close

SimulationCraft 540-5

for World of Warcraft 5.4.0 Live (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 movement,players_only=1,first=10,cooldown=10,duration=4
1 adds,count=3,first=45,cooldown=45,duration=10

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 7.71 - 5.74 - - - 5.06 - 5.08 7.34 4.74 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 7.57 - 5.76 - - - 4.93 - 5.08 6.49 4.38 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 7.73 - 5.75 - - - 5.84 - 5.13 7.42 4.31 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 7.58 - 5.79 - - - 5.29 - 5.21 6.83 4.68 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 7.89 - 5.83 - - - 5.04 - 5.45 6.69 4.48 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 7.85 - 5.95 - - - 5.81 - 5.25 7.87 4.45 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 7.39 - 5.52 - - - 5.22 - 4.88 7.00 4.72 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 7.64 - 5.69 - - - 6.33 - 5.14 8.01 4.74 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 7.74 - 5.86 - - - 6.89 - 5.18 8.39 4.72 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 300254 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
300254.3 300254.3 133.81 / 0.04% 17804 / 5.9% 45.4 6402.3 5038.6 Mana 0.52% 54.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.71 5.74 5.06 5.08 7.34 4.74
Normalized 1.00 0.74 0.66 0.66 0.95 0.61
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.19 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > Haste > SP > Crit ~= Hit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.71, SpellDamage=5.74, HitRating=5.06, CritRating=5.08, HasteRating=7.34, MasteryRating=4.74 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.71, SpellDamage=5.74, HitRating=0.00, CritRating=5.08, HasteRating=7.34, MasteryRating=4.74 )

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:880138|460839|335602|281458|258582|220454|192413|107754|81325&chds=0,1760277&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++880138++devouring_plague,9482C9,0,0,15|t++460839++halo,9482C9,1,0,15|t++335602++vampiric_touch,9482C9,2,0,15|t++281458++shadow_word_pain,9482C9,3,0,15|t++258582++shadow_word_death,9482C9,4,0,15|t++220454++mind_blast,9482C9,5,0,15|t++192413++mind_spike,4A79D3,6,0,15|t++107754++mind_flay,9482C9,7,0,15|t++81325++mind_sear,9482C9,8,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,10,9,8,8,8,7,6,5,4,4,4,4,3,3,3,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|mind_blast|shadowy_apparition|mind_spike|essence_of_yulon|vampiric_touch|devouring_plague_tick|shadow_word_pain_mastery|mind_flay|devouring_plague|halo_damage|multistrike_spell|vampiric_touch_mastery|devouring_plague_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.71,7.34,5.74,5.08,5.06,4.74|7.53,7.15,5.55,4.89,4.86,4.55|7.90,7.53,5.92,5.27,5.25,4.93&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.71++Int,FFFFFF,0,0,15,0.1,e|t++++7.34++Haste,FFFFFF,0,1,15,0.1,e|t++++5.74++SP,FFFFFF,0,2,15,0.1,e|t++++5.08++Crit,FFFFFF,0,3,15,0.1,e|t++++5.06++Hit,FFFFFF,0,4,15,0.1,e|t++++4.74++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.266& http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fikmptvy03576867542zyxxwvsrqpponmmlkjjiikmpqrssssrrrrqqppoonkhfdccbbbbbbbbbaaaabaabddeefghijjkkkkkkkkkkiihhgfddcbbbbbccccddddeeffgjmprttuuuvvvvvvuuuutroliggfeeddddddcccccbbcdeefgikmnopqqqqqqqqpponmljhfecbbbbbbbbbbbbbbbbbdehjkkkkllllllllmmmmkjhfeeeeeefffffggggggggijjjklnoppqqqqppppppnmllkigfeedcccccddccccdddddfhjlmmmmmmmmmmnnnnnmljhfeeedddddddddddddddeeghikmoqsuvwwxxyyyzzyyxwvtrpomllkkkkkkkkkkkkkkklmoqsssssssssssssssrqpnkjjiiiiiiiihhhhhhhhhijjklmmnoopppppppqqqpooonmmlkkjjjjjkkkkkkkllmmnopruwwxxyyyzzzzzzzzzyxvsrrqpppoooooonnmmmllmnnopppqrrttqomkjhgecZ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6188,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=300254|max=485233&chxp=1,1,62,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,2,3,6,19,22,37,64,97,161,215,348,421,520,742,851,1023,1214,1325,1484,1521,1650,1576,1552,1445,1337,1272,1067,1009,778,698,554,482,390,283,217,169,131,93,75,49,25,28,12,7,6,4,1,0,4&chds=0,1650&chbh=5&chxt=x&chxl=0:|min=261556|avg=300254|max=346610&chxp=0,1,45,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:28.5,20.4,13.5,12.8,9.9,4.9,3.8,2.5,0.7,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 128.2s|mind_flay 92.0s|mind_blast 60.9s|mind_spike 57.8s|vampiric_touch 44.8s|devouring_plague 21.9s|shadow_word_death 17.0s|halo 11.4s|shadowfiend 3.3s|mind_sear 0.1s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 300254
devouring_plague 12702 (42754) 4.2% (14.3%) 20.3 21.82sec 948691 880138 192045 416086 281878 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.31 20.31 0.00 0.00 1.0779 0.0000 5724426.29 5724426.29 0.00 880138.31 880138.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.13 59.72% 192045.42 169721 307820 192031.79 169721 236044 2329326 2329326 0.00
crit 8.16 40.18% 416086.08 353627 769642 416204.68 0 653957 3395100 3395100 0.00
miss 0.02 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9885 3.3% 84.1 5.09sec 52955 0 32172 84066 53023 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.11 84.00 0.00 0.00 0.0000 0.0000 4453806.21 4453806.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.11 59.66% 32171.68 28287 51304 32180.79 28741 37102 1612228 1612228 0.00
crit 