11620 3.7% 175.9 2.05sec 24182 0 24182 0 24182 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.88 175.88 0.00 0.00 0.0000 0.0000 4252977.95 4252977.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.88 100.00% 24181.71 8570 334569 24183.69 17842 34065 4252978 4252978 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:117630.59
  • base_dd_max:117630.59
shadow_word_death 14798 4.7% 21.2 4.73sec 255108 245729 190154 406806 255107 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.23 21.23 0.00 0.00 1.0382 0.0000 5416118.46 5416118.46 0.00 245729.25 245729.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.86 69.99% 190154.45 156358 452288 190227.76 159613 269492 2825532 2825532 0.00
crit 6.37 29.99% 406806.17 325785 942380 406780.26 0 767088 2590586 2590586 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32093 (49009) 10.2% (15.5%) 31.1 11.75sec 576080 555232 0 0 0 0.0% 0.0% 0.0% 0.0% 289.1 30194 65027 40630 30.0% 0.0% 127.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.14 31.14 289.10 289.10 1.0376 1.6112 11746097.02 11746097.02 0.00 36012.24 555232.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.13 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 202.5 70.04% 30194.03 25710 48430 30198.75 28042 33724 6113726 6113726 0.00
crit 86.6 29.96% 65026.67 53569 114733 65001.03 58710 75504 5632371 5632371 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 16916 5.4% 137.2 2.64sec 45135 0 30499 79608 45173 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.17 137.06 0.00 0.00 0.0000 0.0000 6191237.69 6191237.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.07 70.10% 30498.75 26996 48430 30501.04 28277 33678 2930006 2930006 0.00
crit 40.97 29.89% 79608.41 67948 150153 79593.27 70067 90710 3261231 3261231 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6808 2.2% 127.6 2.82sec 19530 0 15831 34266 21383 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.58 116.53 0.00 0.00 0.0000 0.0000 2491697.40 2491697.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.40 69.86% 15830.58 13769 25133 15829.25 14484 17815 1288682 1288682 0.00
crit 35.11 30.13% 34265.67 28689 62840 34252.01 29408 39887 1203015 1203015 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2342 0.7% 25.7 12.45sec 33309 0 22389 55318 33309 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.74 25.74 0.00 0.00 0.0000 0.0000 857289.77 857289.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.20 66.81% 22388.62 17031 31086 22465.20 18146 30961 384995 384995 0.00
crit 8.54 33.17% 55317.86 35485 77725 54979.50 0 77725 472295 472295 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:21791.88
  • base_dd_max:21791.88
vampiric_touch 30152 (46083) 9.5% (14.6%) 32.4 11.20sec 519914 500441 0 0 0 0.0% 0.0% 0.0% 0.0% 246.4 33211 71944 44790 29.9% 0.0% 121.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.44 32.44 246.38 246.38 1.0389 1.8047 11035452.98 11035452.98 0.00 35260.03 500440.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.44 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.7 70.11% 33211.17 28140 53851 33215.78 30729 37562 5736561 5736561 0.00
crit 73.7 29.89% 71944.02 58633 134645 71917.73 64264 82196 5298892 5298892 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15931 5.0% 117.0 3.07sec 49855 0 33590 88109 49896 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.96 116.86 0.00 0.00 0.0000 0.0000 5830898.10 5830898.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.88 70.07% 33589.53 29548 53851 33591.16 30843 37430 2750347 2750347 0.00
crit 34.96 29.92% 88108.96 74371 166962 88101.36 77142 104966 3080551 3080551 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 110518 / 8459
melee 110083 2.7% 30.8 12.66sec 100101 115042 78273 181017 100102 31.1% 7.3% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.81 30.81 0.00 0.00 0.8701 0.0000 3083918.58 3083918.58 0.00 115041.54 115041.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.78 35.00% 78219.98 58973 121698 78425.99 64652 113887 843347 843347 0.00
hit (blocked) 0.83 2.69% 78955.28 58973 121698 44849.17 0 121698 65551 65551 0.00
crit 8.87 28.78% 180867.97 129060 292075 180057.50 133446 292075 1603866 1603866 0.00
crit (blocked) 0.70 2.27% 182899.75 133640 292075 92316.03 0 292075 127982 127982 0.00
glance 6.86 22.25% 59954.72 44230 91273 59940.37 0 91273 411045 411045 0.00
glance (blocked) 0.53 1.72% 60513.53 44230 91273 25033.27 0 91273 32128 32128 0.00
parry 2.24 7.27% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 435 0.0% 7.4 0.78sec 1647 0 1092 2705 1647 34.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.39 7.39 0.00 0.00 0.0000 0.0000 12175.57 12175.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.85 65.56% 1091.64 895 1434 1101.10 0 1434 5291 5291 0.00
crit 2.54 34.42% 2705.29 2147 3442 2534.02 0 3442 6884 6884 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1366.43
  • base_dd_max:1366.43
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_FDCL_DI 8977
halo_heal 8977 100.0% 9.0 42.79sec 366503 0 34094 35370 34518 33.3% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.96 95.20 0.00 0.00 0.0000 0.0000 3285647.22 31032996.36 89.41 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.53 66.74% 34093.70 -0 354441 33886.43 0 138590 2165839 15044685 85.67
crit 31.67 33.26% 35369.59 -0 631260 35153.51 0 176069 1119808 15988311 93.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_FDCL_DI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 19.7 1.6 17.5sec 16.1sec 8.42% 40.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.42%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 18.0 0.0 19.9sec 19.9sec 11.31% 13.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:11.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.0 0.0 129.9sec 129.9sec 16.39% 16.39%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.39%

    Trigger Attempt Success

    • trigger_pct:99.95%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.75% 41.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.75%

    Trigger Attempt Success

    • trigger_pct:99.42%
shadow_word_death_reset_cooldown 10.7 0.0 9.8sec 9.8sec 24.99% 49.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:24.99%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 40.6 32.0 8.8sec 4.9sec 44.77% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.20%
  • surge_of_darkness_2:12.57%

Trigger Attempt Success

  • trigger_pct:19.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 8.1 2.0 46.6sec 36.5sec 24.70% 53.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.70%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 54.1sec 54.0sec 17.81% 17.81%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.81%

    Trigger Attempt Success

    • trigger_pct:99.92%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.77% 0.87%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.77%

Trigger Attempt Success

  • trigger_pct:20.63%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.64% 83.77%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.22% 60.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.56% 20.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 18.0 53.9 3.0 3.0 310326.7
halo Mana 9.0 363077.6 40500.0 40500.1 7.8
mind_blast Mana 46.9 234829.1 5002.8 5002.8 44.4
mind_flay Mana 83.7 251238.8 3000.0 3000.0 62.4
shadow_word_death Mana 21.2 165585.9 7800.0 7799.4 32.7
shadow_word_pain Mana 31.1 411010.0 13200.0 13200.1 43.6
vampiric_touch Mana 32.4 291966.8 9000.0 9000.0 57.8
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 28.57 118169.60 (6.90%) 4136.73 138923.68 54.04%
Shadow Orbs from Mind Blast Shadow Orb 46.93 44.85 (80.77%) 0.96 2.08 4.43%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.68 10.68 (19.23%) 1.00 0.00 0.00%
Devouring Plague Health Health 261.90 2837255.30 (45.62%) 10833.30 2738280.71 49.11%
Vampiric Touch Mana Mana 363.24 1267092.50 (73.99%) 3488.27 561789.58 30.72%
halo_heal Health 8.96 278431.26 (4.48%) 31058.00 2608670.94 90.36%
external_healing Health 70.11 2748448.65 (44.20%) 39203.16 20210785.62 88.03%
mp5_regen Mana 1463.00 327272.59 (19.11%) 223.70 111627.41 25.43%
vampiric_embrace Health 156.33 354648.61 (5.70%) 2268.65 106956.11 23.17%
pet - shadowfiend
external_healing Health 11.34 107914.27 (92.27%) 9515.51 3913433.47 97.32%
vampiric_embrace Health 3.46 9037.26 (7.73%) 2608.37 1838.12 16.90%
Resource RPS-Gain RPS-Loss
Health 16991.21 17490.84
Mana 4679.06 4693.19
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 517332.59 100938.27 709623.00
Mana 294860.72 230700.00 300000.00
Shadow Orb 1.53 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.6%
shadowfiend-Mana Cap 25.6%
mindbender-Mana Cap 25.6%

Procs

Count Interval
Shadowy Recall Extra Tick 422.9 0.9sec
Shadowy Apparition Procced 127.6 2.8sec
Divine Insight Mind Blast CD Reset 35.8 16.1sec
FDCL Mind Spike proc 72.6 4.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 315938.39
Minimum 278909.72
Maximum 366243.10
Spread ( max - min ) 87333.37
Range [ ( max - min ) / 2 * 100% ] 13.82%
Standard Deviation 9804.9244
5th Percentile 300386.62
95th Percentile 332683.85
( 95th Percentile - 5th Percentile ) 32297.23
Mean Distribution
Standard Deviation 62.0217
95.00% Confidence Intervall ( 315816.83 - 316059.95 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3699
0.1 Scale Factor Error with Delta=300 820676
0.05 Scale Factor Error with Delta=300 3282707
0.01 Scale Factor Error with Delta=300 82067682
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 315938.39
Minimum 278909.72
Maximum 366243.10
Spread ( max - min ) 87333.37
Range [ ( max - min ) / 2 * 100% ] 13.82%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 112537357.67
Minimum 99493023.26
Maximum 129961038.67
Spread ( max - min ) 30468015.41
Range [ ( max - min ) / 2 * 100% ] 13.54%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 8977.18
Minimum 0.00
Maximum 34293.48
Spread ( max - min ) 34293.48
Range [ ( max - min ) / 2 * 100% ] 191.00%
Standard Deviation 5623.0776
5th Percentile 2210.08
95th Percentile 20484.93
( 95th Percentile - 5th Percentile ) 18274.86
Mean Distribution
Standard Deviation 35.5692
95.00% Confidence Intervall ( 8907.46 - 9046.89 )
Normalized 95.00% Confidence Intervall ( 99.22% - 100.78% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15071
0.1% Error 1507178
0.1 Scale Factor Error with Delta=300 269917
0.05 Scale Factor Error with Delta=300 1079671
0.01 Scale Factor Error with Delta=300 26991798
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 8977.18
Minimum 0.00
Maximum 34293.48
Spread ( max - min ) 34293.48
Range [ ( max - min ) / 2 * 100% ] 191.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 3285647.22
Minimum 0.00
Maximum 12551415.28
Spread ( max - min ) 12551415.28
Range [ ( max - min ) / 2 * 100% ] 191.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 8270.78
Minimum 3944.54
Maximum 11834.49
Spread ( max - min ) 7889.95
Range [ ( max - min ) / 2 * 100% ] 47.70%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 10.55 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 2.60 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 47.97 mind_blast,if=active_enemies<=5&cooldown_react
F 10.68 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 12.45 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 14.14 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 18.69 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 19.86 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.21 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.38 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 16.90 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.96 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.14 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 15.36 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 45.40 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 49.14 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

AEIJPWEWLKENOUWEUWIJLWEUWEDEIEOPLLKOTENUWKTEWLWEWKWELNUWUPWEWIEJKLUWUENUWUWKLLEKUWTTTTTTEWTTTTTTENULPWKTEWWTTTEWLWTEKNWIEJUWLOUEUWKKLOEOPLUWEANKEUWLWTEUWUOUWUEINLUWUWEIJPUWKWEJUOUUKWENOOUKLWEWTEUWLWKPWENUWUWEIEJJIUWENOUWWKEJOKUUWEPUWFCLNEOUKWFCWENUWLFCOTEUKENI8FCJEOLOUPEDFCUKLKEOUFCJNUWESAFCKW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 316311 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
316310.8 316310.8 117.49 / 0.04% 15586 / 4.9% 63.2 9274.2 9274.2 76.44 / 0.82% 10084 / 108.7% 1.9 4872.4 4858.0 Mana 0.40% 46.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.64 6.01 6.87 4.83 4.52 4.48
Normalized 1.00 0.79 0.90 0.63 0.59 0.59
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.18 0.16 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit > Haste ~= Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.64, SpellDamage=6.01, HitRating=6.87, CritRating=4.83, HasteRating=4.52, MasteryRating=4.48 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.64, SpellDamage=6.01, HitRating=0.00, CritRating=4.83, HasteRating=4.52, MasteryRating=4.48 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:909704|571406|516280|310565|243514|211747|185797|141298&chds=0,1819408&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++909704++devouring_plague,9482C9,0,0,15|t++571406++shadow_word_pain,9482C9,1,0,15|t++516280++vampiric_touch,9482C9,2,0,15|t++310565++halo,9482C9,3,0,15|t++243514++shadow_word_death,9482C9,4,0,15|t++211747++mind_blast,9482C9,5,0,15|t++185797++mind_spike,4A79D3,6,0,15|t++141298++mind_flay,9482C9,7,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,11,10,10,7,6,6,6,5,5,5,4,4,3,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,336600&chl=mind_spike|shadow_word_pain|mind_flay|vampiric_touch|mind_blast|essence_of_yulon|devouring_plague_tick|shadow_word_pain_mastery|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|multistrike_spell|devouring_plague|devouring_plague_mastery|shadowfiend: melee|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.64,6.87,6.01,4.83,4.52,4.48|7.47,6.69,5.85,4.66,4.35,4.32|7.80,7.04,6.18,4.99,4.69,4.65&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.64++Int,FFFFFF,0,0,15,0.1,e|t++++6.87++Hit,FFFFFF,0,1,15,0.1,e|t++++6.01++SP,FFFFFF,0,2,15,0.1,e|t++++4.83++Crit,FFFFFF,0,3,15,0.1,e|t++++4.52++Haste,FFFFFF,0,4,15,0.1,e|t++++4.48++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.174& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dhknqtvxy023567875320wvutsstuvutsssrpoonopqqppomlkjihfdcdccbaZYXWWWXXXXXYYZaababaaZZaaabbccccdddddddeefffeedddcccbbbbaaaaaaaccccdeefffgggggggggggghggggghhiiiijjkjjjjiiihhgfeedddeeddefffffgggghhgffeeddccbbbbccccddeefffgfffggffeedcccbaaZaaaabbbbbbccdeeffgghhhhhhggggghhiijkkkllllmmnnoopppppoonnmmmmmmmmmmmmlkkjjjjjjiiiihhggffeefgghiijijjkkklllllmmmllkjhgggggecaZYWUTRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5671,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=316311|max=557722&chxp=1,1,57,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,3,7,17,22,50,63,113,146,255,289,384,564,651,785,970,1028,1216,1318,1415,1538,1604,1550,1449,1390,1242,1153,1044,908,764,617,559,453,336,268,192,168,142,99,67,52,30,27,19,8,3,3,4,1,2&chds=0,1604&chbh=5&chxt=x&chxl=0:|min=284370|avg=316311|max=356121&chxp=0,1,45,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:34.6,18.6,10.6,9.4,8.9,6.1,4.2,2.6,0.8,0.4&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 126.6s|mind_spike 68.2s|mind_blast 38.8s|vampiric_touch 34.4s|shadow_word_pain 32.6s|shadow_word_death 22.3s|devouring_plague 15.5s|halo 9.4s|shadowfiend 3.1s|waiting 1.5s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 316311
devouring_plague 10808 (38493) 3.4% (12.2%) 14.9 23.91sec 945083 909704 197421 424568 265365 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.91 14.91 0.00 0.00 1.0389 0.0000 3955847.88 3955847.88 0.00 909704.19 909704.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.44 70.06% 197420.62 173797 311890 197393.31 173797 252001 2061757 2061757 0.00
crit 4.46 29.93% 424567.81 362119 738867 422114.60 0 738867 1894091 1894091 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9518 3.0% 71.0 4.78sec 49074 0 33185 86174 49137 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.98 70.89 0.00 0.00 0.0000 0.0000 3483471.79 3483471.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.54 69.87% 33184.70 28967 51982 33190.94 29746 38625 1643826 1643826 0.00
crit 21.35 30.11% 86174.36 72910 152704 86123.61 73618 108144 1839646 1839646 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 18167 5.7% 14.9 23.91sec 446043 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.6 33075 71007 44446 30.0% 0.0% 24.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.91 14.91 149.61 149.61 0.0000 0.5932 6649269.14 6649269.14 0.00 74919.65 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.8 70.02% 33075.05 28967 137324 33082.34 29480 82469 3464950 3464950 0.00
crit 44.8 29.98% 71007.43 60355 286125 70955.76 61239 174989 3184319 3184319 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19957 6.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 157.1 26159 56789 35361 30.1% 0.0% 34.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.83 157.11 206.56 0.0000 0.7910 7304187.49 7304187.49 0.00 58771.55 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.5 69.94% 26158.68 21627 43522 26167.14 23970 29464 3778919 3778919 0.00
crit 62.1 30.05% 56788.51 45062 108817 56776.14 50182 66871 3525269 3525269 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7938) 0.0% (2.5%) 9.0 42.53sec 323068 310565 0 0 0 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 8.99 0.00 0.00 1.0403 0.0000 0.00 0.00 0.00 310564.94 310564.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.28 69.80% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.71 30.18% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7938 2.5% 9.0 42.53sec 323068 0 183073 389978 244638 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 11.88 0.00 0.00 0.0000 0.0000 2905335.03 2905335.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.34 70.22% 183073.25 157064 293078 183103.71 160205 235770 1526620 1526620 0.00
crit 3.54 29.77% 389978.12 327255 610651 383900.50 0 610651 1378715 1378715 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 22445 7.1% 37.4 9.85sec 219857 211747 163208 353173 219855 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.36 37.36 0.00 0.00 1.0383 0.0000 8214943.31 8214943.31 0.00 211747.17 211747.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.21 70.16% 163207.91 139099 401435 163190.50 145323 191801 4278259 4278259 0.00
crit 11.15 29.83% 353173.47 289823 950662 353292.05 289823 570063 3936685 3936685 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 32154 (48879) 10.2% (15.5%) 91.5 3.95sec 195529 141298 0 0 0 0.0% 0.0% 0.0% 0.0% 201.2 42779 94846 58493 30.2% 0.0% 31.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.49 91.49 201.19 201.19 1.3838 0.5638 11768214.34 11768214.34 0.00 141298.38 141298.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.48 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.5 69.82% 42779.32 36858 69446 42786.32 39486 47990 6009203 6009203 0.00
crit 60.7 30.18% 94845.61 76796 173637 94810.41 83893 114422 5759012 5759012 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 16725 5.3% 95.4 3.74sec 64144 0 42576 114444 64189 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.43 95.37 0.00 0.00 0.0000 0.0000 6121432.47 6121432.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.66 69.90% 42575.77 36858 69446 42582.33 38790 48117 2838238 2838238 0.00
crit 28.69 30.08% 114444.31 92771 215313 114394.48 96490 153523 3283195 3283195 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 34641 11.0% 65.7 5.40sec 192863 185797 142671 309837 192862 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.74 65.74 0.00 0.00 1.0380 0.0000 12678446.20 12678446.20 0.00 185797.45 185797.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.98 69.95% 142671.48 113151 327667 142742.53 125700 169897 6560342 6560342 0.00
crit 19.75 30.04% 309836.75 235760 775784 309988.15 244162 422529 6118105 6118105 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11488 3.6% 176.4 2.05sec 23830 0 23830 0 23830 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.44 176.44 0.00 0.00 0.0000 0.0000 4204566.77 4204566.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.44 100.00% 23830.45 8570 314127 23831.37 17503 32719 4204567 4204567 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:29547.51
  • base_dd_max:29547.51
power_infusion 0 0.0% 4.0 120.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 14834 4.7% 21.5 4.68sec 252793 243514 188374 402817 252791 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.48 21.48 0.00 0.00 1.0382 0.0000 5429134.26 5429134.26 0.00 243513.53 243513.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.02 69.93% 188374.29 156358 452288 188397.16 158408 239679 2829170 2829170 0.00
crit 6.45 30.05% 402817.28 325785 942380 402721.25 0 731818 2599964 2599964 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 33346 (50927) 10.5% (16.1%) 31.4 11.65sec 592872 571406 0 0 0 0.0% 0.0% 0.0% 0.0% 297.7 30472 65671 41000 29.9% 0.0% 127.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.44 31.44 297.68 297.68 1.0376 1.5675 12204773.48 12204773.48 0.00 37335.55 571405.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.44 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 208.6 70.09% 30471.65 25710 50852 30475.78 28154 33933 6357487 6357487 0.00
crit 89.0 29.91% 65670.99 53569 114733 65643.20 59237 74975 5847286 5847286 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 17581 5.6% 141.3 2.56sec 45552 0 30761 80398 45597 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.26 141.12 0.00 0.00 0.0000 0.0000 6434479.24 6434479.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.91 70.09% 30760.86 26996 50852 30762.94 28414 33848 3042476 3042476 0.00
crit 42.19 29.90% 80397.78 67948 157661 80384.56 71539 92764 3392004 3392004 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 7037 2.2% 131.2 2.76sec 19627 0 15859 34363 21453 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.23 120.06 0.00 0.00 0.0000 0.0000 2575678.98 2575678.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.73 69.74% 15859.20 13769 25133 15857.11 14414 17588 1327935 1327935 0.00
crit 36.31 30.24% 34362.74 28689 62840 34348.01 30018 41637 1247744 1247744 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2757 0.9% 29.1 10.99sec 34740 0 23261 57856 34741 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.0000 0.0000 1009224.81 1009224.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.40 66.79% 23261.26 17031 32641 23348.99 18765 31408 451325 451325 0.00
crit 9.64 33.19% 57855.85 35485 81611 57485.67 37597 81611 557900 557900 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16219.80
  • base_dd_max:16219.80
vampiric_touch 31741 (48480) 10.0% (15.3%) 33.1 10.97sec 536360 516280 0 0 0 0.0% 0.0% 0.0% 0.0% 256.0 33606 72911 45377 29.9% 0.0% 122.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.08 33.08 256.01 256.01 1.0389 1.7512 11617117.23 11617117.23 0.00 36758.67 516280.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.08 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.3 70.05% 33605.64 28140 56544 33610.37 31105 37627 6026783 6026783 0.00
crit 76.7 29.95% 72910.65 58633 141377 72883.98 63465 84300 5590334 5590334 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 16739 5.3% 121.4 2.97sec 50461 0 33928 89194 50500 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.41 121.32 0.00 0.00 0.0000 0.0000 6126401.53 6126401.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.91 69.99% 33928.17 29548 56544 33930.43 31078 37778 2880740 2880740 0.00
crit 36.39 30.00% 89193.82 74371 175310 89183.33 76917 104832 3245662 3245662 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 110222 / 8435
melee 109788 2.7% 30.8 12.67sec 99947 114879 78188 180731 99946 31.1% 7.3% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.77 30.77 0.00 0.00 0.8700 0.0000 3075077.80 3075077.80 0.00 114878.88 114878.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.74 34.89% 78144.26 58973 121698 78328.49 64785 111733 838948 838948 0.00
hit (blocked) 0.83 2.69% 78756.70 58973 121698 44782.57 0 121698 65110 65110 0.00
crit 8.87 28.83% 180608.71 129060 292075 179829.88 0 292075 1601893 1601893 0.00
crit (blocked) 0.69 2.25% 182293.62 133640 292075 91677.33 0 292075 126185 126185 0.00
glance 6.86 22.29% 59896.77 44230 91273 59869.54 0 91273 410811 410811 0.00
glance (blocked) 0.53 1.74% 60131.37 44230 91273 25134.17 0 91273 32131 32131 0.00
parry 2.25 7.30% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 434 0.0% 7.4 0.78sec 1644 0 1090 2699 1644 34.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.39 7.39 0.00 0.00 0.0000 0.0000 12154.24 12154.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.84 65.51% 1089.75 895 1434 1099.05 0 1434 5276 5276 0.00
crit 2.55 34.48% 2698.71 2147 3442 2528.24 0 3442 6878 6878 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_FDCL_PI 9274
halo_heal 9274 100.0% 9.0 42.53sec 377446 0 35267 36863 35797 33.2% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.99 94.84 0.00 0.00 0.0000 0.0000 3394358.00 30848958.04 89.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.31 66.76% 35266.87 -0 354441 35079.56 0 133800 2232484 14964785 85.13
crit 31.52 33.24% 36862.84 -0 640354 36652.38 0 172581 1161874 15884173 92.68
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_FDCL_PI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.9 0.0 24.1sec 24.1sec 10.06% 11.90%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:10.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.0 0.0 130.7sec 130.7sec 16.35% 16.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.35%

    Trigger Attempt Success

    • trigger_pct:99.96%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.5sec 23.3sec 41.85% 41.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.85%

    Trigger Attempt Success

    • trigger_pct:99.35%
power_infusion 4.0 0.0 120.8sec 120.8sec 17.08% 17.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 10.8 0.0 9.7sec 9.7sec 25.26% 49.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:25.26%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 43.1 32.3 8.3sec 4.7sec 44.15% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.15%
  • surge_of_darkness_2:12.00%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 8.1 2.0 46.6sec 36.6sec 24.68% 44.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.68%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 54.4sec 54.3sec 17.73% 17.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.73%

    Trigger Attempt Success

    • trigger_pct:99.93%
vampiric_embrace 0.3 0.0 0.0sec 0.0sec 1.05% 1.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:1.05%

Trigger Attempt Success

  • trigger_pct:27.51%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.64% 83.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.23% 60.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.57% 20.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 14.9 44.7 3.0 3.0 315069.9
halo Mana 9.0 341473.0 37971.1 37971.2 8.5
mind_blast Mana 37.4 322396.1 8628.3 8628.3 25.5
mind_flay Mana 91.5 260323.4 2845.3 2845.3 68.7
shadow_word_death Mana 21.5 165413.0 7702.7 7702.0 32.8
shadow_word_pain Mana 31.4 403675.4 12839.9 12840.0 46.2
vampiric_touch Mana 33.1 290007.1 8766.4 8766.5 61.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 28.52 111152.34 (6.25%) 3897.75 145501.02 56.69%
Shadow Orbs from Mind Blast Shadow Orb 37.36 35.58 (76.71%) 0.95 1.78 4.76%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.80 10.80 (23.29%) 1.00 0.00 0.00%
Devouring Plague Health Health 220.50 2495666.84 (40.22%) 11318.43 2198399.90 46.83%
Vampiric Touch Mana Mana 377.33 1336692.03 (75.18%) 3542.51 563334.21 29.65%
halo_heal Health 8.99 330143.95 (5.32%) 36711.38 2559077.46 88.57%
external_healing Health 70.08 3017246.53 (48.62%) 43054.46 19942834.71 86.86%
mp5_regen Mana 1463.00 330166.11 (18.57%) 225.68 108733.89 24.77%
vampiric_embrace Health 156.33 362708.24 (5.84%) 2320.20 98896.48 21.42%
pet - shadowfiend
external_healing Health 11.34 108296.36 (92.25%) 9547.69 3911375.12 97.31%
vampiric_embrace Health 3.46 9094.98 (7.75%) 2624.90 1768.37 16.28%
Resource RPS-Gain RPS-Loss
Health 16955.64 17490.84
Mana 4857.95 4872.37
Shadow Orb 0.13 0.12
Combat End Resource Mean Min Max
Health 506118.70 77581.18 709623.00
Mana 294734.33 248820.00 300000.00
Shadow Orb 1.63 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.9%
shadowfiend-Mana Cap 24.9%
mindbender-Mana Cap 24.9%

Procs

Count Interval
Shadowy Recall Extra Tick 428.7 0.8sec
Shadowy Apparition Procced 131.2 2.7sec
FDCL Mind Spike proc 75.4 4.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 316310.81
Minimum 284370.11
Maximum 356120.54
Spread ( max - min ) 71750.43
Range [ ( max - min ) / 2 * 100% ] 11.34%
Standard Deviation 9476.3088
5th Percentile 301277.14
95th Percentile 332448.87
( 95th Percentile - 5th Percentile ) 31171.73
Mean Distribution
Standard Deviation 59.9430
95.00% Confidence Intervall ( 316193.32 - 316428.29 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3447
0.1 Scale Factor Error with Delta=300 766588
0.05 Scale Factor Error with Delta=300 3066352
0.01 Scale Factor Error with Delta=300 76658810
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 316310.81
Minimum 284370.11
Maximum 356120.54
Spread ( max - min ) 71750.43
Range [ ( max - min ) / 2 * 100% ] 11.34%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 112682523.95
Minimum 101209122.23
Maximum 127297828.81
Spread ( max - min ) 26088706.58
Range [ ( max - min ) / 2 * 100% ] 11.58%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 9274.20
Minimum 0.00
Maximum 34583.62
Spread ( max - min ) 34583.62
Range [ ( max - min ) / 2 * 100% ] 186.45%
Standard Deviation 6165.1903
5th Percentile 2069.94
95th Percentile 22237.16
( 95th Percentile - 5th Percentile ) 20167.22
Mean Distribution
Standard Deviation 38.9983
95.00% Confidence Intervall ( 9197.77 - 9350.64 )
Normalized 95.00% Confidence Intervall ( 99.18% - 100.82% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16976
0.1% Error 1697602
0.1 Scale Factor Error with Delta=300 324471
0.05 Scale Factor Error with Delta=300 1297886
0.01 Scale Factor Error with Delta=300 32447156
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 9274.20
Minimum 0.00
Maximum 34583.62
Spread ( max - min ) 34583.62
Range [ ( max - min ) / 2 * 100% ] 186.45%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 3394358.00
Minimum 0.00
Maximum 12657604.39
Spread ( max - min ) 12657604.39
Range [ ( max - min ) / 2 * 100% ] 186.45%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 9146.41
Minimum 4844.51
Maximum 12804.83
Spread ( max - min ) 7960.31
Range [ ( max - min ) / 2 * 100% ] 43.52%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 4.00 power_infusion,if=talent.power_infusion.enabled
C 10.67 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.09 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 39.08 mind_blast,if=active_enemies<=5&cooldown_react
F 10.80 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 12.95 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 14.04 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 18.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 20.72 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.28 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.82 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 16.95 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.99 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.27 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 5.75 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 48.79 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 52.07 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

ABEIJPWUTEWUUWLEKNOUWUWOEUIJLOUWUEIOUWUPLEKJNOUWEIUWLWEOUUWUWEIWLUWENPUWIJUEIJUWUUWEULWKULWKENOUWBWUEULPWKUTEWUWLENOUWKIEJOUWLWEOUUWKKJPELUWEAWKUUELNWUUTEWKLWEOUIJPWENWKLUWLEJIOUUWELWKWBUWENWUWLPEWKOUWEUWLWIJENKUWUWELJLKOUWEKPUWUWLEDFCUWUKTEWFCNLUUTEUWFCUWKEI8DJFCJOPEOUUFCNKKEJLOFCUWENSABFCKU

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 323558 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
323557.7 323557.7 123.20 / 0.04% 16310 / 5.0% 62.4 9474.2 9474.2 77.72 / 0.82% 10219 / 107.9% 1.9 5048.6 5028.5 Mana 0.40% 45.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.45 6.00 7.16 4.60 4.57 4.36
Normalized 1.00 0.81 0.96 0.62 0.61 0.59
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit ~= Haste > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.45, SpellDamage=6.00, HitRating=7.16, CritRating=4.60, HasteRating=4.57, MasteryRating=4.36 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.45, SpellDamage=6.00, HitRating=0.00, CritRating=4.60, HasteRating=4.57, MasteryRating=4.36 )

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:953652|582033|524697|327703|279653|222532|194880|138082&chds=0,1907305&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++953652++devouring_plague,9482C9,0,0,15|t++582033++shadow_word_pain,9482C9,1,0,15|t++524697++vampiric_touch,9482C9,2,0,15|t++327703++halo,9482C9,3,0,15|t++279653++shadow_word_death,9482C9,4,0,15|t++222532++mind_blast,9482C9,5,0,15|t++194880++mind_spike,4A79D3,6,0,15|t++138082++mind_flay,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,11,10,10,7,6,6,6,5,5,5,4,4,3,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,336600&chl=mind_spike|shadow_word_pain|mind_flay|vampiric_touch|mind_blast|essence_of_yulon|devouring_plague_tick|shadow_word_pain_mastery|shadow_word_death|vampiric_touch_mastery|mind_flay_mastery|multistrike_spell|devouring_plague|devouring_plague_mastery|shadowfiend: melee|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.45,7.16,6.00,4.60,4.57,4.36|7.28,6.99,5.83,4.43,4.39,4.19|7.62,7.34,6.17,4.77,4.74,4.54&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.45++Int,FFFFFF,0,0,15,0.1,e|t++++7.16++Hit,FFFFFF,0,1,15,0.1,e|t++++6.00++SP,FFFFFF,0,2,15,0.1,e|t++++4.60++Crit,FFFFFF,0,3,15,0.1,e|t++++4.57++Haste,FFFFFF,0,4,15,0.1,e|t++++4.36++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.950& http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dhknqsvwxz14466875320xwvuuuvxyyxwwwvtttstuwwvvusqponmkhhhggfedbaZZZabbbbbbcddeeeeedddeeffgghhhhhhhhiiijkjiihhhgggffeeddcccccddcdddddeeeeefffgggghijjjkkklmmmmnnoooooonnmmlkjiiiiiijiijkkkkkkkklmmlkkjiihggffgghiiijklmmmnnnnnoooonnmlkkjiihhihiiiihhhhhhijjkkklmmmnnmmmmmnnoqrstuvwvwwxxzz001122100zyyxyyyyxyyyyywvvuuuuttttssrrqppooqqrsstuuuvvwwwxxxxyyxxwvusqqqqpnkigecaYWT&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6636,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=323558|max=487616&chxp=1,1,66,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,2,16,17,21,43,61,100,181,214,322,441,626,771,913,1120,1273,1368,1509,1593,1618,1596,1600,1457,1409,1212,1117,987,766,644,467,382,340,223,164,120,85,73,36,35,25,19,7,6,4,2,2,0,2&chds=0,1618&chbh=5&chxt=x&chxl=0:|min=287296|avg=323558|max=368467&chxp=0,1,45,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:35.2,18.1,10.5,9.3,8.9,6.1,4.2,2.6,0.8,0.4&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 128.9s|mind_spike 66.3s|mind_blast 38.4s|vampiric_touch 34.2s|shadow_word_pain 32.7s|shadow_word_death 22.3s|devouring_plague 15.3s|halo 9.4s|shadowfiend 3.1s|waiting 1.5s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 323558
devouring_plague 11464 (39993) 3.5% (12.4%) 14.8 24.16sec 990441 953652 211394 453576 283895 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.78 14.78 0.00 0.00 1.0386 0.0000 4195646.07 4195646.07 0.00 953652.39 953652.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.35 70.04% 211394.43 173797 358674 211330.55 180314 255476 2188137 2188137 0.00
crit 4.43 29.95% 453576.49 362119 747325 451459.49 0 747325 2007509 2007509 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9852 3.0% 68.5 4.97sec 52627 0 35593 92363 52683 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.52 68.44 0.00 0.00 0.0000 0.0000 3605844.34 3605844.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.82 69.87% 35592.87 28967 59780 35596.81 31405 41165 1702104 1702104 0.00
crit 20.61 30.12% 92362.56 72910 152704 92309.10 75966 115211 1903741 1903741 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 18678 5.8% 14.8 24.16sec 462560 0 0 0 0 0.0% 0.0% 0.0% 0.0% 144.5 35269 75631 47324 29.9% 0.0% 24.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.78 14.78 144.45 144.45 0.0000 0.6086 6836120.18 6836120.18 0.00 77762.71 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.3 70.13% 35268.56 28967 131114 35273.12 31674 60311 3572920 3572920 0.00
crit 43.1 29.87% 75631.13 60355 273187 75571.95 65125 127335 3263200 3263200 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20434 6.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 152.2 27499 59460 37077 30.0% 0.0% 32.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.66 152.15 201.71 0.0000 0.7919 7478728.74 7478728.74 0.00 62065.68 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.2 70.01% 27499.06 22500 47667 27502.88 25040 31036 3883572 3883572 0.00
crit 60.5 29.98% 59459.76 46880 103635 59433.22 52151 71500 3595156 3595156 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8374) 0.0% (2.6%) 9.0 42.48sec 340872 327703 0 0 0 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 8.99 0.00 0.00 1.0402 0.0000 0.00 0.00 0.00 327703.10 327703.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.28 69.85% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.71 30.13% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8374 2.6% 9.0 42.48sec 340872 0 192496 410170 257408 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 11.91 0.00 0.00 0.0000 0.0000 3065007.12 3065007.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.35 70.16% 192496.10 157064 320990 192559.85 160990 252575 1608199 1608199 0.00
crit 3.55 29.83% 410170.49 327255 668808 404266.67 0 668808 1456808 1456808 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 23335 7.2% 37.0 9.96sec 231136 222532 171756 371154 231131 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.95 36.95 0.00 0.00 1.0387 0.0000 8540560.98 8540560.98 0.00 222532.14 222532.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.94 70.19% 171756.07 139099 461650 171738.11 152423 204671 4454888 4454888 0.00
crit 11.01 29.79% 371154.37 289823 961885 371304.85 289823 648918 4085673 4085673 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 32006 (48629) 9.9% (15.0%) 90.7 3.98sec 196251 138082 0 0 0 0.0% 0.0% 0.0% 0.0% 195.7 43922 96781 59850 30.1% 0.0% 31.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.69 90.69 195.72 195.72 1.4213 0.5919 11714173.41 11714173.41 0.00 138082.28 138082.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.68 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.7 69.87% 43922.46 36858 76060 43927.12 40287 48302 6006323 6006323 0.00
crit 59.0 30.13% 96781.49 76796 165368 96754.83 85281 115395 5707850 5707850 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 16623 5.1% 92.8 3.83sec 65582 0 43723 116699 65619 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.77 92.72 0.00 0.00 0.0000 0.0000 6084080.63 6084080.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.88 69.97% 43723.14 36858 76060 43726.62 39430 49143 2836648 2836648 0.00
crit 27.83 30.01% 116699.45 92771 205060 116671.62 100157 144076 3247433 3247433 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 35287 10.9% 63.8 5.56sec 202286 194880 149961 324837 202286 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.85 63.85 0.00 0.00 1.0380 0.0000 12915093.03 12915093.03 0.00 194880.09 194880.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.72 70.05% 149960.50 113151 376817 150050.17 129108 178513 6706813 6706813 0.00
crit 19.11 29.93% 324836.91 235760 785128 324949.84 254851 429158 6208280 6208280 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11830 3.7% 171.7 2.11sec 25221 0 25221 0 25221 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 171.67 171.67 0.00 0.00 0.0000 0.0000 4329801.51 4329801.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.67 100.00% 25220.72 8570 361246 25221.31 18548 36868 4329802 4329802 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:73645.77
  • base_dd_max:73645.77
shadow_word_death 17015 5.3% 21.5 4.68sec 290303 279653 216149 462644 290307 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.45 21.45 0.00 0.00 1.0381 0.0000 6227309.15 6227309.15 0.00 279652.83 279652.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.99 69.89% 216148.68 179812 520132 216198.60 182273 275872 3240483 3240483 0.00
crit 6.46 30.10% 462644.13 374653 1083737 462611.66 0 855190 2986826 2986826 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 33976 (51955) 10.5% (16.1%) 31.5 11.67sec 603821 582033 0 0 0 0.0% 0.0% 0.0% 0.0% 289.8 31906 68646 42906 29.9% 0.0% 127.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.49 31.49 289.83 289.83 1.0375 1.6101 12435246.36 12435246.36 0.00 38082.94 582033.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.49 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 203.1 70.06% 31906.42 25710 55695 31911.32 29409 35498 6478898 6478898 0.00
crit 86.8 29.94% 68645.81 53569 121089 68615.58 61430 78697 5956348 5956348 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 17979 5.6% 137.5 2.63sec 47871 0 32379 84375 47919 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.46 137.32 0.00 0.00 0.0000 0.0000 6580365.80 6580365.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.25 70.09% 32378.96 26996 55695 32382.44 29877 36067 3116323 3116323 0.00
crit 41.05 29.90% 84375.20 67948 150153 84358.44 74721 101938 3464043 3464043 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6811 2.1% 127.8 2.82sec 19502 0 15820 34258 21375 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.82 116.62 0.00 0.00 0.0000 0.0000 2492796.21 2492796.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.45 69.85% 15820.16 13769 25133 15817.90 14532 17519 1288607 1288607 0.00
crit 35.15 30.14% 34257.59 28689 62840 34240.09 29899 40132 1204190 1204190 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2475 0.8% 26.3 12.21sec 34482 0 23306 57059 34482 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.27 26.27 0.00 0.00 0.0000 0.0000 905873.63 905873.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.57 66.87% 23306.00 18697 35749 23393.35 19259 32388 409420 409420 0.00
crit 8.70 33.12% 57059.34 40808 77725 56698.36 40808 77725 496454 496454 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:22446.36
  • base_dd_max:22446.36
vampiric_touch 31982 (48989) 9.9% (15.1%) 32.9 11.03sec 545170 524697 0 0 0 0.0% 0.0% 0.0% 0.0% 248.0 35029 75753 47197 29.9% 0.0% 122.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.89 32.89 248.01 248.01 1.0390 1.8055 11705363.15 11705363.15 0.00 37203.41 524697.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.89 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.9 70.12% 35028.52 28140 61929 35033.05 32027 39878 6091522 6091522 0.00
crit 74.1 29.88% 75753.16 58633 134645 75726.07 67716 86430 5613841 5613841 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 17007 5.3% 117.7 3.06sec 52893 0 35640 93341 52937 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.68 117.58 0.00 0.00 0.0000 0.0000 6224598.44 6224598.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.31 70.00% 35640.03 29548 61929 35642.35 32604 39862 2933502 2933502 0.00
crit 35.26 29.99% 93340.76 74371 166962 93325.11 80953 111063 3291097 3291097 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 110132 / 8430
melee 109702 2.6% 30.8 12.67sec 99856 114771 78146 180376 99856 31.1% 7.3% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.78 30.78 0.00 0.00 0.8701 0.0000 3073463.71 3073463.71 0.00 114771.41 114771.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.75 34.94% 78104.77 58973 121698 78301.44 63396 113184 839975 839975 0.00
hit (blocked) 0.83 2.69% 78681.69 58973 121698 44886.81 0 121698 65214 65214 0.00
crit 8.88 28.84% 180241.58 129060 292075 179525.82 0 292075 1599789 1599789 0.00
crit (blocked) 0.69 2.24% 182104.26 133640 292075 91356.28 0 292075 125606 125606 0.00
glance 6.86 22.28% 59840.07 44230 91273 59802.11 0 91273 410414 410414 0.00
glance (blocked) 0.54 1.75% 60357.99 44230 91273 25208.36 0 91273 32466 32466 0.00
parry 2.23 7.24% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 431 0.0% 7.4 0.78sec 1629 0 1083 2681 1629 34.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.40 7.40 0.00 0.00 0.0000 0.0000 12059.03 12059.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.87 65.78% 1082.53 895 1434 1092.23 0 1434 5271 5271 0.00
crit 2.53 34.21% 2680.88 2147 3442 2503.00 0 3442 6788 6788 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_FDCL_ToF 9474
halo_heal 9474 100.0% 9.0 42.48sec 385641 0 36300 37026 36541 33.2% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.99 94.89 0.00 0.00 0.0000 0.0000 3467560.23 32562034.79 89.35 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.35 66.76% 36300.14 -0 407607 36120.68 0 141815 2299750 15802388 85.49
crit 31.54 33.24% 37025.75 -0 687647 36838.82 0 179499 1167810 16759647 93.03
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_FDCL_ToF
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.99%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.8 0.0 24.3sec 24.3sec 10.22% 12.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:10.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.0 0.0 131.2sec 131.2sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.34%

    Trigger Attempt Success

    • trigger_pct:99.95%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.89% 41.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.89%

    Trigger Attempt Success

    • trigger_pct:99.41%
shadow_word_death_reset_cooldown 10.8 0.0 9.7sec 9.7sec 25.25% 49.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:25.25%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 42.4 30.7 8.4sec 4.9sec 43.09% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:31.61%
  • surge_of_darkness_2:11.48%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 8.1 2.0 46.8sec 36.7sec 24.61% 53.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.61%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.5 0.0 54.6sec 54.4sec 17.66% 17.66%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.66%

    Trigger Attempt Success

    • trigger_pct:99.91%
twist_of_fate 1.0 345.8 76.5sec 0.4sec 41.72% 41.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:41.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.3 0.0 0.0sec 0.0sec 1.03% 1.15%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:1.03%

Trigger Attempt Success

  • trigger_pct:27.12%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.64% 83.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.18% 60.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.56% 20.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 14.8 44.3 3.0 3.0 330181.9
halo Mana 9.0 364163.0 40500.0 40500.0 8.4
mind_blast Mana 37.0 332552.2 9000.0 9000.0 25.7
mind_flay Mana 90.7 272078.9 3000.0 3000.1 65.4
shadow_word_death Mana 21.4 167304.7 7800.0 7799.4 37.2
shadow_word_pain Mana 31.5 415699.2 13200.0 13200.1 45.7
vampiric_touch Mana 32.9 295999.6 9000.0 9000.0 60.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 28.55 125787.88 (6.83%) 4406.61 131119.28 51.04%
Shadow Orbs from Mind Blast Shadow Orb 36.94 35.17 (76.53%) 0.95 1.77 4.79%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.79 10.79 (23.47%) 1.00 0.00 0.00%
Devouring Plague Health Health 212.89 2429094.54 (39.17%) 11409.88 2103137.27 46.40%
Vampiric Touch Mana Mana 365.59 1368923.00 (74.38%) 3744.40 471877.96 25.63%
halo_heal Health 8.99 349036.69 (5.63%) 38817.74 2719069.08 88.62%
external_healing Health 70.08 3061003.55 (49.36%) 43678.06 19720153.90 86.56%
mp5_regen Mana 1463.00 345726.25 (18.79%) 236.31 93173.75 21.23%
vampiric_embrace Health 156.33 362860.42 (5.85%) 2321.18 98744.30 21.39%
pet - shadowfiend
external_healing Health 11.34 108319.51 (92.25%) 9550.10 3908631.98 97.30%
vampiric_embrace Health 3.47 9102.98 (7.75%) 2625.03 1772.92 16.30%
Resource RPS-Gain RPS-Loss
Health 16945.34 17490.84
Mana 5028.52 5048.63
Shadow Orb 0.13 0.12
Combat End Resource Mean Min Max
Health 502038.26 36244.84 709623.00
Mana 292523.34 234600.00 300000.00
Shadow Orb 1.61 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.4%
shadowfiend-Mana Cap 21.4%
mindbender-Mana Cap 21.4%

Procs

Count Interval
Shadowy Recall Extra Tick 416.1 0.9sec
Shadowy Apparition Procced 127.8 2.8sec
FDCL Mind Spike proc 73.1 4.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 323557.74
Minimum 287295.52
Maximum 368467.16
Spread ( max - min ) 81171.64
Range [ ( max - min ) / 2 * 100% ] 12.54%
Standard Deviation 9937.2861
5th Percentile 307814.75
95th Percentile 340434.65
( 95th Percentile - 5th Percentile ) 32619.90
Mean Distribution
Standard Deviation 62.8590
95.00% Confidence Intervall ( 323434.53 - 323680.94 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3623
0.1 Scale Factor Error with Delta=300 842983
0.05 Scale Factor Error with Delta=300 3371935
0.01 Scale Factor Error with Delta=300 84298385
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 323557.74
Minimum 287295.52
Maximum 368467.16
Spread ( max - min ) 81171.64
Range [ ( max - min ) / 2 * 100% ] 12.54%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 115336608.72
Minimum 101355809.73
Maximum 130838162.01
Spread ( max - min ) 29482352.28
Range [ ( max - min ) / 2 * 100% ] 12.78%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 9474.21
Minimum 0.00
Maximum 36561.44
Spread ( max - min ) 36561.44
Range [ ( max - min ) / 2 * 100% ] 192.95%
Standard Deviation 6268.8749
5th Percentile 2168.93
95th Percentile 22606.80
( 95th Percentile - 5th Percentile ) 20437.87
Mean Distribution
Standard Deviation 39.6542
95.00% Confidence Intervall ( 9396.49 - 9551.93 )
Normalized 95.00% Confidence Intervall ( 99.18% - 100.82% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16818
0.1% Error 1681858
0.1 Scale Factor Error with Delta=300 335477
0.05 Scale Factor Error with Delta=300 1341908
0.01 Scale Factor Error with Delta=300 33547709
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 9474.21
Minimum 0.00
Maximum 36561.44
Spread ( max - min ) 36561.44
Range [ ( max - min ) / 2 * 100% ] 192.95%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 3467560.23
Minimum 0.00
Maximum 13381488.48
Spread ( max - min ) 13381488.48
Range [ ( max - min ) / 2 * 100% ] 192.95%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 9317.61
Minimum 4707.82
Maximum 12631.34
Spread ( max - min ) 7923.53
Range [ ( max - min ) / 2 * 100% ] 42.52%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 10.66 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.10 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 39.01 mind_blast,if=active_enemies<=5&cooldown_react
F 10.79 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 12.47 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 13.73 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 19.02 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 20.86 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.27 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.68 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 16.16 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.99 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.23 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 6.05 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 47.68 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 51.59 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

AEIJPWOEUWUWLKENWOUWEIJLWKEUWUWPLEKJNOUWEIUUWLEWEKWLWTENPUWIJEILUWUWUEWULKOUKLENUWTEWPWKJTEUWWTENUWLWKUEIJUUWELUUWKLKENOPUWLUEWAWKWEUWLUWENUWKWEWLIJPWEWKOOLUEJINUWTEWKWLUWEWUWELKNPUWUTEWUWIEJJKUWUENWOKLJTEUKWUWPEWFCLNWEKFCUWWEDFCJWKESF8CIJMNUWELFCPUWKEDFCOUWLWEOFCANKU

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 319629 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
319629.2 319629.2 123.15 / 0.04% 16344 / 5.1% 59.7 8774.0 8774.0 72.28 / 0.82% 9565 / 109.0% 1.8 5003.8 4970.4 Mana 0.52% 39.9 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.77 6.05 7.22 5.04 4.34 5.04
Normalized 1.00 0.78 0.93 0.65 0.56 0.65
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.18 0.17
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit ~= Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.77, SpellDamage=6.05, HitRating=7.22, CritRating=5.04, HasteRating=4.34, MasteryRating=5.04 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.77, SpellDamage=6.05, HitRating=0.00, CritRating=5.04, HasteRating=4.34, MasteryRating=5.04 )

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:896613|554616|500358|310556|260471|235260|134030&chds=0,1793225&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++896613++devouring_plague,9482C9,0,0,15|t++554616++shadow_word_pain,9482C9,1,0,15|t++500358++vampiric_touch,9482C9,2,0,15|t++310556++halo,9482C9,3,0,15|t++260471++shadow_word_death,9482C9,4,0,15|t++235260++mind_blast,9482C9,5,0,15|t++134030++mind_flay,9482C9,6,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,11,10,10,7,7,7,6,6,5,5,4,4,4,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,C79C6E,336600,336600&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|mind_flay_mastery|devouring_plague_tick|mindbender: melee|essence_of_yulon|shadow_word_pain_mastery|vampiric_touch_mastery|shadow_word_death|devouring_plague|devouring_plague_mastery|multistrike_spell|halo_damage|shadowy_apparition|stormlash|mindbender: stormlash& DPS Taken Timeline Chart
http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.77,7.22,6.05,5.04,5.04,4.34|7.60,7.04,5.88,4.86,4.86,4.16|7.94,7.40,6.22,5.21,5.21,4.52&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.77++Int,FFFFFF,0,0,15,0.1,e|t++++7.22++Hit,FFFFFF,0,1,15,0.1,e|t++++6.05++SP,FFFFFF,0,2,15,0.1,e|t++++5.04++Crit,FFFFFF,0,3,15,0.1,e|t++++5.04++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.34++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.336& http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bfjnrtwyz135577875320xvtrrrstuuvvvxwvwwwwwwwvutsqpomlkihhghghhiiiiijjjijiihhhhggedccbccddefgghhiiiiijjjjiihhggfeeeededeeefghiiiiiiiiiihhgggfffeeefggghhiijkkllmmmmmmllkkjjihgffffggghijjkkllllmmmmllkjiihggggggghhiijjkkkkkkkkkkjjihgffeddcddeffgghhhhiijjjkkklkkkkkiiihhhhhijkklmnmnnoopqqqrrrrrrrqqpopqqqrrsttuttttttsssssrqponmlkkllllmnnnnoppqqqqqrrrqqpoomlllkjgecaZXVUSQ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6307,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=319629|max=506799&chxp=1,1,63,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,2,5,17,19,40,59,101,141,210,298,400,501,691,832,1013,1122,1292,1472,1536,1617,1625,1595,1512,1446,1299,1158,1014,847,725,573,464,354,244,214,138,143,82,63,44,23,24,15,9,4,2,2,1,2&chds=0,1625&chbh=5&chxt=x&chxl=0:|min=283085|avg=319629|max=363030&chxp=0,1,46,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:48.8,13.2,9.2,8.8,5.9,5.1,2.6,2.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 178.5s|mind_blast 48.4s|vampiric_touch 33.5s|shadow_word_pain 32.1s|shadow_word_death 21.6s|devouring_plague 18.5s|halo 9.4s|mindbender 7.2s|waiting 1.9s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 319629
devouring_plague 12851 (45372) 4.0% (14.2%) 17.8 19.93sec 930804 896613 195977 422713 263640 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 0.00 0.00 1.0382 0.0000 4703498.54 4703498.54 0.00 896612.72 896612.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.51 70.13% 195977.46 173797 311890 195938.46 174547 237830 2452037 2452037 0.00
crit 5.33 29.85% 422712.55 362119 779817 422365.76 0 779817 2251461 2251461 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 11200 3.5% 83.8 4.09sec 48910 0 33005 86080 48964 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.81 83.72 0.00 0.00 0.0000 0.0000 4099306.69 4099306.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.52 69.90% 33005.47 28967 51982 33009.35 29588 37406 1931589 1931589 0.00
crit 25.18 30.08% 86080.05 72910 161167 86032.46 73449 111976 2167718 2167718 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 21321 6.7% 17.8 19.93sec 437392 0 0 0 0 0.0% 0.0% 0.0% 0.0% 176.8 32817 70628 44127 29.9% 0.0% 29.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 176.84 176.84 0.0000 0.6018 7803358.99 7803358.99 0.00 73322.61 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.9 70.09% 32816.89 28967 88175 32819.45 29551 63259 4067517 4067517 0.00
crit 52.9 29.91% 70627.77 60355 193696 70569.47 61654 129724 3735842 3735842 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18848 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.2 25819 55820 34796 29.9% 0.0% 32.4%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.67 149.19 198.26 0.0000 0.7944 6898467.61 6898467.61 0.00 58204.60 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.9 70.06% 25818.76 21627 41449 25825.00 23688 29263 3585972 3585972 0.00
crit 59.3 29.93% 55819.90 46880 103635 55802.93 49150 65469 3312496 3312496 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7939) 0.0% (2.5%) 9.0 42.42sec 322955 310556 0 0 0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.0400 0.0000 0.00 0.00 0.00 310555.68 310555.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.30 70.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.70 29.96% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7939 2.5% 9.0 42.42sec 322955 0 181259 386507 242487 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 11.98 0.00 0.00 0.0000 0.0000 2905558.90 2905558.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.41 70.15% 181258.55 157064 279122 181271.64 157064 231628 1523623 1523623 0.00
crit 3.58 29.84% 386506.99 327255 697887 380130.67 0 697887 1381936 1381936 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 31092 9.7% 46.6 7.87sec 244201 235260 181922 392398 244201 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.60 46.60 0.00 0.00 1.0380 0.0000 11379541.87 11379541.87 0.00 235260.32 235260.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.80 70.39% 181922.37 139099 401435 181883.00 153997 214987 5966855 5966855 0.00
crit 13.79 29.60% 392397.53 289823 1003706 392406.63 296123 534012 5412687 5412687 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 43001 (65361) 13.5% (20.4%) 124.5 2.91sec 192213 134030 0 0 0 0.0% 0.0% 0.0% 0.0% 275.9 41932 92252 57046 30.0% 0.0% 44.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.46 124.46 275.89 275.89 1.4341 0.5914 15738502.55 15738502.55 0.00 134029.72 134029.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.44 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 193.0 69.96% 41931.55 36858 66140 41935.92 39154 45775 8093863 8093863 0.00
crit 82.9 30.04% 92252.16 76796 165368 92235.42 83406 104639 7644640 7644640 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 22359 7.0% 130.9 2.76sec 62541 0 41767 111276 62565 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.85 130.80 0.00 0.00 0.0000 0.0000 8183523.18 8183523.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.63 70.05% 41766.77 36858 66140 41769.80 38654 45662 3827177 3827177 0.00
crit 39.15 29.93% 111275.86 92771 205060 111252.82 97291 134084 4356346 4356346 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10785 3.4% 181.3 2.00sec 21777 0 21777 0 21777 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.26 181.26 0.00 0.00 0.0000 0.0000 3947298.32 3947298.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.26 100.00% 21777.22 8570 334569 21779.22 15968 30697 3947298 3947298 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:26995.70
  • base_dd_max:26995.70
shadow_word_death 15349 4.8% 20.8 4.78sec 270415 260471 201567 430794 270416 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.77 20.77 0.00 0.00 1.0382 0.0000 5617575.22 5617575.22 0.00 260470.87 260470.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.53 69.94% 201566.87 156358 452288 201623.63 162038 259348 2928507 2928507 0.00
crit 6.24 30.05% 430794.10 325785 942380 430681.03 0 921795 2689068 2689068 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31861 (48674) 10.0% (15.2%) 31.0 11.76sec 575520 554616 0 0 0 0.0% 0.0% 0.0% 0.0% 288.7 30063 64701 40399 29.8% 0.0% 127.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.95 30.95 288.65 288.65 1.0377 1.6121 11661096.48 11661096.48 0.00 35811.23 554616.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.95 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 202.5 70.16% 30062.84 25710 48430 30067.44 27947 33800 6088298 6088298 0.00
crit 86.1 29.84% 64700.70 53569 114733 64672.04 58136 73654 5572799 5572799 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 16813 5.3% 137.0 2.64sec 44915 0 30394 79244 44955 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.01 136.89 0.00 0.00 0.0000 0.0000 6153735.38 6153735.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.05 70.17% 30394.41 26996 48430 30396.97 28021 33565 2919453 2919453 0.00
crit 40.81 29.82% 79244.47 67948 150153 79229.82 70740 91493 3234283 3234283 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 6738 2.1% 126.9 2.84sec 19427 0 15755 34097 21268 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.95 115.95 0.00 0.00 0.0000 0.0000 2466183.16 2466183.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.07 69.92% 15755.41 13769 25133 15753.45 14303 17680 1277328 1277328 0.00
crit 34.87 30.07% 34096.94 28689 62840 34082.65 29593 40120 1188855 1188855 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2632 0.8% 29.0 11.01sec 33190 0 22303 55156 33191 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.02 29.02 0.00 0.00 0.0000 0.0000 963276.47 963276.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.40 66.84% 22303.17 17031 31086 22393.98 18208 30942 432635 432635 0.00
crit 9.62 33.15% 55156.40 35485 77725 54746.40 0 77725 530641 530641 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:22446.36
  • base_dd_max:22446.36
vampiric_touch 30045 (45858) 9.4% (14.3%) 32.3 11.28sec 519972 500358 0 0 0 0.0% 0.0% 0.0% 0.0% 245.9 33167 71828 44712 29.9% 0.0% 121.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.28 32.28 245.94 245.94 1.0392 1.8047 10996585.58 10996585.58 0.00 35157.57 500358.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.27 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.5 70.14% 33167.11 28140 53851 33171.70 30413 36847 5721326 5721326 0.00
crit 73.4 29.86% 71827.58 58633 134645 71802.07 63726 84350 5275259 5275259 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15813 4.9% 116.7 3.08sec 49599 0 33463 87714 49642 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.69 116.58 0.00 0.00 0.0000 0.0000 5787426.17 5787426.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.79 70.15% 33462.89 29548 53851 33464.21 30827 36827 2736844 2736844 0.00
crit 34.78 29.83% 87714.44 74371 166962 87701.66 77178 102201 3050583 3050583 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 84004 / 20982
melee 83693 6.5% 93.2 3.83sec 82119 89766 66849 146274 82119 30.3% 7.4% 24.0% 6.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.17 93.17 0.00 0.00 0.9148 0.0000 7650878.73 7650878.73 0.00 89766.38 89766.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.00 35.42% 66837.57 51896 107094 66919.30 57162 81129 2205905 2205905 0.00
hit (blocked) 2.66 2.85% 66990.76 51896 107094 62466.57 0 107094 178183 178183 0.00
crit 26.12 28.03% 146249.53 103793 257026 146099.06 120249 188281 3819430 3819430 0.00
crit (blocked) 2.10 2.25% 146580.33 103793 257026 128440.02 0 257026 307666 307666 0.00
glance 20.71 22.23% 50936.45 38922 80320 50955.46 43169 65537 1054870 1054870 0.00
glance (blocked) 1.66 1.78% 51036.19 38922 80320 41416.20 0 80320 84825 84825 0.00
parry 6.90 7.41% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.9 20.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.92 18.92 0.00 0.00 1.0374 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 311 0.0% 19.6 16.50sec 1453 0 1016 2352 1453 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.59 19.59 0.00 0.00 0.0000 0.0000 28466.91 28466.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.17 67.25% 1015.52 786 1434 1018.40 825 1434 13379 13379 0.00
crit 6.41 32.74% 2352.20 1573 3442 2337.03 0 3442 15088 15088 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1035.99
  • base_dd_max:1035.99
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MB_DI 8774
halo_heal 8774 100.0% 9.0 42.42sec 356936 0 33359 34798 33838 33.3% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 94.92 0.00 0.00 0.0000 0.0000 3211277.82 30913513.06 89.61 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.31 66.70% 33359.14 -0 354441 33216.41 0 129668 2111793 14975196 85.94
crit 31.60 33.30% 34797.84 -0 612730 34645.52 0 176429 1099485 15938317 93.09
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MB_DI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.45%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 19.6 1.7 17.5sec 16.1sec 8.57% 40.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.57%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 17.8 0.0 20.1sec 20.1sec 26.11% 25.94%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:26.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 2.9 0.0 138.4sec 138.4sec 15.75% 15.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.75%

    Trigger Attempt Success

    • trigger_pct:99.95%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.80% 41.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.80%

    Trigger Attempt Success

    • trigger_pct:99.38%
shadow_word_death_reset_cooldown 10.5 0.0 9.9sec 9.9sec 24.74% 49.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:24.74%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.87%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 8.1 2.0 46.7sec 36.5sec 24.71% 53.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.71%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.4 0.0 56.1sec 56.0sec 17.30% 17.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.30%

    Trigger Attempt Success

    • trigger_pct:99.85%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.76% 0.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.76%

Trigger Attempt Success

  • trigger_pct:19.94%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.9 0.0 20.1sec 20.1sec 85.40% 86.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.0 0.0 180.0sec 180.0sec 20.52% 31.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 20.49% 20.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.16% 2.16%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.16%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 17.8 53.5 3.0 3.0 310304.4
halo Mana 9.0 364370.4 40500.0 40500.0 8.0
mind_blast Mana 46.6 232506.0 4989.5 4989.5 48.9
mind_flay Mana 124.5 373371.1 3000.0 3000.0 64.1
shadow_word_death Mana 20.8 162023.5 7800.0 7799.4 34.7
shadow_word_pain Mana 31.0 408600.2 13200.0 13200.1 43.6
vampiric_touch Mana 32.3 290509.6 9000.0 9000.0 57.8
Resource Gains Type Count Total Average Overflow
mindbender Mana 86.25 241098.30 (13.25%) 2795.35 210685.95 46.63%
Shadow Orbs from Mind Blast Shadow Orb 46.59 44.58 (80.96%) 0.96 2.01 4.32%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.49 10.49 (19.04%) 1.00 0.00 0.00%
Devouring Plague Health Health 260.55 2826440.63 (45.39%) 10847.84 2720398.23 49.04%
Vampiric Touch Mana Mana 362.53 1258133.02 (69.16%) 3470.46 567280.10 31.08%
halo_heal Health 9.00 280199.89 (4.50%) 31144.39 2615587.02 90.32%
external_healing Health 70.08 2765632.92 (44.41%) 39466.24 20200132.66 87.96%
mp5_regen Mana 1463.00 319932.43 (17.59%) 218.68 118967.57 27.11%
vampiric_embrace Health 156.33 354821.16 (5.70%) 2269.75 106783.56 23.13%
pet - mindbender
external_healing Health 21.89 842045.42 (98.28%) 38474.16 6585348.18 88.66%
vampiric_embrace Health 4.84 14771.87 (1.72%) 3050.12 1934.18 11.58%
Resource RPS-Gain RPS-Loss
Health 17013.92 17490.84
Mana 4970.39 5003.77
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 527177.91 35831.16 709623.00
Mana 287600.08 219600.00 300000.00
Shadow Orb 1.50 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 27.2%
shadowfiend-Mana Cap 27.2%
mindbender-Mana Cap 27.2%

Procs

Count Interval
Shadowy Recall Extra Tick 468.0 0.8sec
Shadowy Apparition Procced 126.9 2.8sec
Divine Insight Mind Blast CD Reset 35.8 16.1sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 319629.18
Minimum 283085.06
Maximum 363030.03
Spread ( max - min ) 79944.97
Range [ ( max - min ) / 2 * 100% ] 12.51%
Standard Deviation 9933.5334
5th Percentile 303722.78
95th Percentile 336411.58
( 95th Percentile - 5th Percentile ) 32688.80
Mean Distribution
Standard Deviation 62.8352
95.00% Confidence Intervall ( 319506.03 - 319752.34 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3710
0.1 Scale Factor Error with Delta=300 842347
0.05 Scale Factor Error with Delta=300 3369389
0.01 Scale Factor Error with Delta=300 84234729
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 319629.18
Minimum 283085.06
Maximum 363030.03
Spread ( max - min ) 79944.97
Range [ ( max - min ) / 2 * 100% ] 12.51%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 109304935.12
Minimum 95970201.03
Maximum 125026419.51
Spread ( max - min ) 29056218.48
Range [ ( max - min ) / 2 * 100% ] 13.29%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 8773.98
Minimum 0.00
Maximum 33824.86
Spread ( max - min ) 33824.86
Range [ ( max - min ) / 2 * 100% ] 192.76%
Standard Deviation 5829.9232
5th Percentile 1980.62
95th Percentile 21109.99
( 95th Percentile - 5th Percentile ) 19129.37
Mean Distribution
Standard Deviation 36.8776
95.00% Confidence Intervall ( 8701.70 - 8846.26 )
Normalized 95.00% Confidence Intervall ( 99.18% - 100.82% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16960
0.1% Error 1696009
0.1 Scale Factor Error with Delta=300 290141
0.05 Scale Factor Error with Delta=300 1160564
0.01 Scale Factor Error with Delta=300 29014115
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 8773.98
Minimum 0.00
Maximum 33824.86
Spread ( max - min ) 33824.86
Range [ ( max - min ) / 2 * 100% ] 192.76%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 3211277.82
Minimum 0.00
Maximum 12379900.00
Spread ( max - min ) 12379900.00
Range [ ( max - min ) / 2 * 100% ] 192.76%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 8322.46
Minimum 4233.27
Maximum 12196.33
Spread ( max - min ) 7963.06
Range [ ( max - min ) / 2 * 100% ] 47.84%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 6.92 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 10.29 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 2.68 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 47.64 mind_blast,if=active_enemies<=5&cooldown_react
F 10.49 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 12.83 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 14.74 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 18.13 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 19.18 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.20 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.16 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 9.00 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.17 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 13.73 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 60.54 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9EIJPWTEWKEJNWETTTTTTEIJWLWEINWPELKLWTEKW9WELNWTTTTTTTTEWKWELWPWTTTTENIJEIWLWEWENWLEKWKJTTTTEW9ENWLPKWEWWTELWKWIEJNWLWEWEKKLPWWENLWTE9KWLEWEKNWELWPIJWEWKWLWENLWIWETTTTTTTTEKLW9ENWPLTEKWTEWENLWIEJIWEWLWWLKENKPEWEWLWF9CNEWKWFCEJNWFCTEWEKED8FCIJJPEWFCNKWEWLFCWENWFCK9L

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 319651 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
319650.5 319650.5 120.55 / 0.04% 15906 / 5.0% 57.5 9102.2 9102.2 76.92 / 0.85% 10244 / 112.5% 1.8 5197.3 5158.9 Mana 0.26% 37.1 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.55 5.86 7.19 4.82 3.84 4.80
Normalized 1.00 0.78 0.95 0.64 0.51 0.64
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit ~= Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.55, SpellDamage=5.86, HitRating=7.19, CritRating=4.82, HasteRating=3.84, MasteryRating=4.80 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.55, SpellDamage=5.86, HitRating=0.00, CritRating=4.82, HasteRating=3.84, MasteryRating=4.80 )

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:902764|565679|511329|313312|259767|236230|143070&chds=0,1805528&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++902764++devouring_plague,9482C9,0,0,15|t++565679++shadow_word_pain,9482C9,1,0,15|t++511329++vampiric_touch,9482C9,2,0,15|t++313312++halo,9482C9,3,0,15|t++259767++shadow_word_death,9482C9,4,0,15|t++236230++mind_blast,9482C9,5,0,15|t++143070++mind_flay,9482C9,6,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:16,11,11,9,8,7,6,6,6,6,5,4,4,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,C79C6E,336600,336600&chl=mind_flay|shadow_word_pain|vampiric_touch|mind_flay_mastery|mind_blast|mindbender: melee|essence_of_yulon|devouring_plague_tick|shadow_word_pain_mastery|vampiric_touch_mastery|shadow_word_death|devouring_plague|multistrike_spell|devouring_plague_mastery|halo_damage|shadowy_apparition|stormlash|mindbender: stormlash& DPS Taken Timeline Chart
http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.55,7.19,5.86,4.82,4.80,3.84|7.38,7.01,5.69,4.65,4.63,3.67|7.71,7.37,6.03,4.99,4.97,4.01&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.55++Int,FFFFFF,0,0,15,0.1,e|t++++7.19++Hit,FFFFFF,0,1,15,0.1,e|t++++5.86++SP,FFFFFF,0,2,15,0.1,e|t++++4.82++Crit,FFFFFF,0,3,15,0.1,e|t++++4.80++Mastery,FFFFFF,0,4,15,0.1,e|t++++3.84++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.065& http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cgkpsvxz0133567875220xurqpppqrqrrqqponnlmmnnnnmljjihgfdddedddddccbabcccddddddeddcbaZZabbbbbcbcbccccdddeeeddddccbbbbbbbbbbccdffffgghhihihhggggfeedeeedddddeeefffggffgfffeeedcccbbbbbbbcdeefggggghhhhggfffeedccbbcccddeefffffffffffeedccbbaZZZaabcddeeffghiijjkllllkkjiihgggggghhhiiiiiijjkkllllmlllkkjjjkkllmnnoopnnoonnnnnnnmlkjihgffggghhijijjkkkllkllllllkkjhghgffcbZXWVTSQO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5659,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=319651|max=564872&chxp=1,1,57,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:7,7,18,48,59,85,161,232,357,468,614,832,1000,1230,1359,1528,1687,1741,1723,1725,1609,1586,1370,1191,1043,842,660,520,371,289,200,142,102,67,47,25,21,13,5,2,3,0,1,0,1,0,0,0,0,1&chds=0,1741&chbh=5&chxt=x&chxl=0:|min=287335|avg=319651|max=373672&chxp=0,1,37,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:51.9,10.6,9.4,8.9,6.0,4.2,2.6,2.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 190.0s|mind_blast 38.7s|vampiric_touch 34.4s|shadow_word_pain 32.4s|shadow_word_death 21.8s|devouring_plague 15.4s|halo 9.4s|mindbender 7.2s|waiting 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 319651
devouring_plague 10648 (37941) 3.3% (11.9%) 14.8 23.97sec 937377 902764 195979 421591 263073 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.81 14.81 0.00 0.00 1.0384 0.0000 3897178.35 3897178.35 0.00 902764.07 902764.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.40 70.23% 195979.18 173797 311890 195942.44 173797 242900 2039051 2039051 0.00
crit 4.41 29.75% 421591.28 362119 738867 419717.95 0 738867 1858127 1858127 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9427 2.9% 70.7 4.80sec 48819 0 33076 85823 48867 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.67 70.60 0.00 0.00 0.0000 0.0000 3450101.73 3450101.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.45 70.04% 33075.52 28967 51982 33081.94 29597 38269 1635578 1635578 0.00
crit 21.14 29.95% 85823.14 72910 152704 85750.04 73806 110082 1814524 1814524 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17866 5.6% 14.8 23.97sec 441409 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.8 32780 70263 43935 29.8% 0.0% 24.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.81 14.81 148.84 148.84 0.0000 0.5940 6539036.82 6539036.82 0.00 73962.64 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.5 70.24% 32780.30 28967 113240 32788.26 29474 79927 3427021 3427021 0.00
crit 44.3 29.76% 70263.18 60355 235944 70213.80 61736 168495 3112016 3112016 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19155 6.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 151.6 25989 56305 35043 29.9% 0.0% 32.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.15 151.60 200.05 0.0000 0.7946 7010664.22 7010664.22 0.00 58202.97 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.3 70.11% 25988.85 21627 43522 25995.30 23837 29004 3645305 3645305 0.00
crit 59.8 29.88% 56305.49 45062 108817 56299.49 49885 65061 3365359 3365359 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8009) 0.0% (2.5%) 9.0 42.34sec 325708 313312 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.0396 0.0000 0.00 0.00 0.00 313311.58 313311.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.31 70.10% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.69 29.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8009 2.5% 9.0 42.34sec 325708 0 182683 389561 244376 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 12.00 0.00 0.00 0.0000 0.0000 2931343.13 2931343.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.42 70.16% 182682.80 157064 293078 182721.26 159681 234203 1537365 1537365 0.00
crit 3.58 29.83% 389560.56 327255 610651 383752.91 0 610651 1393978 1393978 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 24948 7.8% 37.2 9.89sec 245243 236230 182492 393989 245243 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.23 37.23 0.00 0.00 1.0382 0.0000 9131010.96 9131010.96 0.00 236230.33 236230.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.18 70.30% 182491.99 139099 401435 182420.16 152358 214933 4776771 4776771 0.00
crit 11.05 29.68% 393988.79 289823 950662 394095.64 0 582787 4354240 4354240 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 48807 (74265) 15.3% (23.2%) 134.3 2.70sec 202378 143070 0 0 0 0.0% 0.0% 0.0% 0.0% 309.5 42395 93459 57713 30.0% 0.0% 47.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.31 134.31 309.52 309.52 1.4145 0.5652 17863459.32 17863459.32 0.00 143069.88 143069.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.29 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 216.7 70.00% 42394.76 36858 69446 42399.16 39862 46593 9185907 9185907 0.00
crit 92.8 30.00% 93458.89 76796 173637 93439.65 84387 107694 8677552 8677552 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 25458 8.0% 146.9 2.46sec 63428 0 42273 113021 63450 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.90 146.85 0.00 0.00 0.0000 0.0000 9317529.54 9317529.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.86 70.04% 42273.21 36858 69446 42277.19 39247 46649 4348099 4348099 0.00
crit 43.97 29.94% 113020.54 92771 215313 112997.51 95948 134662 4969430 4969430 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10588 3.3% 183.1 1.97sec 21167 0 21167 0 21167 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.07 183.07 0.00 0.00 0.0000 0.0000 3875058.96 3875058.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 183.07 100.00% 21166.73 8570 316887 21167.36 15337 28990 3875059 3875059 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:35917.71
  • base_dd_max:35917.71
power_infusion 0 0.0% 3.8 121.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 3.77 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 15471 4.8% 21.0 4.73sec 269668 259767 200872 429560 269670 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.0381 0.0000 5662401.99 5662401.99 0.00 259767.04 259767.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.68 69.89% 200872.02 156358 452288 200838.27 160639 261942 2948038 2948038 0.00
crit 6.32 30.09% 429560.27 325785 942380 429158.68 0 767088 2714364 2714364 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32812 (50143) 10.3% (15.7%) 31.3 11.62sec 587019 565679 0 0 0 0.0% 0.0% 0.0% 0.0% 296.4 30183 64919 40514 29.7% 0.0% 127.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.26 31.26 296.43 296.43 1.0377 1.5726 12009256.16 12009256.16 0.00 36807.09 565678.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.26 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 208.3 70.26% 30183.27 25710 50852 30188.07 27833 34182 6286333 6286333 0.00
crit 88.2 29.74% 64919.39 53569 114733 64889.74 58519 74066 5722923 5722923 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 17331 5.4% 140.6 2.57sec 45121 0 30546 79694 45163 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.58 140.45 0.00 0.00 0.0000 0.0000 6343051.51 6343051.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.64 70.24% 30545.69 26996 50852 30547.97 28245 33801 3013169 3013169 0.00
crit 41.78 29.75% 79694.36 67948 157661 79677.07 70677 91395 3329883 3329883 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 6890 2.2% 129.9 2.77sec 19407 0 15724 34024 21218 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.94 118.85 0.00 0.00 0.0000 0.0000 2521752.54 2521752.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.14 69.95% 15724.18 13769 25133 15721.84 14374 17423 1307256 1307256 0.00
crit 35.70 30.03% 34024.12 28689 62840 34010.65 29742 40413 1214497 1214497 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 3242 1.0% 34.6 9.20sec 34333 0 23026 57319 34332 33.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.57 34.57 0.00 0.00 0.0000 0.0000 1186744.89 1186744.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.16 67.00% 23025.77 17031 32641 23115.70 18849 32051 533296 533296 0.00
crit 11.40 32.98% 57318.73 35485 81611 56840.70 38900 81611 653449 653449 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:22446.36
  • base_dd_max:22446.36
vampiric_touch 31503 (48071) 9.9% (15.0%) 33.1 10.94sec 531234 511329 0 0 0 0.0% 0.0% 0.0% 0.0% 255.9 33424 72414 45051 29.8% 0.0% 122.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.12 33.12 255.93 255.93 1.0389 1.7497 11530072.02 11530072.02 0.00 36485.41 511329.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.12 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.6 70.18% 33424.46 28140 56544 33429.42 30866 37508 6003585 6003585 0.00
crit 76.3 29.82% 72413.73 58633 141377 72386.12 64353 84368 5526487 5526487 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 16568 5.2% 121.4 2.96sec 49935 0 33672 88325 49975 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.43 121.34 0.00 0.00 0.0000 0.0000 6063738.96 6063738.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.11 70.14% 33671.77 29548 56544 33674.37 31064 37395 2865816 2865816 0.00
crit 36.21 29.84% 88325.11 74371 175310 88304.70 76187 103082 3197923 3197923 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 83614 / 20928
melee 83305 6.5% 93.4 3.86sec 81745 89351 66631 145636 81746 30.2% 7.4% 24.0% 6.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.36 93.36 0.00 0.00 0.9149 0.0000 7631377.80 7631377.80 0.00 89350.98 89350.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.19 35.55% 66627.20 51896 107094 66702.14 58152 82349 2211223 2211223 0.00
hit (blocked) 2.65 2.84% 66676.54 51896 107094 62121.31 0 107094 176941 176941 0.00
crit 26.10 27.96% 145605.04 103793 257026 145456.55 118606 203873 3800752 3800752 0.00
crit (blocked) 2.10 2.24% 146028.09 103793 257026 128143.24 0 257026 306013 306013 0.00
glance 20.72 22.19% 50782.68 38922 80320 50795.66 42573 66097 1052033 1052033 0.00
glance (blocked) 1.66 1.78% 50901.14 38922 80320 41300.60 0 80320 84416 84416 0.00
parry 6.93 7.42% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.9 20.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.95 18.95 0.00 0.00 1.0373 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 309 0.0% 19.6 16.51sec 1445 0 1010 2341 1445 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.60 19.60 0.00 0.00 0.0000 0.0000 28308.33 28308.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.20 67.34% 1010.39 786 1434 1013.47 820 1434 13335 13335 0.00
crit 6.40 32.64% 2340.78 1573 3442 2324.05 0 3442 14974 14974 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1035.99
  • base_dd_max:1035.99
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MB_PI 9102
halo_heal 9102 100.0% 9.0 42.34sec 370161 0 34868 36291 35340 33.2% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 94.28 0.00 0.00 0.0000 0.0000 3331423.21 30530760.17 89.09 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.00 66.83% 34868.40 -0 354441 34674.25 0 134084 2196536 14838606 85.26
crit 31.27 33.17% 36290.79 -0 687899 36077.69 0 211980 1134887 15692154 92.77
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MB_PI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.43%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.8 0.0 24.2sec 24.2sec 27.29% 24.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 2.8 0.0 142.4sec 142.4sec 15.30% 15.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.30%

    Trigger Attempt Success

    • trigger_pct:99.95%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.85% 41.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.85%

    Trigger Attempt Success

    • trigger_pct:99.33%
power_infusion 3.8 0.0 121.4sec 121.4sec 16.62% 16.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:16.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 10.6 0.0 9.8sec 9.8sec 25.01% 49.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:25.01%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 7.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 8.1 2.0 46.6sec 36.6sec 24.66% 44.78%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.66%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.3 0.0 57.2sec 57.1sec 16.98% 16.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.98%

    Trigger Attempt Success

    • trigger_pct:99.83%
vampiric_embrace 0.3 0.0 0.0sec 0.0sec 1.07% 1.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:1.07%

Trigger Attempt Success

  • trigger_pct:27.46%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.9 0.0 20.2sec 20.2sec 85.42% 86.16%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.0 0.0 180.0sec 180.0sec 20.47% 31.43%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 20.47% 20.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.15% 2.15%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.15%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 14.8 44.4 3.0 3.0 312496.2
halo Mana 9.0 340621.5 37847.2 37847.2 8.6
mind_blast Mana 37.2 322033.5 8649.3 8649.3 28.4
mind_flay Mana 134.3 384251.1 2860.9 2861.0 70.7
shadow_word_death Mana 21.0 162331.2 7731.5 7730.9 34.9
shadow_word_pain Mana 31.3 402781.5 12883.3 12883.4 45.6
vampiric_touch Mana 33.1 290187.1 8761.9 8762.0 60.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 86.41 232941.66 (12.34%) 2695.62 219707.30 48.54%
Shadow Orbs from Mind Blast Shadow Orb 37.23 35.43 (76.95%) 0.95 1.79 4.82%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.61 10.61 (23.05%) 1.00 0.00 0.00%
Devouring Plague Health Health 219.43 2487706.89 (40.03%) 11336.92 2183759.77 46.75%
Vampiric Touch Mana Mana 377.27 1329586.14 (70.42%) 3524.24 570025.38 30.01%
halo_heal Health 9.00 333542.23 (5.37%) 37060.58 2545841.40 88.42%
external_healing Health 70.07 3031125.41 (48.77%) 43256.80 19945006.66 86.81%
mp5_regen Mana 1463.00 325636.74 (17.25%) 222.58 113263.26 25.81%
vampiric_embrace Health 156.33 362796.21 (5.84%) 2320.77 98808.51 21.41%
pet - mindbender
external_healing Health 21.84 842128.88 (98.34%) 38550.19 6571113.92 88.64%
vampiric_embrace Health 4.67 14191.20 (1.66%) 3037.71 1957.04 12.12%
Resource RPS-Gain RPS-Loss
Health 16981.34 17490.84
Mana 5158.92 5197.28
Shadow Orb 0.13 0.12
Combat End Resource Mean Min Max
Health 517380.60 2673.49 709623.00
Mana 285014.28 233178.10 300000.00
Shadow Orb 1.56 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.9%
shadowfiend-Mana Cap 25.9%
mindbender-Mana Cap 25.9%

Procs

Count Interval
Shadowy Recall Extra Tick 479.2 0.8sec
Shadowy Apparition Procced 129.9 2.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 319650.51
Minimum 287335.37
Maximum 373672.37
Spread ( max - min ) 86337.00
Range [ ( max - min ) / 2 * 100% ] 13.50%
Standard Deviation 9723.2475
5th Percentile 304019.51
95th Percentile 335831.82
( 95th Percentile - 5th Percentile ) 31812.31
Mean Distribution
Standard Deviation 61.5051
95.00% Confidence Intervall ( 319529.96 - 319771.06 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3554
0.1 Scale Factor Error with Delta=300 807060
0.05 Scale Factor Error with Delta=300 3228243
0.01 Scale Factor Error with Delta=300 80706098
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 319650.51
Minimum 287335.37
Maximum 373672.37
Spread ( max - min ) 86337.00
Range [ ( max - min ) / 2 * 100% ] 13.50%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 109332401.10
Minimum 97822072.95
Maximum 129027534.68
Spread ( max - min ) 31205461.73
Range [ ( max - min ) / 2 * 100% ] 14.27%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 9102.25
Minimum 0.00
Maximum 40225.34
Spread ( max - min ) 40225.34
Range [ ( max - min ) / 2 * 100% ] 220.96%
Standard Deviation 6204.5679
5th Percentile 2030.06
95th Percentile 22517.37
( 95th Percentile - 5th Percentile ) 20487.31
Mean Distribution
Standard Deviation 39.2474
95.00% Confidence Intervall ( 9025.33 - 9179.17 )
Normalized 95.00% Confidence Intervall ( 99.15% - 100.85% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17849
0.1% Error 1784932
0.1 Scale Factor Error with Delta=300 328629
0.05 Scale Factor Error with Delta=300 1314518
0.01 Scale Factor Error with Delta=300 32862965
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 9102.25
Minimum 0.00
Maximum 40225.34
Spread ( max - min ) 40225.34
Range [ ( max - min ) / 2 * 100% ] 220.96%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 3331423.21
Minimum 0.00
Maximum 14722475.49
Spread ( max - min ) 14722475.49
Range [ ( max - min ) / 2 * 100% ] 220.96%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 9193.55
Minimum 5083.56
Maximum 12535.11
Spread ( max - min ) 7451.55
Range [ ( max - min ) / 2 * 100% ] 40.53%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 6.95 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 3.77 power_infusion,if=talent.power_infusion.enabled
C 10.38 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.12 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 38.78 mind_blast,if=active_enemies<=5&cooldown_react
F 10.61 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 13.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 14.61 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 17.94 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 20.10 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.27 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.70 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 9.00 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.28 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 4.31 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 59.32 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9BEIJPWEWLWEINWTEWIJLWEKWLEKJNPWEI9WLWEWEILNWEWIJPKLEWEKLNWLKWTEW9BWEWLWKWEPWLENWKIJEWLWEWLWKIWELNWPW9EWKWLWEWENKLWEIJWPWELKWLWENWLWEKW9BWEWLWEKNPWELWIJWEKWLWEKJMNWKEWLWPW9FCENWFCEIJWSFCENWI8JFCEIJWPFCELKNWFCEIJWSFC9BEN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 325776 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
325775.6 325775.6 123.62 / 0.04% 16504 / 5.1% 56.9 8639.4 8639.4 74.75 / 0.87% 9992 / 115.7% 1.6 5361.4 5320.0 Mana 0.28% 36.7 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.68 6.20 7.55 4.91 4.60 4.96
Normalized 1.00 0.81 0.98 0.64 0.60 0.65
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.18 0.17
Gear Ranking
Optimizers
Ranking
  • Int ~= Hit > SP > Mastery ~= Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.68, SpellDamage=6.20, HitRating=7.55, CritRating=4.91, HasteRating=4.60, MasteryRating=4.96 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.68, SpellDamage=6.20, HitRating=0.00, CritRating=4.91, HasteRating=4.60, MasteryRating=4.96 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:949456|580684|521753|328948|298535|247115|140701&chds=0,1898912&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++949456++devouring_plague,9482C9,0,0,15|t++580684++shadow_word_pain,9482C9,1,0,15|t++521753++vampiric_touch,9482C9,2,0,15|t++328948++halo,9482C9,3,0,15|t++298535++shadow_word_death,9482C9,4,0,15|t++247115++mind_blast,9482C9,5,0,15|t++140701++mind_flay,9482C9,6,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:16,11,10,8,8,7,6,6,6,6,6,4,4,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,C79C6E,336600,336600&chl=mind_flay|shadow_word_pain|vampiric_touch|mind_blast|mind_flay_mastery|mindbender: melee|essence_of_yulon|devouring_plague_tick|shadow_word_pain_mastery|shadow_word_death|vampiric_touch_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|halo_damage|shadowy_apparition|stormlash|mindbender: stormlash& DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.68,7.55,6.20,4.96,4.91,4.60|7.51,7.37,6.02,4.78,4.73,4.42|7.86,7.73,6.37,5.13,5.08,4.77&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.68++Int,FFFFFF,0,0,15,0.1,e|t++++7.55++Hit,FFFFFF,0,1,15,0.1,e|t++++6.20++SP,FFFFFF,0,2,15,0.1,e|t++++4.96++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.91++Crit,FFFFFF,0,4,15,0.1,e|t++++4.60++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.228& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cgjortwxyz24476875320ywtrsrsuvuvuuutrrsqrssstssqoonlkjhhhhhhhgggfeefggghggghhhhgffdddeffeffgggghhhhhiiijhggggffeeeeeeeeddeefgggggggghgggfffffeeeefggghhhiijjjkkkkkjkjiiiihhgffeeefffghiijkkkkkllmlllkkjiihhhggghijkllmmmmnmmmnnnnnmlkjiihhghhiikkkllllllmnnoopppppppnnmmlmmmnopqrrsssttuuvvwwwxxxxwwvutuvvwwxyz01zzzzzyyyyyyxwvutsrppqrrrstttuvvwwwwwwxxxxwwvusqrqpoljgedbZXVS&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6588,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=325776|max=494535&chxp=1,1,66,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,5,3,9,15,35,82,121,165,278,383,521,668,884,1066,1298,1443,1642,1853,1876,1808,1768,1638,1464,1280,1063,894,697,547,458,304,248,154,115,67,59,28,12,19,4,7,5,3,0,0,0,0,0,0,1&chds=0,1876&chbh=5&chxt=x&chxl=0:|min=289065|avg=325776|max=379868&chxp=0,1,40,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:52.0,10.4,9.3,8.9,6.0,4.2,2.6,2.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 190.5s|mind_blast 38.2s|vampiric_touch 34.2s|shadow_word_pain 32.5s|shadow_word_death 21.8s|devouring_plague 15.2s|halo 9.4s|mindbender 7.2s|waiting 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 325776
devouring_plague 11237 (39421) 3.4% (12.1%) 14.6 24.29sec 985441 949456 210053 449974 280892 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.64 14.64 0.00 0.00 1.0379 0.0000 4112620.46 4112620.46 0.00 949455.94 949455.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.31 70.45% 210053.22 173797 358674 209976.41 179450 259475 2166616 2166616 0.00
crit 4.32 29.54% 449974.00 362119 747325 447358.03 0 747325 1946004 1946004 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9776 3.0% 68.2 4.99sec 52474 0 35526 92203 52517 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.18 68.13 0.00 0.00 0.0000 0.0000 3577839.82 3577839.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.69 70.00% 35525.93 28967 59780 35530.06 31293 41067 1694121 1694121 0.00
crit 20.43 29.99% 92203.01 72910 152704 92135.57 74123 116728 1883719 1883719 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 18408 5.7% 14.6 24.29sec 460176 0 0 0 0 0.0% 0.0% 0.0% 0.0% 143.7 35002 75018 46895 29.7% 0.0% 23.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.64 14.64 143.67 143.67 0.0000 0.6084 6737472.25 6737472.25 0.00 77078.96 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.0 70.28% 35002.08 28967 114034 35007.50 31279 44130 3534150 3534150 0.00
crit 42.7 29.72% 75018.12 60355 237599 74957.36 65031 102153 3203322 3203322 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19704 6.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 146.8 27392 59163 36890 29.9% 0.0% 31.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.07 146.80 195.49 0.0000 0.7952 7211584.91 7211584.91 0.00 61781.11 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.0 70.08% 27391.86 22709 47667 27391.11 25024 31029 3752890 3752890 0.00
crit 58.5 29.90% 59162.77 47316 103635 59134.53 51979 69112 3458695 3458695 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8407) 0.0% (2.6%) 9.0 42.41sec 341891 328948 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.0394 0.0000 0.00 0.00 0.00 328948.18 328948.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.30 70.06% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.69 29.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8407 2.6% 9.0 42.41sec 341891 0 192377 409327 256625 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 11.99 0.00 0.00 0.0000 0.0000 3076981.26 3076981.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.44 70.36% 192376.65 157064 320990 192416.27 162299 255335 1623111 1623111 0.00
crit 3.55 29.62% 409327.11 327255 668808 403168.88 0 668808 1453870 1453870 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 25765 7.9% 36.7 10.02sec 256650 247115 191184 412086 256651 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.74 36.74 0.00 0.00 1.0386 0.0000 9430161.44 9430161.44 0.00 247115.16 247115.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.85 70.34% 191184.36 139099 461650 191108.79 157597 226840 4941218 4941218 0.00
crit 10.89 29.65% 412085.99 289823 961885 412059.59 296325 608287 4488944 4488944 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 48115 (73215) 14.8% (22.5%) 131.4 2.75sec 203894 140701 0 0 0 0.0% 0.0% 0.0% 0.0% 296.4 43755 95956 59405 30.0% 0.0% 47.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.43 131.43 296.44 296.44 1.4491 0.5910 17609986.35 17609986.35 0.00 140701.18 140701.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.41 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 207.6 70.02% 43754.94 36858 76060 43758.75 40932 47518 9082002 9082002 0.00
crit 88.9 29.98% 95955.56 76796 165368 95940.02 87097 110279 8527985 8527985 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 25101 7.7% 140.7 2.56sec 65313 0 43665 116029 65330 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.66 140.62 0.00 0.00 0.0000 0.0000 9186835.64 9186835.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.49 70.04% 43664.57 36858 76060 43667.58 40022 47947 4300381 4300381 0.00
crit 42.11 29.95% 116029.20 92771 205060 116014.82 102176 135640 4886455 4886455 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=110}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10882 3.3% 177.5 2.03sec 22434 0 22434 0 22434 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 177.54 177.54 0.00 0.00 0.0000 0.0000 3982963.03 3982963.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.54 100.00% 22433.65 8570 361246 22436.31 16957 30493 3982963 3982963 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:67195.25
  • base_dd_max:67195.25
shadow_word_death 17775 5.5% 21.0 4.73sec 309925 298535 230922 493551 309928 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.99 20.99 0.00 0.00 1.0382 0.0000 6505674.16 6505674.16 0.00 298534.97 298534.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.67 69.89% 230921.86 179812 520132 230918.57 183040 302206 3387708 3387708 0.00
crit 6.32 30.10% 493551.26 374653 1083737 493222.65 0 1060065 3117966 3117966 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 33688 (51543) 10.3% (15.8%) 31.3 11.65sec 602595 580684 0 0 0 0.0% 0.0% 0.0% 0.0% 289.6 31718 68163 42568 29.8% 0.0% 127.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.31 31.31 289.65 289.65 1.0378 1.6108 12329923.39 12329923.39 0.00 37801.64 580684.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.30 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 203.4 70.23% 31718.37 25710 55695 31723.91 29265 35334 6452110 6452110 0.00
crit 86.2 29.77% 68163.47 53569 116044 68132.96 61277 78112 5877814 5877814 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 17855 5.5% 137.5 2.63sec 47527 0 32204 83843 47574 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.49 137.36 0.00 0.00 0.0000 0.0000 6534760.24 6534760.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.44 70.21% 32203.77 26996 55695 32206.37 29813 35612 3105846 3105846 0.00
crit 40.90 29.77% 83843.07 67948 150153 83827.11 74315 97497 3428914 3428914 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowy_apparition 6712 2.1% 127.1 2.83sec 19324 0 15707 33961 21175 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.13 116.02 0.00 0.00 0.0000 0.0000 2456607.57 2456607.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.24 70.02% 15706.64 13769 25133 15704.30 14416 17527 1275937 1275937 0.00
crit 34.77 29.97% 33961.33 28689 62840 33946.54 29718 39856 1180670 1180670 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2788 0.9% 29.8 10.73sec 34265 0 23134 56783 34265 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.78 29.78 0.00 0.00 0.0000 0.0000 1020394.20 1020394.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.92 66.90% 23134.07 18697 35749 23215.92 19223 31733 460886 460886 0.00
crit 9.85 33.09% 56783.33 40808 77725 56341.78 40808 77725 559508 559508 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:21791.88
  • base_dd_max:21791.88
vampiric_touch 31824 (48691) 9.8% (14.9%) 32.9 11.06sec 542118 521753 0 0 0 0.0% 0.0% 0.0% 0.0% 247.9 34914 75435 46979 29.8% 0.0% 122.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.87 32.87 247.93 247.93 1.0391 1.8049 11647520.81 11647520.81 0.00 36999.92 521753.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.87 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.1 70.23% 34914.12 28140 61929 34919.19 32145 39056 6079000 6079000 0.00
crit 73.8 29.77% 75435.47 58633 134645 75408.59 66598 85702 5568521 5568521 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 16867 5.2% 117.6 3.06sec 52485 0 35431 92739 52531 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.62 117.52 0.00 0.00 0.0000 0.0000 6173491.04 6173491.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.43 70.14% 35431.47 29548 61929 35433.44 32272 39277 2920570 2920570 0.00
crit 35.08 29.85% 92739.16 74371 166962 92725.67 80714 108520 3252921 3252921 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 83508 / 20872
melee 83198 6.4% 93.0 3.86sec 81870 89502 66692 145849 81869 30.2% 7.4% 24.0% 6.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.96 92.96 0.00 0.00 0.9147 0.0000 7610701.64 7610701.64 0.00 89501.87 89501.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.00 35.50% 66677.26 51896 107094 66745.72 58427 81722 2200427 2200427 0.00
hit (blocked) 2.64 2.84% 66882.40 51896 107094 62575.16 0 107094 176654 176654 0.00
crit 26.03 28.01% 145820.66 103793 257026 145637.72 118649 190120 3796318 3796318 0.00
crit (blocked) 2.08 2.24% 146203.62 103793 257026 128219.24 0 257026 303817 303817 0.00
glance 20.65 22.21% 50817.37 38922 80320 50829.71 43205 64753 1049288 1049288 0.00
glance (blocked) 1.65 1.78% 50898.63 38922 80320 41292.73 0 80320 84198 84198 0.00
parry 6.89 7.41% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.9 20.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.94 18.94 0.00 0.00 1.0375 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 310 0.0% 19.6 16.52sec 1447 0 1011 2345 1447 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.59 19.59 0.00 0.00 0.0000 0.0000 28347.48 28347.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.18 67.31% 1011.45 786 1434 1014.52 823 1434 13336 13336 0.00
crit 6.40 32.68% 2345.23 1573 3442 2329.65 0 3442 15012 15012 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1005.78
  • base_dd_max:1005.78
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MB_ToF 8639
halo_heal 8639 100.0% 9.0 42.41sec 351339 0 33359 34068 33594 33.1% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 94.14 0.00 0.00 0.0000 0.0000 3162013.30 32177653.59 90.17 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.96 66.88% 33358.71 -0 399455 33170.29 0 136537 2099951 15662521 86.64
crit 31.18 33.12% 34067.69 -0 704640 33859.00 0 173083 1062062 16515132 93.57
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MB_ToF
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.6 0.0 24.6sec 24.6sec 27.54% 24.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 2.8 0.0 142.5sec 142.5sec 15.31% 15.31%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.31%

    Trigger Attempt Success

    • trigger_pct:99.94%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.2sec 41.89% 41.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.89%

    Trigger Attempt Success

    • trigger_pct:99.40%
shadow_word_death_reset_cooldown 10.6 0.0 9.8sec 9.8sec 25.01% 49.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:25.01%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.91%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 8.1 2.0 46.8sec 36.6sec 24.62% 53.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.62%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.3 0.0 57.5sec 57.3sec 16.93% 16.93%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.93%

    Trigger Attempt Success

    • trigger_pct:99.83%
twist_of_fate 1.0 355.2 78.7sec 0.4sec 41.72% 41.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:41.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.3 0.0 0.0sec 0.0sec 1.06% 1.17%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:1.06%

Trigger Attempt Success

  • trigger_pct:27.28%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.9 0.0 20.2sec 20.2sec 85.41% 86.27%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.0 0.0 180.0sec 180.0sec 20.51% 31.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 20.50% 20.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.18% 2.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.18%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 14.6 43.9 3.0 3.0 328515.3
halo Mana 9.0 364495.1 40500.0 40500.0 8.4
mind_blast Mana 36.7 330690.2 9000.0 9000.0 28.5
mind_flay Mana 131.4 394279.2 3000.0 3000.0 68.0
shadow_word_death Mana 21.0 163717.6 7800.0 7799.4 39.7
shadow_word_pain Mana 31.3 413237.6 13200.0 13200.1 45.7
vampiric_touch Mana 32.9 295859.9 9000.0 9000.1 60.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 86.06 253602.06 (13.02%) 2946.93 197169.35 43.74%
Shadow Orbs from Mind Blast Shadow Orb 36.74 34.93 (76.70%) 0.95 1.81 4.93%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.61 10.61 (23.30%) 1.00 0.00 0.00%
Devouring Plague Health Health 211.79 2412967.24 (38.84%) 11393.05 2095825.72 46.48%
Vampiric Touch Mana Mana 365.45 1357218.62 (69.70%) 3713.78 482939.62 26.24%
halo_heal Health 9.00 325003.43 (5.23%) 36111.97 2732753.55 89.37%
external_healing Health 70.07 3111351.33 (50.08%) 44401.67 19683707.29 86.35%
mp5_regen Mana 1463.00 336300.10 (17.27%) 229.87 102599.90 23.38%
vampiric_embrace Health 156.33 362969.01 (5.84%) 2321.87 98635.71 21.37%
pet - mindbender
external_healing Health 21.88 846722.80 (98.32%) 38698.34 6583147.12 88.60%
vampiric_embrace Health 4.73 14442.15 (1.68%) 3053.51 1954.26 11.92%
Resource RPS-Gain RPS-Loss
Health 16973.47 17490.84
Mana 5320.00 5361.42
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 512121.47 23962.18 709623.00
Mana 284167.08 231300.00 300000.00
Shadow Orb 1.52 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.5%
shadowfiend-Mana Cap 23.5%
mindbender-Mana Cap 23.5%

Procs

Count Interval
Shadowy Recall Extra Tick 463.6 0.8sec
Shadowy Apparition Procced 127.1 2.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 325775.59
Minimum 289065.43
Maximum 379867.80
Spread ( max - min ) 90802.37
Range [ ( max - min ) / 2 * 100% ] 13.94%
Standard Deviation 9970.9675
5th Percentile 309585.21
95th Percentile 342593.58
( 95th Percentile - 5th Percentile ) 33008.37
Mean Distribution
Standard Deviation 63.0720
95.00% Confidence Intervall ( 325651.97 - 325899.21 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3598
0.1 Scale Factor Error with Delta=300 848707
0.05 Scale Factor Error with Delta=300 3394831
0.01 Scale Factor Error with Delta=300 84870794
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 325775.59
Minimum 289065.43
Maximum 379867.80
Spread ( max - min ) 90802.37
Range [ ( max - min ) / 2 * 100% ] 13.94%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 111594816.58
Minimum 98109613.93
Maximum 127208003.78
Spread ( max - min ) 29098389.85
Range [ ( max - min ) / 2 * 100% ] 13.04%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 8639.38
Minimum 0.00
Maximum 34703.87
Spread ( max - min ) 34703.87
Range [ ( max - min ) / 2 * 100% ] 200.85%
Standard Deviation 6029.3338
5th Percentile 1842.09
95th Percentile 21825.95
( 95th Percentile - 5th Percentile ) 19983.86
Mean Distribution
Standard Deviation 38.1390
95.00% Confidence Intervall ( 8564.63 - 8714.13 )
Normalized 95.00% Confidence Intervall ( 99.13% - 100.87% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18709
0.1% Error 1870982
0.1 Scale Factor Error with Delta=300 310328
0.05 Scale Factor Error with Delta=300 1241315
0.01 Scale Factor Error with Delta=300 31032897
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 8639.38
Minimum 0.00
Maximum 34703.87
Spread ( max - min ) 34703.87
Range [ ( max - min ) / 2 * 100% ] 200.85%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 3162013.30
Minimum 0.00
Maximum 12701615.25
Spread ( max - min ) 12701615.25
Range [ ( max - min ) / 2 * 100% ] 200.85%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 9389.46
Minimum 5238.92
Maximum 12731.64
Spread ( max - min ) 7492.71
Range [ ( max - min ) / 2 * 100% ] 39.90%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 6.94 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 10.38 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.09 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 38.76 mind_blast,if=active_enemies<=5&cooldown_react
F 10.61 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 0.00 mind_flay_insanity,interrupt=1,chain=1
I 12.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 14.22 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 18.68 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 20.28 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.27 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.55 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 9.00 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.29 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 5.04 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 60.07 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9EIJPWTEWLKENWEWIJLWEIWPLEKJNWEIW9WLEWEIWLWTENPWIJKEWLWEWLKWKJEW9ENWLKPWEWWELWKIJENWLWEWKKJWEPLWTE9KNWEJWEWKWLWEIJNWPWEKWLWLKEWKELNW9WTEWLKPEWENWIJJKWEWEKLJWKWTENPWF9CEJWKWFCEMNWLWFCEWKI8JFCENLPWFCEKKJWLFCENWWFC9E

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 327081 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
327080.9 327080.9 151.10 / 0.05% 17648 / 5.4% 66.9 11331.2 11331.2 61.26 / 0.54% 8091 / 71.4% 2.4 4761.7 4709.6 Mana 0.36% 37.1 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.98 6.36 8.69 5.12 4.76 5.81
Normalized 1.00 0.80 1.09 0.64 0.60 0.73
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.22 0.22 0.22 0.21 0.22 0.23
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.98, SpellDamage=6.36, HitRating=8.69, CritRating=5.12, HasteRating=4.76, MasteryRating=5.81 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.98, SpellDamage=6.36, HitRating=0.00, CritRating=5.12, HasteRating=4.76, MasteryRating=5.81 )

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:893597|574326|514318|302107|258898|235124|232552|137703&chds=0,1787194&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++893597++devouring_plague,9482C9,0,0,15|t++574326++shadow_word_pain,9482C9,1,0,15|t++514318++vampiric_touch,9482C9,2,0,15|t++302107++halo,9482C9,3,0,15|t++258898++shadow_word_death,9482C9,4,0,15|t++235124++mind_blast,9482C9,5,0,15|t++232552++mind_flay_insanity,9482C9,6,0,15|t++137703++mind_flay,9482C9,7,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,9,9,8,7,6,6,5,5,5,4,4,4,3,3,2,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,C79C6E,336600,336600&chl=mind_flay_insanity|mind_blast|shadow_word_pain|vampiric_touch|mind_flay|devouring_plague_tick|essence_of_yulon|mind_flay_insanity_mastery|shadow_word_pain_mastery|shadow_word_death|vampiric_touch_mastery|mind_flay_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadowfiend: melee|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.69,7.98,6.36,5.81,5.12,4.76|8.46,7.76,6.14,5.59,4.90,4.54|8.91,8.20,6.58,6.04,5.33,4.98&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.69++Hit,FFFFFF,0,0,15,0.1,e|t++++7.98++Int,FFFFFF,0,1,15,0.1,e|t++++6.36++SP,FFFFFF,0,2,15,0.1,e|t++++5.81++Mastery,FFFFFF,0,3,15,0.1,e|t++++5.12++Crit,FFFFFF,0,4,15,0.1,e|t++++4.76++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,10.434& http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bfiloqtvxz13466876320xwvuuuuvwvwwwwvvvwwvwwwvvusqpomljihhffeeeeeeddeeeeeeeeeeeeedcccccddeffgghiijjjkklllkjjiihggffeedddcccccddddddddddeeeeeeeeeeefghhijjkklllmmnmmllllllkkihggggghhhikllllllllmnnmllkjihhgffffffgghhijjjjjjjjjjjjjjiihggffefeeeeeffeeeeeeeeeeffffgggggggghhiijklmmnnnopprrrsssttsssrrqqrrqqqqqqqrppoooooonnnnmmmllkkklllmmmnmmnnnooooopppppoonmllllljgecaYWVTR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6194,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=327081|max=528092&chxp=1,1,62,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,3,5,10,9,9,5,3,3,1,1,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,1,2,5,36,118,300,719,1418,2257,2985,3561,3728,3277,2595,1781,1005,626,307,136,58,18,3,1,2&chds=0,3728&chbh=5&chxt=x&chxl=0:|min=178783|avg=327081|max=377749&chxp=0,1,75,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:29.1,23.3,13.0,8.2,8.0,5.8,5.0,2.3,0.8,0.0,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 106.3s|mind_flay_insanity 85.4s|mind_blast 47.6s|vampiric_touch 29.9s|shadow_word_pain 29.1s|shadow_word_death 21.4s|devouring_plague 18.3s|halo 8.5s|shadowfiend 3.1s|dispersion 0.0s|waiting 1.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 327081
devouring_plague 12680 (44585) 3.9% (13.6%) 17.6 20.25sec 927667 893597 195993 422861 263819 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.59 17.59 0.00 0.00 1.0381 0.0000 4640746.46 4640746.46 0.00 893597.15 893597.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.33 70.07% 195993.04 173797 311890 195956.84 174359 230156 2415881 2415881 0.00
crit 5.26 29.91% 422860.62 362119 779817 422253.36 0 637186 2224865 2224865 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 10994 3.4% 82.4 4.15sec 48811 0 32978 85924 48880 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.43 82.32 0.00 0.00 0.0000 0.0000 4023633.27 4023633.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.57 69.94% 32978.28 28967 51982 32983.28 29600 38593 1898619 1898619 0.00
crit 24.73 30.04% 85924.14 72910 161167 85865.95 74103 107276 2125014 2125014 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20911 6.4% 17.6 20.25sec 435102 0 0 0 0 0.0% 0.0% 0.0% 0.0% 173.7 32775 70535 44068 29.9% 0.0% 28.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.59 17.59 173.68 173.68 0.0000 0.6016 7653597.86 7653597.86 0.00 73254.19 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.7 70.09% 32774.98 28967 111376 32779.21 29560 40954 3989807 3989807 0.00
crit 51.9 29.91% 70534.59 60355 232061 70479.53 61600 85581 3663791 3663791 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18842 5.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.1 25820 55823 34794 29.9% 0.0% 32.4%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.68 149.14 198.20 0.0000 0.7943 6896187.23 6896187.23 0.00 58211.88 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.9 70.07% 25819.75 21627 41449 25825.14 23543 29237 3585622 3585622 0.00
crit 59.3 29.92% 55823.27 45062 103635 55808.16 48837 64962 3310566 3310566 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7033) 0.0% (2.2%) 8.2 46.65sec 313769 302107 0 0 0 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 1.0387 0.0000 0.00 0.00 0.00 302107.40 302107.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.76 70.16% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.45 29.82% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7033 2.2% 8.2 46.65sec 313769 0 180725 387197 242092 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 10.63 0.00 0.00 0.0000 0.0000 2574257.16 2574257.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.47 70.26% 180725.30 157064 279122 180438.62 0 226609 1350277 1350277 0.00
crit 3.16 29.73% 387196.78 327255 697887 377433.50 0 683930 1223980 1223980 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 30554 9.3% 45.8 8.01sec 244061 235124 181847 392849 244063 29.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.82 45.82 0.00 0.00 1.0380 0.0000 11182721.28 11182721.28 0.00 235123.76 235123.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.30 70.49% 181847.38 139099 401435 181818.78 156684 209216 5872919 5872919 0.00
crit 13.52 29.50% 392849.42 289823 1003706 392972.35 289823 557894 5309802 5309802 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 26296 (40006) 8.0% (12.2%) 73.3 4.85sec 199824 137703 0 0 0 0.0% 0.0% 0.0% 0.0% 167.6 41980 93352 57428 30.1% 0.0% 26.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.28 73.28 167.59 167.59 1.4511 0.5851 9624237.79 9624237.79 0.00 137702.57 137702.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.27 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.2 69.93% 41980.32 36858 66140 41911.62 0 49673 4919825 4919825 0.00
crit 50.4 30.07% 93351.92 76796 165368 93136.28 0 115458 4704413 4704413 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 35739 (54253) 10.9% (16.6%) 54.7 6.24sec 363051 232552 0 0 0 0.0% 0.0% 0.0% 0.0% 129.6 74777 161445 100866 30.1% 0.0% 21.4%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.69 54.69 129.62 129.62 1.5612 0.6038 13080566.96 13080566.96 0.00 232551.60 232551.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.69 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.6 69.90% 74776.69 36858 132279 75031.90 39975 88853 6778163 6778163 0.00
crit 39.0 30.10% 161445.44 76796 330737 161835.77 84129 201801 6302404 6302404 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 18514 5.7% 61.5 5.51sec 110125 0 74316 193966 110187 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.53 61.47 0.00 0.00 0.0000 0.0000 6776084.01 6776084.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.03 70.00% 74316.23 36858 132279 74569.96 39400 91075 3199042 3199042 0.00
crit 18.43 29.99% 193966.32 92771 410120 194424.61 100447 260472 3577042 3577042 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 13711 4.2% 79.6 4.39sec 63079 0 41827 112849 63111 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.55 79.51 0.00 0.00 0.0000 0.0000 5018089.09 5018089.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.67 70.01% 41827.22 36858 66140 41758.81 0 52519 2328378 2328378 0.00
crit 23.83 29.98% 112848.83 92771 205060 112580.66 0 148652 2689711 2689711 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
multistrike_spell 11450 3.5% 177.5 2.03sec 23611 0 23611 0 23611 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 177.48 177.48 0.00 0.00 0.0000 0.0000 4190615.77 4190615.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.48 100.00% 23611.33 8570 334569 23612.46 17584 32383 4190616 4190616 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:30735.47
  • base_dd_max:30735.47
shadow_word_death 15131 4.6% 20.6 4.87sec 268793 258898 200249 427992 268793 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.60 20.60 0.00 0.00 1.0383 0.0000 5537818.37 5537818.37 0.00 258897.54 258897.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.40 69.87% 200249.17 156358 452288 200290.06 160475 279113 2882728 2882728 0.00
crit 6.20 30.11% 427992.35 325785 942380 427525.18 0 942380 2655091 2655091 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 29850 (45668) 9.1% (14.0%) 28.0 13.10sec 596198 574326 0 0 0 0.0% 0.0% 0.0% 0.0% 271.3 29988 64523 40267 29.8% 0.0% 120.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.04 28.04 271.32 271.32 1.0381 1.6183 10924974.38 10924974.38 0.00 35702.14 574325.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.03 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 190.6 70.24% 29988.30 25710 48430 29936.86 0 35192 5714712 5714712 0.00
crit 80.8 29.76% 64522.92 53569 114733 64370.23 0 76497 5210263 5210263 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15819 4.8% 128.7 2.80sec 44968 0 30394 79329 45000 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.75 128.66 0.00 0.00 0.0000 0.0000 5789623.54 5789623.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.23 70.13% 30393.95 26996 48430 30338.41 0 34605 2742355 2742355 0.00
crit 38.41 29.86% 79328.92 67948 150153 79158.44 0 91687 3047268 3047268 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6334 1.9% 119.2 3.01sec 19455 0 15752 34101 21266 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.16 109.02 0.00 0.00 0.0000 0.0000 2318363.50 2318363.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.23 69.92% 15752.30 13769 25133 15719.49 0 17729 1200785 1200785 0.00
crit 32.77 30.06% 34101.16 28689 62840 34018.14 0 41351 1117578 1117578 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2702 0.8% 30.1 10.57sec 32833 0 22169 54592 32832 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.12 30.12 0.00 0.00 0.0000 0.0000 988809.61 988809.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.20 67.09% 22169.00 17031 31086 22255.54 18077 31086 447906 447906 0.00
crit 9.91 32.90% 54591.90 35485 77725 54184.48 38089 77725 540904 540904 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:22446.36
  • base_dd_max:22446.36
vampiric_touch 27528 (42081) 8.4% (12.9%) 28.8 12.65sec 534291 514318 0 0 0 0.0% 0.0% 0.0% 0.0% 225.7 33114 71699 44631 29.8% 0.0% 111.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.83 28.83 225.74 225.74 1.0389 1.8013 10075147.45 10075147.45 0.00 35279.36 514318.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.82 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 158.4 70.15% 33114.38 28140 53851 33058.45 0 39034 5244116 5244116 0.00
crit 67.4 29.85% 71699.29 58633 134645 71533.98 0 83501 4831032 4831032 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 14554 4.4% 107.1 3.34sec 49733 0 33485 87910 49765 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.10 107.04 0.00 0.00 0.0000 0.0000 5326623.45 5326623.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.99 70.06% 33484.89 29548 53851 33424.84 0 37596 2511135 2511135 0.00
crit 32.03 29.92% 87909.55 74371 166962 87726.13 0 104317 2815489 2815489 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 110686 / 8441
melee 110257 2.6% 30.7 12.71sec 100303 115320 78564 181210 100304 31.1% 7.3% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.68 30.68 0.00 0.00 0.8698 0.0000 3077537.21 3077537.21 0.00 115319.71 115319.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.71 34.90% 78525.69 58973 121698 78745.16 63396 113700 840881 840881 0.00
hit (blocked) 0.83 2.69% 79059.16 58973 121698 44748.37 0 121698 65287 65287 0.00
crit 8.84 28.82% 181058.08 129060 292075 180247.75 0 274632 1601006 1601006 0.00
crit (blocked) 0.69 2.26% 183148.60 133640 292075 91981.69 0 292075 126749 126749 0.00
glance 6.84 22.30% 60118.70 44230 91273 60124.71 0 91273 411271 411271 0.00
glance (blocked) 0.53 1.74% 60550.86 44230 91273 25209.74 0 91273 32343 32343 0.00
parry 2.23 7.28% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 429 0.0% 7.4 0.78sec 1618 0 1075 2660 1618 34.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.39 7.39 0.00 0.00 0.0000 0.0000 11965.24 11965.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.86 65.73% 1075.42 895 1434 1084.64 0 1434 5227 5227 0.00
crit 2.53 34.26% 2659.86 2147 3442 2488.01 0 3442 6739 6739 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:852.09
  • base_dd_max:852.09
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MFI_DI 11331
halo_heal 11331 100.0% 8.2 46.65sec 505494 0 44989 48173 46047 33.2% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.20 90.07 0.00 0.00 0.0000 0.0000 4147223.06 29192177.24 85.79 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.14 66.78% 44988.94 -0 354441 44845.57 0 183996 2705812 14169116 80.75
crit 29.92 33.22% 48173.47 -0 687899 47968.86 0 273030 1441411 15023061 90.20
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_DI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 18.5 1.5 18.6sec 17.1sec 8.39% 38.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.41%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 17.6 0.0 20.4sec 20.4sec 26.87% 25.87%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:26.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 2.9 0.0 139.4sec 139.4sec 15.62% 15.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.62%

    Trigger Attempt Success

    • trigger_pct:99.94%
jade_serpent_potion 2.0 0.0 290.1sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.83% 41.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.83%

    Trigger Attempt Success

    • trigger_pct:99.41%
shadow_word_death_reset_cooldown 10.4 0.0 10.0sec 10.0sec 24.33% 49.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:24.33%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.93%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 8.1 2.0 46.7sec 36.6sec 24.64% 53.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.64%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.4 0.0 55.8sec 55.7sec 17.37% 17.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.37%

    Trigger Attempt Success

    • trigger_pct:99.90%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.64% 0.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.64%

Trigger Attempt Success

  • trigger_pct:17.89%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.59% 83.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.52% 60.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.64% 20.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 17.6 52.8 3.0 3.0 309280.8
halo Mana 8.2 332169.7 40500.0 40487.2 7.7
mind_blast Mana 45.8 236681.3 5166.0 5165.5 47.2
mind_flay Mana 73.3 219759.4 3000.0 2999.1 66.6
mind_flay_insanity Mana 54.7 164199.1 3000.0 3002.2 120.9
shadow_word_death Mana 20.6 160675.6 7800.0 7798.8 34.5
shadow_word_pain Mana 28.0 369950.1 13200.0 13195.9 45.2
vampiric_touch Mana 28.8 259357.7 9000.0 8997.2 59.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.02 401.04 (0.02%) 18000.00 0.00 0.00%
shadowfiend Mana 28.44 130732.38 (7.58%) 4596.12 125264.34 48.93%
Shadow Orbs from Mind Blast Shadow Orb 45.81 43.89 (80.89%) 0.96 1.92 4.18%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.37 10.37 (19.11%) 1.00 0.00 0.00%
Devouring Plague Health Health 255.97 2857461.54 (45.96%) 11163.41 2591735.46 47.56%
Vampiric Touch Mana Mana 332.67 1242138.53 (72.06%) 3733.81 432897.19 25.84%
halo_heal Health 8.20 370235.07 (5.96%) 45141.15 2253280.81 85.89%
external_healing Health 70.87 2633216.13 (42.36%) 37155.06 20604571.36 88.67%
mp5_regen Mana 1463.00 350437.31 (20.33%) 239.53 88462.69 20.16%
vampiric_embrace Health 156.33 355741.00 (5.72%) 2275.63 105863.72 22.93%
pet - shadowfiend
external_healing Health 11.33 106689.56 (92.27%) 9413.43 3913522.06 97.35%
vampiric_embrace Health 3.43 8932.54 (7.73%) 2604.30 1836.49 17.05%
Resource RPS-Gain RPS-Loss
Health 16985.39 17490.84
Mana 4709.59 4761.73
Shadow Orb 0.15 0.14
Combat End Resource Mean Min Max
Health 515982.69 37485.88 709623.00
Mana 279531.72 16500.00 300000.00
Shadow Orb 1.51 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 20.3%
shadowfiend-Mana Cap 20.3%
mindbender-Mana Cap 20.3%

Procs

Count Interval
Shadowy Recall Extra Tick 459.0 0.8sec
Shadowy Apparition Procced 119.2 3.0sec
Divine Insight Mind Blast CD Reset 33.5 17.1sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 327080.87
Minimum 178782.59
Maximum 377749.26
Spread ( max - min ) 198966.67
Range [ ( max - min ) / 2 * 100% ] 30.42%
Standard Deviation 12187.1657
5th Percentile 310169.90
95th Percentile 345466.61
( 95th Percentile - 5th Percentile ) 35296.71
Mean Distribution
Standard Deviation 77.0907
95.00% Confidence Intervall ( 326929.78 - 327231.97 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5333
0.1 Scale Factor Error with Delta=300 1267911
0.05 Scale Factor Error with Delta=300 5071647
0.01 Scale Factor Error with Delta=300 126791196
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 327080.87
Minimum 178782.59
Maximum 377749.26
Spread ( max - min ) 198966.67
Range [ ( max - min ) / 2 * 100% ] 30.42%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 116622097.18
Minimum 63075996.19
Maximum 135658363.02
Spread ( max - min ) 72582366.83
Range [ ( max - min ) / 2 * 100% ] 31.12%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 11331.21
Minimum 0.00
Maximum 35943.58
Spread ( max - min ) 35943.58
Range [ ( max - min ) / 2 * 100% ] 158.60%
Standard Deviation 4941.4688
5th Percentile 4148.42
95th Percentile 20330.63
( 95th Percentile - 5th Percentile ) 16182.21
Mean Distribution
Standard Deviation 31.2576
95.00% Confidence Intervall ( 11269.95 - 11392.47 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7305
0.1% Error 730559
0.1 Scale Factor Error with Delta=300 208447
0.05 Scale Factor Error with Delta=300 833788
0.01 Scale Factor Error with Delta=300 20844706
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 11331.21
Minimum 0.00
Maximum 35943.58
Spread ( max - min ) 35943.58
Range [ ( max - min ) / 2 * 100% ] 158.60%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 4147223.06
Minimum 0.00
Maximum 13155349.03
Spread ( max - min ) 13155349.03
Range [ ( max - min ) / 2 * 100% ] 158.60%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 8206.12
Minimum 4115.46
Maximum 11985.22
Spread ( max - min ) 7869.76
Range [ ( max - min ) / 2 * 100% ] 47.95%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 10.23 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 2.79 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 46.87 mind_blast,if=active_enemies<=5&cooldown_react
F 10.37 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 6.05 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 22.01 mind_flay_insanity,interrupt=1,chain=1
I 16.70 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 18.91 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 11.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 11.34 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.18 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 14.80 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.20 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.50 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 9.61 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 32.67 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

AEHEHEHDEHGHEHHEHDEHHEHEHDHEHHEHEHHDEHGHEHHEHDHEHEHEHHDHEHAHEHEHDHEHGHEHEHHDHEHEHEHDEHHEHEHDHEHFSSSSSSSSSHSHSSHSSSSSSSSHSSSSSSHHSHSHSSSHSSSHSSH8aEDFCHEHFCHEDHFACH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 328739 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
328738.9 328738.9 146.27 / 0.04% 16986 / 5.2% 63.7 11427.3 11427.3 68.95 / 0.60% 9114 / 79.8% 2.3 5027.2 4961.7 Mana 0.20% 35.2 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.86 6.18 9.05 4.88 5.50 5.55
Normalized 1.00 0.79 1.15 0.62 0.70 0.71
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.21 0.21 0.22 0.20 0.21 0.21
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP > Mastery ~= Haste > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.86, SpellDamage=6.18, HitRating=9.05, CritRating=4.88, HasteRating=5.50, MasteryRating=5.55 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.86, SpellDamage=6.18, HitRating=0.00, CritRating=4.88, HasteRating=5.50, MasteryRating=5.55 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:902570|589699|527077|301736|256829|242425|237432|148658&chds=0,1805140&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++902570++devouring_plague,9482C9,0,0,15|t++589699++shadow_word_pain,9482C9,1,0,15|t++527077++vampiric_touch,9482C9,2,0,15|t++301736++halo,9482C9,3,0,15|t++256829++shadow_word_death,9482C9,4,0,15|t++242425++mind_flay_insanity,9482C9,5,0,15|t++237432++mind_blast,9482C9,6,0,15|t++148658++mind_flay,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,10,9,8,6,6,5,5,5,5,5,4,3,3,3,2,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,336600&chl=mind_flay|mind_flay_insanity|shadow_word_pain|vampiric_touch|mind_blast|essence_of_yulon|devouring_plague_tick|mind_flay_mastery|mind_flay_insanity_mastery|shadow_word_pain_mastery|vampiric_touch_mastery|shadow_word_death|multistrike_spell|devouring_plague|devouring_plague_mastery|shadowfiend: melee|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:9.05,7.86,6.18,5.55,5.50,4.88|8.83,7.65,5.97,5.34,5.28,4.68|9.26,8.07,6.39,5.77,5.71,5.09&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++9.05++Hit,FFFFFF,0,0,15,0.1,e|t++++7.86++Int,FFFFFF,0,1,15,0.1,e|t++++6.18++SP,FFFFFF,0,2,15,0.1,e|t++++5.55++Mastery,FFFFFF,0,3,15,0.1,e|t++++5.50++Haste,FFFFFF,0,4,15,0.1,e|t++++4.88++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,10.868& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cgjnptvxyz11246786432zwvutstuvuuutsqnmmlllmnooonllkjihfeeeddccaZXWVWXWXYZabbbcccccbbbbccccccbbbbbbbcdefgfffffedccccccbbbbaaZZZYZabdefggghhggggggghihhhgfeddeeffgggghhhhggfedddddddcccdeeeffghhijjjiihggffedddcccbbbccdeeeffffffffffeeeddccbbaZaaabccdeffgghhiiiiiijjiihhgggggghhiijjjkllmnnnoooonnmmmllmmmmlmmmmmlkkkkkkkjjjjjiiihhgghhiiijjiijjjkkkkklllllkkjihhhiigecZYWUTRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5675,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=328739|max=579302&chxp=1,1,57,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,4,7,10,16,10,5,2,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,19,87,227,493,957,1701,2563,3178,3562,3494,3068,2193,1510,913,526,254,111,43,16,8,4,1&chds=0,3562&chbh=5&chxt=x&chxl=0:|min=192039|avg=328739|max=377351&chxp=0,1,74,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:34.4,20.4,10.6,8.6,8.1,5.9,4.2,2.4,0.8,0.0,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 126.1s|mind_flay_insanity 74.6s|mind_blast 38.8s|vampiric_touch 31.6s|shadow_word_pain 29.8s|shadow_word_death 21.5s|devouring_plague 15.5s|halo 8.8s|shadowfiend 3.1s|dispersion 0.0s|waiting 0.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 328739
devouring_plague 10757 (38140) 3.3% (11.6%) 14.9 23.85sec 936729 902570 196669 423426 264198 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 14.90 0.00 0.00 1.0379 0.0000 3937109.82 3937109.82 0.00 902570.15 902570.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.46 70.19% 196668.93 173797 311890 196630.52 173797 239311 2057179 2057179 0.00
crit 4.44 29.79% 423426.06 362119 738867 421371.25 0 738867 1879930 1879930 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9407 2.9% 70.8 4.79sec 48650 0 33005 85577 48737 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.77 70.64 0.00 0.00 0.0000 0.0000 3442875.00 3442875.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.49 70.05% 33005.44 28967 51982 33015.18 29563 38454 1633360 1633360 0.00
crit 21.14 29.93% 85577.38 72910 152704 85513.52 73539 113919 1809515 1809515 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17976 5.5% 14.9 23.85sec 441495 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.3 32865 70453 44069 29.8% 0.0% 24.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 14.90 149.29 149.29 0.0000 0.5927 6579165.15 6579165.15 0.00 74359.33 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.8 70.19% 32864.71 28967 95925 32873.38 29497 40592 3443905 3443905 0.00
crit 44.5 29.81% 70453.13 60355 199868 70394.94 61111 84957 3135260 3135260 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19307 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 152.5 25976 56281 35039 29.9% 0.0% 33.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.34 152.47 201.68 0.0000 0.7944 7066544.38 7066544.38 0.00 58342.37 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.3 70.07% 25976.19 21627 43522 25982.47 23887 29243 3671124 3671124 0.00
crit 60.3 29.91% 56280.54 45062 108817 56270.84 49986 66327 3395420 3395420 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7265) 0.0% (2.2%) 8.5 45.22sec 313695 301736 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.48 8.48 0.00 0.00 1.0397 0.0000 0.00 0.00 0.00 301736.26 301736.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.94 70.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.53 29.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7265 2.2% 8.5 45.22sec 313695 0 182014 390286 243723 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.48 10.91 0.00 0.00 0.0000 0.0000 2658899.96 2658899.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.67 70.35% 182014.37 157064 293078 181642.87 0 233636 1396905 1396905 0.00
crit 3.23 29.64% 390285.80 327255 664021 380663.40 0 650063 1261995 1261995 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 25179 7.7% 37.4 9.84sec 246402 237432 183574 396043 246400 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.40 37.40 0.00 0.00 1.0378 0.0000 9215432.58 9215432.58 0.00 237431.60 237431.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.33 70.41% 183573.83 139099 401435 183510.74 156611 217139 4833874 4833874 0.00
crit 11.06 29.58% 396043.46 289823 950662 396205.50 295516 603641 4381559 4381559 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 33641 (51203) 10.2% (15.6%) 89.0 4.00sec 210458 148658 0 0 0 0.0% 0.0% 0.0% 0.0% 211.0 42611 94984 58347 30.0% 0.0% 31.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.05 89.05 211.02 211.02 1.4157 0.5531 12312489.48 12312489.48 0.00 148657.74 148657.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.03 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 147.6 69.95% 42610.70 36858 69446 42533.55 0 52298 6289999 6289999 0.00
crit 63.4 30.05% 94983.99 76796 173637 94747.97 0 113219 6022490 6022490 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 32571 (49422) 9.9% (15.0%) 49.3 6.94sec 367223 242425 0 0 0 0.0% 0.0% 0.0% 0.0% 116.3 76212 163662 102405 30.0% 0.0% 18.8%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.26 49.26 116.35 116.35 1.5148 0.5915 11921018.59 11921018.59 0.00 242425.39 242425.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.25 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.5 70.05% 76211.70 36858 132279 76536.80 40863 92394 6214444 6214444 0.00
crit 34.8 29.95% 163662.06 76796 313370 164156.73 87550 207119 5706574 5706574 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 16851 5.1% 55.2 6.16sec 111760 0 75835 196549 111827 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.19 55.12 0.00 0.00 0.0000 0.0000 6167551.73 6167551.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.67 70.15% 75835.23 36858 132279 76155.57 40505 93359 2934240 2934240 0.00
crit 16.44 29.83% 196548.66 92771 388585 197117.11 102591 262705 3233311 3233311 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 17563 5.3% 100.1 3.51sec 64221 0 42501 115035 64247 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.09 100.05 0.00 0.00 0.0000 0.0000 6427900.12 6427900.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.03 70.00% 42501.26 36858 69446 42423.47 0 49303 2976486 2976486 0.00
crit 30.00 29.99% 115035.07 92771 215313 114738.16 0 144735 3451414 3451414 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
multistrike_spell 11348 3.5% 181.4 1.99sec 22901 0 22901 0 22901 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.36 181.36 0.00 0.00 0.0000 0.0000 4153296.92 4153296.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.36 100.00% 22900.63 8570 316887 22902.48 16727 30469 4153297 4153297 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:311866.06
  • base_dd_max:311866.06
power_infusion 0 0.0% 4.0 120.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 15101 4.6% 20.7 4.83sec 266673 256829 198765 424677 266676 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.73 20.73 0.00 0.00 1.0384 0.0000 5526961.10 5526961.10 0.00 256829.05 256829.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.49 69.91% 198765.35 156358 452288 198740.57 158633 259571 2880111 2880111 0.00
crit 6.23 30.07% 424677.12 325785 942380 424269.39 0 892434 2646850 2646850 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31388 (48001) 9.5% (14.6%) 28.7 12.85sec 611992 589699 0 0 0 0.0% 0.0% 0.0% 0.0% 283.5 30186 64970 40524 29.7% 0.0% 122.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.71 28.71 283.48 283.48 1.0378 1.5755 11487895.38 11487895.38 0.00 36876.46 589699.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.70 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 199.2 70.28% 30186.00 25710 50852 30129.78 0 47771 6013799 6013799 0.00
crit 84.3 29.72% 64969.65 53569 127144 64805.62 0 100908 5474096 5474096 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 16613 5.1% 134.5 2.68sec 45193 0 30564 79863 45231 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.54 134.43 0.00 0.00 0.0000 0.0000 6080419.47 6080419.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.41 70.23% 30563.86 26996 50852 30504.88 0 46735 2885438 2885438 0.00
crit 40.01 29.76% 79862.65 67948 157661 79687.47 0 104456 3194981 3194981 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6603 2.0% 124.3 2.89sec 19447 0 15722 34063 21221 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.26 113.87 0.00 0.00 0.0000 0.0000 2416577.61 2416577.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.70 69.99% 15721.69 13769 25133 15687.77 0 24459 1252981 1252981 0.00
crit 34.16 30.00% 34062.56 28689 62840 33973.35 0 42511 1163596 1163596 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 3284 1.0% 35.2 9.02sec 34133 0 22943 57017 34133 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.21 35.21 0.00 0.00 0.0000 0.0000 1201873.43 1201873.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.64 67.14% 22942.85 17031 32641 23030.84 18928 31019 542394 542394 0.00
crit 11.57 32.85% 57016.93 35485 81611 56572.70 39337 81611 659480 659480 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16219.80
  • base_dd_max:16219.80
vampiric_touch 29797 (45464) 9.1% (13.8%) 30.4 11.99sec 547294 527077 0 0 0 0.0% 0.0% 0.0% 0.0% 241.6 33466 72530 45135 29.9% 0.0% 115.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.40 30.40 241.62 241.62 1.0384 1.7458 10905587.85 10905587.85 0.00 36699.87 527077.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.40 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 169.4 70.13% 33465.62 28140 56544 33403.18 0 50969 5670594 5670594 0.00
crit 72.2 29.87% 72530.41 58633 141377 72355.16 0 106198 5234994 5234994 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15667 4.8% 114.6 3.13sec 50034 0 33709 88495 50069 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.61 114.53 0.00 0.00 0.0000 0.0000 5734245.40 5734245.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.30 70.12% 33708.91 29548 56544 33641.19 0 42546 2706865 2706865 0.00
crit 34.21 29.87% 88495.02 74371 175310 88304.65 0 115310 3027381 3027381 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 110625 / 8422
melee 110198 2.6% 30.6 12.74sec 100226 115245 78488 180771 100226 31.1% 7.2% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.64 30.64 0.00 0.00 0.8697 0.0000 3070704.24 3070704.24 0.00 115245.05 115245.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.69 34.90% 78447.80 58973 121698 78665.30 61589 113512 838765 838765 0.00
hit (blocked) 0.83 2.70% 79009.60 58973 121698 44914.99 0 121698 65357 65357 0.00
crit 8.85 28.88% 180649.81 129060 292075 179842.55 0 279905 1598302 1598302 0.00
crit (blocked) 0.69 2.26% 182316.67 133640 292075 91103.47 0 292075 125976 125976 0.00
glance 6.83 22.31% 60007.14 44230 91273 59993.85 0 91273 410122 410122 0.00
glance (blocked) 0.53 1.74% 60539.31 44230 91273 25162.93 0 91273 32182 32182 0.00
parry 2.21 7.21% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 427 0.0% 7.4 0.78sec 1605 0 1068 2643 1605 34.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.40 7.40 0.00 0.00 0.0000 0.0000 11884.72 11884.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.87 65.84% 1067.57 895 1434 1077.39 0 1434 5204 5204 0.00
crit 2.53 34.14% 2643.19 2147 3442 2467.61 0 3442 6681 6681 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1109.26
  • base_dd_max:1109.26
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MFI_PI 11427
halo_heal 11427 100.0% 8.5 45.22sec 493437 0 43470 47020 44645 33.1% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.48 93.68 0.00 0.00 0.0000 0.0000 4182407.29 30224258.42 86.16 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.67 66.90% 43469.76 -0 354441 43177.45 0 140417 2724179 14715111 81.37
crit 31.01 33.10% 47020.30 -0 645784 46612.39 0 180267 1458229 15509148 90.42
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_PI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.9 0.0 24.1sec 24.1sec 27.51% 24.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 2.8 0.0 142.5sec 142.5sec 15.24% 15.24%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.24%

    Trigger Attempt Success

    • trigger_pct:99.96%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.5sec 23.3sec 41.84% 41.84%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.84%

    Trigger Attempt Success

    • trigger_pct:99.35%
power_infusion 4.0 0.0 120.8sec 120.8sec 17.07% 17.07%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 10.4 0.0 10.0sec 10.0sec 24.51% 49.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:24.51%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 7.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 8.1 2.0 46.8sec 36.8sec 24.59% 44.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.59%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.3 0.0 57.0sec 56.9sec 17.07% 17.07%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.07%

    Trigger Attempt Success

    • trigger_pct:99.88%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.73% 0.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.73%

Trigger Attempt Success

  • trigger_pct:20.81%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.57% 83.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.66% 60.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.68% 20.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 14.9 44.7 3.0 3.0 312289.4
halo Mana 8.5 327006.4 38592.1 38579.9 8.1
mind_blast Mana 37.4 323117.8 8639.7 8639.5 28.5
mind_flay Mana 89.0 251713.5 2827.7 2826.8 74.5
mind_flay_insanity Mana 49.3 144136.3 2923.6 2926.2 125.5
shadow_word_death Mana 20.7 159914.7 7716.9 7715.8 34.6
shadow_word_pain Mana 28.7 368258.5 12832.3 12828.3 47.7
vampiric_touch Mana 30.4 265826.3 8746.0 8743.2 62.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.03 455.76 (0.03%) 18000.00 0.00 0.00%
shadowfiend Mana 28.42 127894.13 (7.04%) 4499.56 127918.99 50.00%
Shadow Orbs from Mind Blast Shadow Orb 37.39 35.81 (77.45%) 0.96 1.59 4.24%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.42 10.42 (22.55%) 1.00 0.00 0.00%
Devouring Plague Health Health 219.93 2529260.29 (40.80%) 11500.52 2152671.89 45.98%
Vampiric Touch Mana Mana 356.04 1337438.94 (73.65%) 3756.46 455308.38 25.40%
halo_heal Health 8.47 403694.36 (6.51%) 47642.55 2296841.43 85.05%
external_healing Health 70.60 2904555.87 (46.85%) 41141.41 20249669.47 87.46%
mp5_regen Mana 1463.00 350192.08 (19.28%) 239.37 88707.92 20.21%
vampiric_embrace Health 156.33 361722.11 (5.83%) 2313.90 99882.61 21.64%
pet - shadowfiend
external_healing Health 11.33 106237.23 (92.31%) 9377.26 3911432.05 97.36%
vampiric_embrace Health 3.40 8854.74 (7.69%) 2603.66 1835.89 17.17%
Resource RPS-Gain RPS-Loss
Health 16937.79 17490.84
Mana 4961.70 5027.25
Shadow Orb 0.13 0.12
Combat End Resource Mean Min Max
Health 496271.66 121.09 709623.00
Mana 274656.97 117000.00 300000.00
Shadow Orb 1.58 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 20.3%
shadowfiend-Mana Cap 20.3%
mindbender-Mana Cap 20.3%

Procs

Count Interval
Shadowy Recall Extra Tick 474.8 0.8sec
Shadowy Apparition Procced 124.3 2.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 328738.89
Minimum 192038.92
Maximum 377351.49
Spread ( max - min ) 185312.57
Range [ ( max - min ) / 2 * 100% ] 28.19%
Standard Deviation 11798.1517
5th Percentile 312388.19
95th Percentile 346359.34
( 95th Percentile - 5th Percentile ) 33971.16
Mean Distribution
Standard Deviation 74.6300
95.00% Confidence Intervall ( 328592.62 - 328885.16 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4947
0.1 Scale Factor Error with Delta=300 1188260
0.05 Scale Factor Error with Delta=300 4753041
0.01 Scale Factor Error with Delta=300 118826039
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 328738.89
Minimum 192038.92
Maximum 377351.49
Spread ( max - min ) 185312.57
Range [ ( max - min ) / 2 * 100% ] 28.19%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 117235843.96
Minimum 68170458.00
Maximum 135209966.13
Spread ( max - min ) 67039508.12
Range [ ( max - min ) / 2 * 100% ] 28.59%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 11427.34
Minimum 0.00
Maximum 36789.49
Spread ( max - min ) 36789.49
Range [ ( max - min ) / 2 * 100% ] 160.97%
Standard Deviation 5561.3762
5th Percentile 3360.64
95th Percentile 21588.11
( 95th Percentile - 5th Percentile ) 18227.47
Mean Distribution
Standard Deviation 35.1789
95.00% Confidence Intervall ( 11358.39 - 11496.29 )
Normalized 95.00% Confidence Intervall ( 99.40% - 100.60% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9098
0.1% Error 909850
0.1 Scale Factor Error with Delta=300 264026
0.05 Scale Factor Error with Delta=300 1056107
0.01 Scale Factor Error with Delta=300 26402692
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 11427.34
Minimum 0.00
Maximum 36789.49
Spread ( max - min ) 36789.49
Range [ ( max - min ) / 2 * 100% ] 160.97%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 4182407.29
Minimum 0.00
Maximum 13464953.99
Spread ( max - min ) 13464953.99
Range [ ( max - min ) / 2 * 100% ] 160.97%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 9039.23
Minimum 5105.03
Maximum 12705.71
Spread ( max - min ) 7600.68
Range [ ( max - min ) / 2 * 100% ] 42.04%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 4.00 power_infusion,if=talent.power_infusion.enabled
C 10.30 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.36 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 38.66 mind_blast,if=active_enemies<=5&cooldown_react
F 10.42 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 4.50 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 18.32 mind_flay_insanity,interrupt=1,chain=1
I 17.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 17.43 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 11.21 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 14.23 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.21 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.54 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.47 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.54 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 3.20 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 36.80 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

ABEHEHEHDHEHHEHHEHDEHGHEHEHDHEHHGHEHEHDHEHBHEHHEHDEHGHEHEHHDHEHAHEHEHDEHGHEHEHHDEHGBHEHEHDEHHEHEHDEHFCEHDFCHHHHHHSSSHa8EFCHHDEFCHGHEDFCABH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 334951 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
334951.0 334951.0 156.57 / 0.05% 17764 / 5.3% 63.2 11764.4 11764.4 71.42 / 0.61% 9459 / 80.4% 2.3 5170.2 5094.0 Mana 0.26% 34.6 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.79 6.23 8.26 4.79 6.04 5.22
Normalized 1.00 0.80 1.06 0.61 0.78 0.67
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.22 0.22 0.22 0.22 0.23 0.22
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP ~= Haste > Mastery > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.79, SpellDamage=6.23, HitRating=8.26, CritRating=4.79, HasteRating=6.04, MasteryRating=5.22 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.79, SpellDamage=6.23, HitRating=0.00, CritRating=4.79, HasteRating=6.04, MasteryRating=5.22 )

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:947220|597498|533731|321735|294905|249971|248529|142622&chds=0,1894441&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++947220++devouring_plague,9482C9,0,0,15|t++597498++shadow_word_pain,9482C9,1,0,15|t++533731++vampiric_touch,9482C9,2,0,15|t++321735++halo,9482C9,3,0,15|t++294905++shadow_word_death,9482C9,4,0,15|t++249971++mind_flay_insanity,9482C9,5,0,15|t++248529++mind_blast,9482C9,6,0,15|t++142622++mind_flay,9482C9,7,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:10,10,10,9,8,6,6,5,5,5,5,5,4,3,3,3,2,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,C79C6E,336600,336600&chl=mind_flay_insanity|mind_flay|shadow_word_pain|vampiric_touch|mind_blast|essence_of_yulon|devouring_plague_tick|mind_flay_insanity_mastery|shadow_word_death|shadow_word_pain_mastery|mind_flay_mastery|vampiric_touch_mastery|multistrike_spell|devouring_plague|devouring_plague_mastery|shadowfiend: melee|halo_damage|shadowy_apparition|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.26,7.79,6.23,6.04,5.22,4.79|8.04,7.56,6.01,5.81,4.99,4.57|8.48,8.01,6.45,6.27,5.44,5.01&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.26++Hit,FFFFFF,0,0,15,0.1,e|t++++7.79++Int,FFFFFF,0,1,15,0.1,e|t++++6.23++SP,FFFFFF,0,2,15,0.1,e|t++++6.04++Haste,FFFFFF,0,3,15,0.1,e|t++++5.22++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.79++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.923& http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cfiloqsuvwy0145786331yxvuvuvxyxxwuusqpqppprstuusqqpnmliihhggfedbZYXYZZaabcdddefffeeeeefffgggffffgffgghijiiiihggffffeeeedcbbaaaZZaaabccdddeeeefeffghiiiiiiiiiiiijjiijjjjjjihgfggggghhhjkkkkkkkklmmmllkkjiihgggggghhhijklklllllmmnnnnnmmllkjiiihhhiiiihiihiiijjjkkkllmllllllmnoppqrststuvvxxyzzzzzzyxxwwvwwwwwwxxxxvuuuuuuutttttssrrqppqrrssttsstttuuvuvvvvvvvutsqqrqqoljgecaYVT&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6457,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=334951|max=518708&chxp=1,1,65,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:5,7,11,14,12,12,3,1,2,0,2,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3,31,88,244,578,991,1764,2565,3139,3507,3472,3055,2185,1543,857,487,227,115,48,17,5,0,2&chds=0,3507&chbh=5&chxt=x&chxl=0:|min=192944|avg=334951|max=385859&chxp=0,1,74,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:34.5,20.4,10.4,8.6,8.2,5.9,4.2,2.4,0.8,0.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 126.2s|mind_flay_insanity 74.8s|mind_blast 38.2s|vampiric_touch 31.5s|shadow_word_pain 30.0s|shadow_word_death 21.5s|devouring_plague 15.3s|halo 8.8s|shadowfiend 3.1s|dispersion 0.0s|waiting 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 334951
devouring_plague 11347 (39600) 3.4% (11.8%) 14.7 24.13sec 983130 947220 210352 451850 281714 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.74 14.74 0.00 0.00 1.0380 0.0000 4152995.95 4152995.95 0.00 947220.46 947220.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.38 70.42% 210351.54 173797 358674 210300.22 179267 260712 2183707 2183707 0.00
crit 4.36 29.56% 451850.25 362119 747325 449336.60 0 747325 1969289 1969289 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9774 2.9% 68.3 4.97sec 52353 0 35459 92010 52426 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.33 68.23 0.00 0.00 0.0000 0.0000 3577174.21 3577174.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.74 69.97% 35458.56 28967 59780 35464.55 31508 41687 1692919 1692919 0.00
crit 20.48 30.01% 92009.63 72910 152704 91935.81 74440 120683 1884255 1884255 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 18479 5.5% 14.7 24.13sec 458771 0 0 0 0 0.0% 0.0% 0.0% 0.0% 144.0 35053 75081 46973 29.8% 0.0% 23.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.74 14.74 143.98 143.98 0.0000 0.6085 6763250.08 6763250.08 0.00 77198.12 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.1 70.22% 35052.72 28967 84255 35057.25 31098 40527 3543931 3543931 0.00
crit 42.9 29.78% 75081.11 60355 175551 75014.09 63842 90517 3219319 3219319 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19825 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147.5 27372 59097 36844 29.9% 0.0% 32.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.22 147.49 196.94 0.0000 0.7951 7256044.75 7256044.75 0.00 61871.52 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.1 70.12% 27371.69 22500 47667 27371.70 24876 31275 3780105 3780105 0.00
crit 58.8 29.87% 59097.15 46880 112790 59069.23 52092 69666 3475940 3475940 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every {$t1=1} sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7730) 0.0% (2.3%) 8.5 45.35sec 334669 321735 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 8.45 0.00 0.00 1.0403 0.0000 0.00 0.00 0.00 321735.47 321735.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.93 70.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.53 29.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7730 2.3% 8.5 45.35sec 334669 0 191515 408489 255805 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 11.06 0.00 0.00 0.0000 0.0000 2829341.71 2829341.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.78 70.35% 191515.09 157064 320990 191023.71 0 305705 1490181 1490181 0.00
crit 3.28 29.64% 408489.15 327255 668808 398225.14 0 668808 1339161 1339161 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 25954 7.7% 36.8 9.99sec 258050 248529 192376 414265 258053 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.81 36.81 0.00 0.00 1.0383 0.0000 9499035.88 9499035.88 0.00 248529.23 248529.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.91 70.38% 192375.68 139099 461650 192315.77 163350 232413 4983923 4983923 0.00
crit 10.90 29.61% 414264.72 289823 961885 414291.10 289823 659637 4515113 4515113 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 32315 (49181) 9.6% (14.7%) 86.0 4.13sec 209232 142622 0 0 0 0.0% 0.0% 0.0% 0.0% 200.1 43350 95934 59116 30.0% 0.0% 32.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.03 86.03 200.07 200.07 1.4670 0.5850 11827399.14 11827399.14 0.00 142622.00 142622.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.02 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.1 70.02% 43350.33 36858 76060 43248.53 0 49239 6072813 6072813 0.00
crit 60.0 29.98% 95933.82 76796 180188 95664.72 0 113047 5754586 5754586 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 33631 (51083) 10.0% (15.3%) 48.2 7.13sec 388037 249971 0 0 0 0.0% 0.0% 0.0% 0.0% 113.8 80400 172902 108098 29.9% 0.0% 18.8%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.18 48.18 113.80 113.80 1.5523 0.6061 12308966.09 12308966.09 0.00 249970.75 249970.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.18 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.7 70.06% 80400.22 36858 152121 80803.92 41554 98936 6413776 6413776 0.00
crit 34.1 29.94% 172902.25 76796 316956 173587.64 88438 218341 5895190 5895190 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 17452 5.2% 54.0 6.33sec 118180 0 80062 207838 118242 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.05 53.99 0.00 0.00 0.0000 0.0000 6387345.97 6387345.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.84 70.10% 80062.19 36858 152121 80458.08 41433 102500 3031642 3031642 0.00
crit 16.14 29.89% 207837.94 92771 388585 208653.33 108359 282813 3355704 3355704 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 16866 5.0% 94.9 3.69sec 65074 0 43271 116223 65097 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.86 94.82 0.00 0.00 0.0000 0.0000 6172780.45 6172780.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.43 70.06% 43270.64 36858 76060 43166.66 0 49405 2874598 2874598 0.00
crit 28.38 29.93% 116223.22 92771 223436 115881.12 0 151104 3298183 3298183 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
multistrike_spell 11637 3.5% 175.7 2.05sec 24235 0 24235 0 24235 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.74 175.74 0.00 0.00 0.0000 0.0000 4259081.82 4259081.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.74 100.00% 24235.05 8570 361246 24236.90 17924 33716 4259082 4259082 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:46980.38
  • base_dd_max:46980.38
shadow_word_death 17353 5.2% 20.7 4.83sec 306198 294905 228279 488191 306198 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.74 20.74 0.00 0.00 1.0383 0.0000 6351077.25 6351077.25 0.00 294905.15 294905.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.52 70.00% 228279.34 179812 520132 228287.71 179812 304397 3314230 3314230 0.00
crit 6.22 29.99% 488191.01 374653 1083737 487776.54 0 882151 3036847 3036847 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32019 (49027) 9.6% (14.6%) 28.9 12.73sec 620187 597498 0 0 0 0.0% 0.0% 0.0% 0.0% 276.2 31611 67985 42424 29.7% 0.0% 121.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.93 28.93 276.23 276.23 1.0380 1.6150 11718882.42 11718882.42 0.00 37685.62 597497.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.93 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.1 70.27% 31611.01 25710 55695 31539.65 0 53237 6136092 6136092 0.00
crit 82.1 29.73% 67985.28 53569 116044 67786.33 0 105333 5582790 5582790 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.366000
  • base_td:779.65
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 17009 5.1% 131.1 2.75sec 47497 0 32170 83838 47528 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.07 130.98 0.00 0.00 0.0000 0.0000 6225165.53 6225165.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.01 70.25% 32169.78 26996 55695 32093.43 0 55092 2960027 2960027 0.00
crit 38.95 29.73% 83837.78 67948 163612 83611.37 0 140184 3265138 3265138 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=780} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.366000
  • base_dd_min:779.65
  • base_dd_max:779.65
shadowfiend 0 0.0% 3.0 180.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6401 1.9% 121.1 2.97sec 19352 0 15702 33976 21180 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.06 110.61 0.00 0.00 0.0000 0.0000 2342764.79 2342764.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.42 70.00% 15701.79 13769 25133 15660.15 0 25054 1215702 1215702 0.00
crit 33.17 29.99% 33976.27 28689 62840 33871.70 0 49613 1127063 1127063 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:0.00
  • base_dd_max:0.00
stormlash 2866 0.9% 30.8 10.34sec 34043 0 23081 56434 34042 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.81 30.81 0.00 0.00 0.0000 0.0000 1048924.02 1048924.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.68 67.11% 23081.36 18697 35749 23161.04 19240 31826 477276 477276 0.00
crit 10.13 32.87% 56434.41 40808 77725 56016.08 42508 77725 571648 571648 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16219.80
  • base_dd_max:16219.80
vampiric_touch 29985 (45876) 9.0% (13.7%) 30.3 12.00sec 554394 533731 0 0 0 0.0% 0.0% 0.0% 0.0% 233.7 34888 75433 46964 29.8% 0.0% 115.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.29 30.29 233.68 233.68 1.0387 1.8023 10974626.40 10974626.40 0.00 37096.09 533731.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.28 99.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 164.1 70.21% 34887.54 28140 61929 34808.20 0 61219 5724270 5724270 0.00
crit 69.6 29.79% 75433.05 58633 134645 75212.86 0 127061 5250357 5250357 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15891 4.7% 110.9 3.23sec 52454 0 35423 92742 52489 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.88 110.81 0.00 0.00 0.0000 0.0000 5816030.15 5816030.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.79 70.20% 35422.94 29548 61929 35336.42 0 50295 2755495 2755495 0.00
crit 33.00 29.78% 92741.59 74371 181729 92484.77 0 126594 3060535 3060535 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 110435 / 8419
melee 110009 2.5% 30.7 12.71sec 100057 115037 78419 180730 100061 31.0% 7.3% 23.9% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.68 30.68 0.00 0.00 0.8698 0.0000 3069310.35 3069310.35 0.00 115037.31 115037.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.75 35.03% 78373.89 58973 121698 78618.10 61263 111733 842235 842235 0.00
hit (blocked) 0.83 2.71% 79004.16 58973 121698 45058.60 0 121698 65621 65621 0.00
crit 8.82 28.76% 180632.72 129060 292075 179737.32 0 282339 1593680 1593680 0.00
crit (blocked) 0.70 2.28% 181955.63 133640 292075 92274.53 0 292075 126995 126995 0.00
glance 6.81 22.21% 59957.16 44230 91273 59933.28 0 91273 408419 408419 0.00
glance (blocked) 0.53 1.74% 60526.48 44230 91273 25356.72 0 91273 32361 32361 0.00
parry 2.23 7.26% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 90.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 425 0.0% 7.4 0.78sec 1602 0 1068 2640 1602 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.41 7.41 0.00 0.00 0.0000 0.0000 11861.55 11861.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.89 66.02% 1068.16 895 1434 1077.52 0 1434 5222 5222 0.00
crit 2.52 33.97% 2639.58 2147 3442 2468.66 0 3442 6640 6640 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1366.43
  • base_dd_max:1366.43
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MFI_ToF 11764
halo_heal 11764 100.0% 8.5 45.35sec 509307 0 45112 48148 46114 33.0% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.45 93.37 0.00 0.00 0.0000 0.0000 4305756.41 31620879.12 86.38 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.55 66.99% 45112.32 -0 407607 44757.63 0 193548 2821755 15438111 81.59
crit 30.82 33.01% 48148.32 -0 741918 47714.40 0 296676 1484002 16182769 90.61
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_ToF
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.7 0.0 24.4sec 24.4sec 27.58% 24.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 2.8 0.0 142.8sec 142.8sec 15.20% 15.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:15.20%

    Trigger Attempt Success

    • trigger_pct:99.93%
jade_serpent_potion 2.0 0.0 290.0sec 0.0sec 12.29% 12.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:12.29%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.3 5.4 36.5sec 23.3sec 41.80% 41.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.80%

    Trigger Attempt Success

    • trigger_pct:99.43%
shadow_word_death_reset_cooldown 10.4 0.0 10.0sec 10.0sec 24.49% 49.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:24.49%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.46% 6.92%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.46% 5.46%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 8.1 2.0 46.7sec 36.7sec 24.64% 53.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:24.64%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.3 0.0 57.5sec 57.3sec 16.93% 16.93%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.93%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 348.9 18.7sec 0.4sec 41.80% 41.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:41.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.72% 0.78%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.72%

Trigger Attempt Success

  • trigger_pct:20.34%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.5sec 90.5sec 85.59% 83.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.52% 60.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.65% 20.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 14.7 44.2 3.0 3.0 327769.0
halo Mana 8.5 342284.9 40500.0 40487.2 8.3
mind_blast Mana 36.8 331288.9 9000.0 8999.8 28.7
mind_flay Mana 86.0 258007.4 3000.0 2999.0 69.8
mind_flay_insanity Mana 48.2 144672.4 3000.0 3002.6 129.2
shadow_word_death Mana 20.7 161758.9 7800.0 7798.7 39.3
shadow_word_pain Mana 28.9 381798.9 13200.0 13195.8 47.0
vampiric_touch Mana 30.3 272492.3 9000.0 8997.2 61.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.03 526.32 (0.03%) 18000.00 0.00 0.00%
shadowfiend Mana 28.44 142368.80 (7.64%) 5005.11 113633.32 44.39%
Shadow Orbs from Mind Blast Shadow Orb 36.81 35.31 (77.19%) 0.96 1.49 4.05%
Shadow Orbs from Shadow Word: Death Shadow Orb 10.44 10.44 (22.81%) 1.00 0.00 0.00%
Devouring Plague Health Health 212.20 2471845.91 (39.86%) 11648.56 2045653.28 45.28%
Vampiric Touch Mana Mana 344.38 1359151.74 (72.90%) 3946.70 374796.90 21.62%
halo_heal Health 8.45 413856.14 (6.67%) 48968.48 2439244.03 85.49%
external_healing Health 70.62 2954148.35 (47.64%) 41830.88 20049454.84 87.16%
mp5_regen Mana 1463.00 362342.45 (19.43%) 247.67 76557.55 17.44%
vampiric_embrace Health 156.33 361536.28 (5.83%) 2312.71 100068.44 21.68%
pet - shadowfiend
external_healing Health 11.34 106706.35 (92.28%) 9413.15 3913377.66 97.35%
vampiric_embrace Health 3.42 8924.57 (7.72%) 2610.16 1817.47 16.92%
Resource RPS-Gain RPS-Loss
Health 16943.68 17490.84
Mana 5093.96 5170.23
Shadow Orb 0.13 0.12
Combat End Resource Mean Min Max
Health 498555.05 -39903.89 709623.00
Mana 271835.63 87300.00 300000.00
Shadow Orb 1.54 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 17.6%
shadowfiend-Mana Cap 17.6%
mindbender-Mana Cap 17.6%

Procs

Count Interval
Shadowy Recall Extra Tick 458.8 0.8sec
Shadowy Apparition Procced 121.1 3.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 334950.98
Minimum 192943.72
Maximum 385858.55
Spread ( max - min ) 192914.83
Range [ ( max - min ) / 2 * 100% ] 28.80%
Standard Deviation 12629.0105
5th Percentile 317564.56
95th Percentile 353091.73
( 95th Percentile - 5th Percentile ) 35527.18
Mean Distribution
Standard Deviation 79.8857
95.00% Confidence Intervall ( 334794.41 - 335107.55 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5461
0.1 Scale Factor Error with Delta=300 1361514
0.05 Scale Factor Error with Delta=300 5446058
0.01 Scale Factor Error with Delta=300 136151464
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 334950.98
Minimum 192943.72
Maximum 385858.55
Spread ( max - min ) 192914.83
Range [ ( max - min ) / 2 * 100% ] 28.80%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 119510886.63
Minimum 67651231.71
Maximum 137872060.01
Spread ( max - min ) 70220828.31
Range [ ( max - min ) / 2 * 100% ] 29.38%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 17490.84
Minimum 17490.84
Maximum 17490.84
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 11764.36
Minimum 0.00
Maximum 35552.36
Spread ( max - min ) 35552.36
Range [ ( max - min ) / 2 * 100% ] 151.10%
Standard Deviation 5760.3096
5th Percentile 3467.36
95th Percentile 22385.65
( 95th Percentile - 5th Percentile ) 18918.29
Mean Distribution
Standard Deviation 36.4372
95.00% Confidence Intervall ( 11692.95 - 11835.78 )
Normalized 95.00% Confidence Intervall ( 99.39% - 100.61% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9209
0.1% Error 920981
0.1 Scale Factor Error with Delta=300 283253
0.05 Scale Factor Error with Delta=300 1133014
0.01 Scale Factor Error with Delta=300 28325352
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 11764.36
Minimum 0.00
Maximum 35552.36
Spread ( max - min ) 35552.36
Range [ ( max - min ) / 2 * 100% ] 151.10%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 4305756.41
Minimum 0.00
Maximum 13012165.29
Spread ( max - min ) 13012165.29
Range [ ( max - min ) / 2 * 100% ] 151.10%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 9202.39
Minimum 5215.49
Maximum 12594.60
Spread ( max - min ) 7379.11
Range [ ( max - min ) / 2 * 100% ] 40.09%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 10.30 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
D 1.37 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
E 38.63 mind_blast,if=active_enemies<=5&cooldown_react
F 10.44 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
G 5.03 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
H 17.85 mind_flay_insanity,interrupt=1,chain=1
I 16.20 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
J 17.60 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
K 12.73 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
L 14.12 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
M 0.20 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.37 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
P 8.45 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 4.40 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 36.07 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 0.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

AEHEHEHDEHGHEHHEHDEHHEHEHEHHDEHGHEHEHDEHGHEHEHEHDEHGHHEHAHEHDHEHEHEHDHEHGHEHEHEHDHEHHEHEHEHDEFCHEDFCaEFCH8HDEFCHGHHEDFCHGEHFCHHAEDF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40230 36573 36573
Intellect 30840 27670 26363
Spirit 5251 4846 4846
Health 709623 658425 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 54066 41885 14225
Spell Hit 14.99% 13.79% 60
Spell Crit 30.33% 24.08% 7151
Spell Haste 50.50% 39.99% 16996
Spell Speed 50.50% 39.99% 16996
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 14.99% 13.79% 60
Melee Crit 20.29% 15.28% 7151
Melee Haste 43.33% 39.99% 16996
Swing Speed 57.67% 39.99% 16996
Expertise 0.00% 0.00% 0
Armor 45470 17762 17762
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.44% 35.91% 7167

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
Local Neck necklace_of_fading_light,id=105473
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
Local Waist belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
Local Legs leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
Local Feet boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
Local Wrists bracers_of_sonic_projection,id=105626,enchant=180int
Local Hands gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
Local Finger1 signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
Local Finger2 laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
Local Main Hand horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_80int_160haste_180int,reforge=crit_spi
neck=necklace_of_fading_light,id=105473
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=80int_160haste_80int_160haste_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=80int_160haste_60int,enchant=180int
chest=raiment_of_the_ternion_glory,id=99362,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=crit_haste
wrists=bracers_of_sonic_projection,id=105626,enchant=180int
hands=gloves_of_the_ternion_glory,id=99359,gems=80int_160mastery_80int_160haste_120int,enchant=170haste,reforge=mastery_crit
waist=belt_of_the_broken_pact,id=105646,gems=80int_160haste_320haste_320crit_120int,reforge=spi_haste
legs=leggings_of_furious_flame,id=105516,gems=320spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=boneinlaid_sandals,id=105493,gems=320haste_60hit,enchant=175haste,reforge=mastery_crit
finger1=signet_of_the_dinomancers,id=105606,gems=80int_160haste_60spi,enchant=160int,reforge=mastery_crit
finger2=laserslice_signet,id=105520,gems=320haste_60spi,enchant=160int
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=horned_mace_of_the_old_ones,id=105649,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=revelations_of_yshaarj,id=105650,gems=80int_160haste_60int,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36496
# gear_intellect=26146
# gear_spirit=4630
# gear_spell_power=14225
# gear_hit_rating=60
# gear_crit_rating=7151
# gear_haste_rating=16996
# gear_mastery_rating=7167
# gear_armor=17762
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=horned_mace_of_the_old_ones,heroic=1,elite=1,weapon=mace_2.40speed_5651min_10495max,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 366 - 366 ( 366.0 )

Performance:

Total Events Processed: 799463178
Max Event Queue: 233
Sim Seconds: 9150000
CPU Seconds: 1643.5200
Physical Seconds: 212.3750
Speed Up: 5567

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 366.00
95th Percentile 366.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 366.00 - 366.00 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 4748163 12973 2.95 196178 423571 18.0 18.0 29.9% 0.0% 0.0% 0.0% 19.76sec 4748163 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 4119786 11256 13.80 33007 86027 84.3 84.2 30.0% 0.0% 0.0% 0.0% 4.05sec 4119786 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 7864420 21487 29.13 32881 70837 18.0 177.7 30.0% 0.0% 0.0% 0.0% 19.76sec 7864420 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 7069743 19316 25.02 25905 56082 0.0 152.7 30.0% 0.0% 0.0% 0.0% 0.00sec 7069743 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.47 0 0 9.0 9.0 30.0% 0.0% 0.0% 0.0% 42.79sec 0 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 2845623 7775 1.93 181169 386001 9.0 11.7 29.8% 0.0% 0.0% 0.0% 42.79sec 2845623 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 3285647 8977 15.61 34094 35370 9.0 95.2 33.3% 0.0% 0.0% 0.0% 42.79sec 31032996 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 10437458 28518 7.69 165221 357039 46.9 46.9 29.8% 0.0% 0.0% 0.0% 7.81sec 10437458 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 10311980 28175 29.35 42172 93247 83.7 179.0 30.2% 0.0% 0.0% 0.0% 4.31sec 10311980 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 5353621 14627 13.91 41941 112388 84.9 84.8 30.1% 0.0% 0.0% 0.0% 4.18sec 5353621 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 11964794 32691 10.21 142307 308786 62.3 62.3 29.9% 0.0% 0.0% 0.0% 5.68sec 11964794 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 4252978 11620 28.83 24182 0 175.9 175.9 0.0% 0.0% 0.0% 0.0% 2.05sec 4252978 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 5416118 14798 3.48 190154 406806 21.2 21.2 30.0% 0.0% 0.0% 0.0% 4.73sec 5416118 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 11746097 32093 47.39 30194 65027 31.1 289.1 30.0% 0.0% 0.0% 0.0% 11.75sec 11746097 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 6191238 16916 22.47 30499 79608 137.2 137.1 29.9% 0.0% 0.0% 0.0% 2.64sec 6191238 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 2491697 6808 19.10 15831 34266 127.6 116.5 30.1% 0.0% 0.0% 0.0% 2.82sec 2491697 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 857290 2342 4.22 22389 55318 25.7 25.7 33.2% 0.0% 0.0% 0.0% 12.45sec 857290 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 11035453 30152 40.39 33211 71944 32.4 246.4 29.9% 0.0% 0.0% 0.0% 11.20sec 11035453 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 5830898 15931 19.16 33590 88109 117.0 116.9 29.9% 0.0% 0.0% 0.0% 3.07sec 5830898 366.00sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 3083919 110075 65.98 78273 181017 30.8 30.8 31.1% 7.3% 24.0% 6.7% 12.66sec 3083919 28.02sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.71 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.50sec 0 28.02sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 12176 435 15.83 1092 2705 7.4 7.4 34.4% 0.0% 0.0% 0.0% 0.78sec 12176 28.02sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 3955848 10808 2.44 197421 424568 14.9 14.9 29.9% 0.0% 0.0% 0.0% 23.91sec 3955848 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 3483472 9518 11.62 33185 86174 71.0 70.9 30.1% 0.0% 0.0% 0.0% 4.78sec 3483472 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 6649269 18167 24.53 33075 71007 14.9 149.6 30.0% 0.0% 0.0% 0.0% 23.91sec 6649269 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 7304187 19957 25.76 26159 56789 0.0 157.1 30.1% 0.0% 0.0% 0.0% 0.00sec 7304187 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 1.47 0 0 9.0 9.0 30.2% 0.0% 0.0% 0.0% 42.53sec 0 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 2905335 7938 1.95 183073 389978 9.0 11.9 29.8% 0.0% 0.0% 0.0% 42.53sec 2905335 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 3394358 9274 15.55 35267 36863 9.0 94.8 33.2% 0.0% 0.0% 0.0% 42.53sec 30848958 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 8214943 22445 6.13 163208 353173 37.4 37.4 29.8% 0.0% 0.0% 0.0% 9.85sec 8214943 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 11768214 32154 32.98 42779 94846 91.5 201.2 30.2% 0.0% 0.0% 0.0% 3.95sec 11768214 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 6121432 16725 15.63 42576 114444 95.4 95.4 30.1% 0.0% 0.0% 0.0% 3.74sec 6121432 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 12678446 34641 10.78 142671 309837 65.7 65.7 30.0% 0.0% 0.0% 0.0% 5.40sec 12678446 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 4204567 11488 28.92 23830 0 176.4 176.4 0.0% 0.0% 0.0% 0.0% 2.05sec 4204567 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.66 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 120.81sec 0 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 5429134 14834 3.52 188374 402817 21.5 21.5 30.1% 0.0% 0.0% 0.0% 4.68sec 5429134 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 12204773 33346 48.80 30472 65671 31.4 297.7 29.9% 0.0% 0.0% 0.0% 11.65sec 12204773 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 6434479 17581 23.13 30761 80398 141.3 141.1 29.9% 0.0% 0.0% 0.0% 2.56sec 6434479 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 2575679 7037 19.68 15859 34363 131.2 120.1 30.2% 0.0% 0.0% 0.0% 2.76sec 2575679 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 1009225 2757 4.76 23261 57856 29.1 29.1 33.2% 0.0% 0.0% 0.0% 10.99sec 1009225 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_embrace 15286 0 0 0.05 0 0 0.3 0.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 11617117 31741 41.97 33606 72911 33.1 256.0 29.9% 0.0% 0.0% 0.0% 10.97sec 11617117 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 6126402 16739 19.89 33928 89194 121.4 121.3 30.0% 0.0% 0.0% 0.0% 2.97sec 6126402 366.00sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 3075078 109783 65.90 78188 180731 30.8 30.8 31.1% 7.3% 24.0% 6.7% 12.67sec 3075078 28.01sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.71 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.50sec 0 28.01sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 12154 434 15.83 1090 2699 7.4 7.4 34.5% 0.0% 0.0% 0.0% 0.78sec 12154 28.01sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 4195646 11464 2.42 211394 453576 14.8 14.8 29.9% 0.0% 0.0% 0.0% 24.16sec 4195646 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 3605844 9852 11.22 35593 92363 68.5 68.4 30.1% 0.0% 0.0% 0.0% 4.97sec 3605844 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 6836120 18678 23.68 35269 75631 14.8 144.5 29.9% 0.0% 0.0% 0.0% 24.16sec 6836120 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 7478729 20434 24.94 27499 59460 0.0 152.2 30.0% 0.0% 0.0% 0.0% 0.00sec 7478729 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 1.47 0 0 9.0 9.0 30.1% 0.0% 0.0% 0.0% 42.48sec 0 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 3065007 8374 1.95 192496 410170 9.0 11.9 29.8% 0.0% 0.0% 0.0% 42.48sec 3065007 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 3467560 9474 15.56 36300 37026 9.0 94.9 33.2% 0.0% 0.0% 0.0% 42.48sec 32562035 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 8540561 23335 6.06 171756 371154 37.0 37.0 29.8% 0.0% 0.0% 0.0% 9.96sec 8540561 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 11714173 32006 32.09 43922 96781 90.7 195.7 30.1% 0.0% 0.0% 0.0% 3.98sec 11714173 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 6084081 16623 15.20 43723 116699 92.8 92.7 30.0% 0.0% 0.0% 0.0% 3.83sec 6084081 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 12915093 35287 10.47 149961 324837 63.8 63.8 29.9% 0.0% 0.0% 0.0% 5.56sec 12915093 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 4329802 11830 28.14 25221 0 171.7 171.7 0.0% 0.0% 0.0% 0.0% 2.11sec 4329802 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 6227309 17015 3.52 216149 462644 21.5 21.5 30.1% 0.0% 0.0% 0.0% 4.68sec 6227309 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 12435246 33976 47.51 31906 68646 31.5 289.8 29.9% 0.0% 0.0% 0.0% 11.67sec 12435246 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 6580366 17979 22.51 32379 84375 137.5 137.3 29.9% 0.0% 0.0% 0.0% 2.63sec 6580366 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.88sec 0 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 2492796 6811 19.12 15820 34258 127.8 116.6 30.1% 0.0% 0.0% 0.0% 2.82sec 2492796 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 905874 2475 4.31 23306 57059 26.3 26.3 33.1% 0.0% 0.0% 0.0% 12.21sec 905874 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_embrace 15286 0 0 0.04 0 0 0.3 0.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 11705363 31982 40.66 35029 75753 32.9 248.0 29.9% 0.0% 0.0% 0.0% 11.03sec 11705363 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 6224598 17007 19.28 35640 93341 117.7 117.6 30.0% 0.0% 0.0% 0.0% 3.06sec 6224598 366.00sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 3073464 109694 65.91 78146 180376 30.8 30.8 31.1% 7.3% 24.0% 6.7% 12.67sec 3073464 28.02sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.71 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.50sec 0 28.02sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 12059 430 15.85 1083 2681 7.4 7.4 34.2% 0.0% 0.0% 0.0% 0.78sec 12059 28.02sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 4703499 12851 2.92 195977 422713 17.8 17.8 29.9% 0.0% 0.0% 0.0% 19.93sec 4703499 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 4099307 11200 13.72 33005 86080 83.8 83.7 30.1% 0.0% 0.0% 0.0% 4.09sec 4099307 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 7803359 21321 28.99 32817 70628 17.8 176.8 29.9% 0.0% 0.0% 0.0% 19.93sec 7803359 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 6898468 18848 24.46 25819 55820 0.0 149.2 29.9% 0.0% 0.0% 0.0% 0.00sec 6898468 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.47 0 0 9.0 9.0 30.0% 0.0% 0.0% 0.0% 42.42sec 0 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 2905559 7939 1.96 181259 386507 9.0 12.0 29.8% 0.0% 0.0% 0.0% 42.42sec 2905559 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 3211278 8774 15.56 33359 34798 9.0 94.9 33.3% 0.0% 0.0% 0.0% 42.42sec 30913513 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 11379542 31092 7.64 181922 392398 46.6 46.6 29.6% 0.0% 0.0% 0.0% 7.87sec 11379542 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 15738503 43001 45.23 41932 92252 124.5 275.9 30.0% 0.0% 0.0% 0.0% 2.91sec 15738503 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 8183523 22359 21.44 41767 111276 130.9 130.8 29.9% 0.0% 0.0% 0.0% 2.76sec 8183523 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.14 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.78sec 0 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 3947298 10785 29.71 21777 0 181.3 181.3 0.0% 0.0% 0.0% 0.0% 2.00sec 3947298 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 5617575 15349 3.41 201567 430794 20.8 20.8 30.0% 0.0% 0.0% 0.0% 4.78sec 5617575 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 11661096 31861 47.32 30063 64701 31.0 288.7 29.8% 0.0% 0.0% 0.0% 11.76sec 11661096 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 6153735 16813 22.44 30394 79244 137.0 136.9 29.8% 0.0% 0.0% 0.0% 2.64sec 6153735 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 2466183 6738 19.01 15755 34097 126.9 116.0 30.1% 0.0% 0.0% 0.0% 2.84sec 2466183 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 963276 2632 4.76 22303 55156 29.0 29.0 33.1% 0.0% 0.0% 0.0% 11.01sec 963276 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 10996586 30045 40.32 33167 71828 32.3 245.9 29.9% 0.0% 0.0% 0.0% 11.28sec 10996586 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 5787426 15813 19.11 33463 87714 116.7 116.6 29.8% 0.0% 0.0% 0.0% 3.08sec 5787426 366.00sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 7650879 83698 61.15 66849 146274 93.2 93.2 30.3% 7.4% 24.0% 6.9% 3.83sec 7650879 91.41sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.42 0 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 20.13sec 0 91.41sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 28467 311 12.86 1016 2352 19.6 19.6 32.7% 0.0% 0.0% 0.0% 16.50sec 28467 91.41sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 3897178 10648 2.43 195979 421591 14.8 14.8 29.8% 0.0% 0.0% 0.0% 23.97sec 3897178 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3450102 9427 11.57 33076 85823 70.7 70.6 29.9% 0.0% 0.0% 0.0% 4.80sec 3450102 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 6539037 17866 24.40 32780 70263 14.8 148.8 29.8% 0.0% 0.0% 0.0% 23.97sec 6539037 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 7010664 19155 24.85 25989 56305 0.0 151.6 29.9% 0.0% 0.0% 0.0% 0.00sec 7010664 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.48 0 0 9.0 9.0 29.9% 0.0% 0.0% 0.0% 42.34sec 0 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 2931343 8009 1.97 182683 389561 9.0 12.0 29.8% 0.0% 0.0% 0.0% 42.34sec 2931343 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 3331423 9102 15.46 34868 36291 9.0 94.3 33.2% 0.0% 0.0% 0.0% 42.34sec 30530760 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 9131011 24948 6.10 182492 393989 37.2 37.2 29.7% 0.0% 0.0% 0.0% 9.89sec 9131011 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 17863459 48807 50.74 42395 93459 134.3 309.5 30.0% 0.0% 0.0% 0.0% 2.70sec 17863459 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 9317530 25458 24.07 42273 113021 146.9 146.8 29.9% 0.0% 0.0% 0.0% 2.46sec 9317530 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.14 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.77sec 0 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 3875059 10588 30.01 21167 0 183.1 183.1 0.0% 0.0% 0.0% 0.0% 1.97sec 3875059 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.62 0 0 3.8 3.8 0.0% 0.0% 0.0% 0.0% 121.38sec 0 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 5662402 15471 3.44 200872 429560 21.0 21.0 30.1% 0.0% 0.0% 0.0% 4.73sec 5662402 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 12009256 32812 48.59 30183 64919 31.3 296.4 29.7% 0.0% 0.0% 0.0% 11.62sec 12009256 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 6343052 17331 23.02 30546 79694 140.6 140.4 29.7% 0.0% 0.0% 0.0% 2.57sec 6343052 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 2521753 6890 19.48 15724 34024 129.9 118.8 30.0% 0.0% 0.0% 0.0% 2.77sec 2521753 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 1186745 3242 5.67 23026 57319 34.6 34.6 33.0% 0.0% 0.0% 0.0% 9.20sec 1186745 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_embrace 15286 0 0 0.05 0 0 0.3 0.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 11530072 31503 41.96 33424 72414 33.1 255.9 29.8% 0.0% 0.0% 0.0% 10.94sec 11530072 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 6063739 16568 19.89 33672 88325 121.4 121.3 29.8% 0.0% 0.0% 0.0% 2.96sec 6063739 366.00sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 7631378 83308 61.15 66631 145636 93.4 93.4 30.2% 7.4% 24.0% 6.9% 3.86sec 7631378 91.60sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.41 0 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 20.17sec 0 91.60sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 28308 309 12.84 1010 2341 19.6 19.6 32.6% 0.0% 0.0% 0.0% 16.51sec 28308 91.60sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 4112620 11237 2.40 210053 449974 14.6 14.6 29.5% 0.0% 0.0% 0.0% 24.29sec 4112620 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3577840 9776 11.17 35526 92203 68.2 68.1 30.0% 0.0% 0.0% 0.0% 4.99sec 3577840 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 6737472 18408 23.55 35002 75018 14.6 143.7 29.7% 0.0% 0.0% 0.0% 24.29sec 6737472 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 7211585 19704 24.06 27392 59163 0.0 146.8 29.9% 0.0% 0.0% 0.0% 0.00sec 7211585 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 1.48 0 0 9.0 9.0 29.9% 0.0% 0.0% 0.0% 42.41sec 0 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 3076981 8407 1.97 192377 409327 9.0 12.0 29.6% 0.0% 0.0% 0.0% 42.41sec 3076981 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 3162013 8639 15.43 33359 34068 9.0 94.1 33.1% 0.0% 0.0% 0.0% 42.41sec 32177654 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 9430161 25765 6.02 191184 412086 36.7 36.7 29.6% 0.0% 0.0% 0.0% 10.02sec 9430161 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 17609986 48115 48.60 43755 95956 131.4 296.4 30.0% 0.0% 0.0% 0.0% 2.75sec 17609986 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 9186836 25101 23.05 43665 116029 140.7 140.6 29.9% 0.0% 0.0% 0.0% 2.56sec 9186836 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.14 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.77sec 0 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 3982963 10882 29.11 22434 0 177.5 177.5 0.0% 0.0% 0.0% 0.0% 2.03sec 3982963 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 6505674 17775 3.44 230922 493551 21.0 21.0 30.1% 0.0% 0.0% 0.0% 4.73sec 6505674 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 12329923 33688 47.48 31718 68163 31.3 289.6 29.8% 0.0% 0.0% 0.0% 11.65sec 12329923 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 6534760 17855 22.52 32204 83843 137.5 137.4 29.8% 0.0% 0.0% 0.0% 2.63sec 6534760 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 2456608 6712 19.02 15707 33961 127.1 116.0 30.0% 0.0% 0.0% 0.0% 2.83sec 2456608 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 1020394 2788 4.88 23134 56783 29.8 29.8 33.1% 0.0% 0.0% 0.0% 10.73sec 1020394 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_embrace 15286 0 0 0.04 0 0 0.3 0.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 11647521 31824 40.64 34914 75435 32.9 247.9 29.8% 0.0% 0.0% 0.0% 11.06sec 11647521 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 6173491 16867 19.27 35431 92739 117.6 117.5 29.8% 0.0% 0.0% 0.0% 3.06sec 6173491 366.00sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 7610702 83201 60.97 66692 145849 93.0 93.0 30.2% 7.4% 24.0% 6.9% 3.86sec 7610702 91.47sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.42 0 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 20.16sec 0 91.47sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 28347 310 12.85 1011 2345 19.6 19.6 32.7% 0.0% 0.0% 0.0% 16.52sec 28347 91.47sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 4640746 12680 2.88 195993 422861 17.6 17.6 29.9% 0.0% 0.0% 0.0% 20.25sec 4640746 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 4023633 10994 13.49 32978 85924 82.4 82.3 30.0% 0.0% 0.0% 0.0% 4.15sec 4023633 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 7653598 20911 28.47 32775 70535 17.6 173.7 29.9% 0.0% 0.0% 0.0% 20.25sec 7653598 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 6896187 18842 24.45 25820 55823 0.0 149.1 29.9% 0.0% 0.0% 0.0% 0.00sec 6896187 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 1.34 0 0 8.2 8.2 29.8% 0.0% 0.0% 0.0% 46.65sec 0 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 2574257 7033 1.74 180725 387197 8.2 10.6 29.7% 0.0% 0.0% 0.0% 46.65sec 2574257 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 4147223 11331 14.77 44989 48173 8.2 90.1 33.2% 0.0% 0.0% 0.0% 46.65sec 29192177 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 11182721 30554 7.51 181847 392849 45.8 45.8 29.5% 0.0% 0.0% 0.0% 8.01sec 11182721 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 9624238 26296 27.47 41980 93352 73.3 167.6 30.1% 0.0% 0.0% 0.0% 4.85sec 9624238 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 5018089 13711 13.03 41827 112849 79.6 79.5 30.0% 0.0% 0.0% 0.0% 4.39sec 5018089 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 13080567 35739 21.25 74777 161445 54.7 129.6 30.1% 0.0% 0.0% 0.0% 6.24sec 13080567 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 6776084 18514 10.08 74316 193966 61.5 61.5 30.0% 0.0% 0.0% 0.0% 5.51sec 6776084 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 4190616 11450 29.10 23611 0 177.5 177.5 0.0% 0.0% 0.0% 0.0% 2.03sec 4190616 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 5537818 15131 3.38 200249 427992 20.6 20.6 30.1% 0.0% 0.0% 0.0% 4.87sec 5537818 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 10924974 29850 44.48 29988 64523 28.0 271.3 29.8% 0.0% 0.0% 0.0% 13.10sec 10924974 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 5789624 15819 21.09 30394 79329 128.7 128.7 29.9% 0.0% 0.0% 0.0% 2.80sec 5789624 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.92sec 0 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 2318364 6334 17.87 15752 34101 119.2 109.0 30.1% 0.0% 0.0% 0.0% 3.01sec 2318364 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 988810 2702 4.94 22169 54592 30.1 30.1 32.9% 0.0% 0.0% 0.0% 10.57sec 988810 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 10075147 27528 37.01 33114 71699 28.8 225.7 29.8% 0.0% 0.0% 0.0% 12.65sec 10075147 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 5326623 14554 17.55 33485 87910 107.1 107.0 29.9% 0.0% 0.0% 0.0% 3.34sec 5326623 366.00sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 3077537 110255 65.95 78564 181210 30.7 30.7 31.1% 7.3% 24.0% 6.7% 12.71sec 3077537 27.91sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.75 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.53sec 0 27.91sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 11965 429 15.90 1075 2660 7.4 7.4 34.3% 0.0% 0.0% 0.0% 0.78sec 11965 27.91sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 3937110 10757 2.44 196669 423426 14.9 14.9 29.8% 0.0% 0.0% 0.0% 23.85sec 3937110 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 3442875 9407 11.58 33005 85577 70.8 70.6 29.9% 0.0% 0.0% 0.0% 4.79sec 3442875 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 6579165 17976 24.47 32865 70453 14.9 149.3 29.8% 0.0% 0.0% 0.0% 23.85sec 6579165 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 7066544 19307 24.99 25976 56281 0.0 152.5 29.9% 0.0% 0.0% 0.0% 0.00sec 7066544 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 1.39 0 0 8.5 8.5 29.9% 0.0% 0.0% 0.0% 45.22sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 2658900 7265 1.79 182014 390286 8.5 10.9 29.6% 0.0% 0.0% 0.0% 45.22sec 2658900 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 4182407 11427 15.36 43470 47020 8.5 93.7 33.1% 0.0% 0.0% 0.0% 45.22sec 30224258 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 9215433 25179 6.13 183574 396043 37.4 37.4 29.6% 0.0% 0.0% 0.0% 9.84sec 9215433 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 12312489 33641 34.59 42611 94984 89.0 211.0 30.0% 0.0% 0.0% 0.0% 4.00sec 12312489 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 6427900 17563 16.40 42501 115035 100.1 100.0 30.0% 0.0% 0.0% 0.0% 3.51sec 6427900 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 11921019 32571 19.07 76212 163662 49.3 116.3 30.0% 0.0% 0.0% 0.0% 6.94sec 11921019 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 6167552 16851 9.04 75835 196549 55.2 55.1 29.8% 0.0% 0.0% 0.0% 6.16sec 6167552 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 4153297 11348 29.73 22901 0 181.4 181.4 0.0% 0.0% 0.0% 0.0% 1.99sec 4153297 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.66 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 120.84sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 5526961 15101 3.40 198765 424677 20.7 20.7 30.1% 0.0% 0.0% 0.0% 4.83sec 5526961 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 11487895 31388 46.47 30186 64970 28.7 283.5 29.7% 0.0% 0.0% 0.0% 12.85sec 11487895 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 6080419 16613 22.04 30564 79863 134.5 134.4 29.8% 0.0% 0.0% 0.0% 2.68sec 6080419 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.95sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 2416578 6603 18.67 15722 34063 124.3 113.9 30.0% 0.0% 0.0% 0.0% 2.89sec 2416578 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 1201873 3284 5.77 22943 57017 35.2 35.2 32.8% 0.0% 0.0% 0.0% 9.02sec 1201873 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 10905588 29797 39.61 33466 72530 30.4 241.6 29.9% 0.0% 0.0% 0.0% 11.99sec 10905588 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 5734245 15667 18.77 33709 88495 114.6 114.5 29.9% 0.0% 0.0% 0.0% 3.13sec 5734245 366.00sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 3070704 110193 65.97 78488 180771 30.6 30.6 31.1% 7.2% 24.0% 6.7% 12.74sec 3070704 27.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.77 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.54sec 0 27.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 11885 426 15.94 1068 2643 7.4 7.4 34.1% 0.0% 0.0% 0.0% 0.78sec 11885 27.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 4152996 11347 2.42 210352 451850 14.7 14.7 29.6% 0.0% 0.0% 0.0% 24.13sec 4152996 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3577174 9774 11.19 35459 92010 68.3 68.2 30.0% 0.0% 0.0% 0.0% 4.97sec 3577174 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 6763250 18479 23.60 35053 75081 14.7 144.0 29.8% 0.0% 0.0% 0.0% 24.13sec 6763250 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 7256045 19825 24.18 27372 59097 0.0 147.5 29.9% 0.0% 0.0% 0.0% 0.00sec 7256045 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 1.39 0 0 8.5 8.5 29.9% 0.0% 0.0% 0.0% 45.35sec 0 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 2829342 7730 1.81 191515 408489 8.5 11.1 29.6% 0.0% 0.0% 0.0% 45.35sec 2829342 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 4305756 11764 15.31 45112 48148 8.5 93.4 33.0% 0.0% 0.0% 0.0% 45.35sec 31620879 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 9499036 25954 6.03 192376 414265 36.8 36.8 29.6% 0.0% 0.0% 0.0% 9.99sec 9499036 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 11827399 32315 32.80 43350 95934 86.0 200.1 30.0% 0.0% 0.0% 0.0% 4.13sec 11827399 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 6172780 16866 15.55 43271 116223 94.9 94.8 29.9% 0.0% 0.0% 0.0% 3.69sec 6172780 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 12308966 33631 18.66 80400 172902 48.2 113.8 29.9% 0.0% 0.0% 0.0% 7.13sec 12308966 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 6387346 17452 8.85 80062 207838 54.0 54.0 29.9% 0.0% 0.0% 0.0% 6.33sec 6387346 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 4259082 11637 28.81 24235 0 175.7 175.7 0.0% 0.0% 0.0% 0.0% 2.05sec 4259082 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 6351077 17353 3.40 228279 488191 20.7 20.7 30.0% 0.0% 0.0% 0.0% 4.83sec 6351077 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 11718882 32019 45.28 31611 67985 28.9 276.2 29.7% 0.0% 0.0% 0.0% 12.73sec 11718882 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 6225166 17009 21.47 32170 83838 131.1 131.0 29.7% 0.0% 0.0% 0.0% 2.75sec 6225166 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.92sec 0 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 2342765 6401 18.13 15702 33976 121.1 110.6 30.0% 0.0% 0.0% 0.0% 2.97sec 2342765 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 1048924 2866 5.05 23081 56434 30.8 30.8 32.9% 0.0% 0.0% 0.0% 10.34sec 1048924 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 10974626 29985 38.31 34888 75433 30.3 233.7 29.8% 0.0% 0.0% 0.0% 12.00sec 10974626 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 5816030 15891 18.16 35423 92742 110.9 110.8 29.8% 0.0% 0.0% 0.0% 3.23sec 5816030 366.00sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 3069310 110001 65.96 78419 180730 30.7 30.7 31.0% 7.3% 23.9% 6.7% 12.71sec 3069310 27.90sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.75 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 90.53sec 0 27.90sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 11862 425 15.92 1068 2640 7.4 7.4 34.0% 0.0% 0.0% 0.0% 0.78sec 11862 27.90sec

Fluffy_Pillow : 177924 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
177923.7 177923.7 2.91 / 0.00% 368 / 0.2% -1.0 0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18&chs=550x275&chd=t:100&chds=0,100&chdls=ffffff&chco=9482C9&chl=raid_damage_shadow& DPS Taken Timeline Chart
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:EEJJJJJJLLLLLLOOJJJJLLGGGGJJGGGGJJGGGGJJGGGGJJGGGGJJHHHKKKHHLLLLILLLLLLLLLLLLLLLKKKKKJJJJJJJJJJJJJJJJJJJJJJJJJJJJJMKKKNNLLOOOLPPPPPPPPOOOONNNNMMMMLLLLLLLLLLLLLLLLLLLLLLLLLLLQOOTTQVVVYYYbZZbbZbbWZZUWWRUUPRROQQOQQOQQOQQOQQOQQOQQOQQOQQQQTRUUVVYWZZaadbeeeeddddccbbaaZZZZYYXXXXXXXXXXXXXXXXXXXXXXXaacdghklopstwx014577777765443210zzyxwvvvvvvvvvvvvvvvvvvvvvvvvvxz1zwuspnligd&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.3702,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=177924|max=480609&chxp=1,1,37,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:30,0,0,216,0,0,770,0,0,1,2112,0,0,3835,0,0,4951,0,0,118,4881,0,0,3915,0,0,2360,0,0,7,1163,0,0,440,0,0,143,0,0,0,43,0,0,6,0,0,0,0,0,1&chds=0,4951&chbh=5&chxt=x&chxl=0:|min=177229|avg=177924|max=179068&chxp=0,1,38,100&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 177924
raid_damage_shadow 177924 100.0% 1535.7 2.38sec 42405 0 42405 0 42405 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raid_damage_shadow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1535.67 1535.67 0.00 0.00 0.0000 0.0000 65120067.84 65120067.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1535.67 100.00% 42405.12 41360 44855 42405.12 42396 42420 65120068 65120068 0.00
DPS Timeline Chart

Action details: raid_damage_shadow

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_DI
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:44000.00
  • base_dd_max:44000.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 19.31% 19.31%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:19.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 7.99% 7.99%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:7.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.35% 9.35%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 9.25% 9.25%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:9.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.81% 9.81%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.00% 11.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.01% 10.01%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.37% 7.37%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.76% 5.76%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
flying

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_flying
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • flying_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals {$m2=100}% weapon damage, absorbs the next ${{$m1=100}/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2374901.59
Combat End Resource Mean Min Max
Health 1196.20 0.00 3110545.24
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 177923.68
Minimum 177229.40
Maximum 179067.72
Spread ( max - min ) 1838.32
Range [ ( max - min ) / 2 * 100% ] 0.52%
Standard Deviation 234.7893
5th Percentile 177597.07
95th Percentile 178332.40
( 95th Percentile - 5th Percentile ) 735.33
Mean Distribution
Standard Deviation 1.4852
95.00% Confidence Intervall ( 177920.77 - 177926.59 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 6
0.1 Scale Factor Error with Delta=300 470
0.05 Scale Factor Error with Delta=300 1882
0.01 Scale Factor Error with Delta=300 47058
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 177923.68
Minimum 177229.40
Maximum 179067.72
Spread ( max - min ) 1838.32
Range [ ( max - min ) / 2 * 100% ] 0.52%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 65120067.84
Minimum 64865961.90
Maximum 65538786.90
Spread ( max - min ) 672825.00
Range [ ( max - min ) / 2 * 100% ] 0.52%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 2718733.30
Minimum 2320719.26
Maximum 2828980.42
Spread ( max - min ) 508261.16
Range [ ( max - min ) / 2 * 100% ] 9.35%
Standard Deviation 35580.0179
5th Percentile 2664873.33
95th Percentile 2772457.22
( 95th Percentile - 5th Percentile ) 107583.89
Mean Distribution
Standard Deviation 225.0638
95.00% Confidence Intervall ( 2718292.19 - 2719174.42 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 6
0.1% Error 657
0.1 Scale Factor Error with Delta=300 10806772
0.05 Scale Factor Error with Delta=300 43227088
0.01 Scale Factor Error with Delta=300 1080677210
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 853952169 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
588155.7 0.0 Health 100.00% 0.0 32.8% 100%

Charts

DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|&chxp=1,1,-nan,100 http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 120.0s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 588155.69
Combat End Resource Mean Min Max
Health 842677023.72 839071155.07 845686388.99

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 120.00
Minimum 120.00
Maximum 120.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 588343.96
Minimum 421091.57
Maximum 674624.54
Spread ( max - min ) 253532.98
Range [ ( max - min ) / 2 * 100% ] 21.55%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 366.00
Vary Combat Length: 0.00

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.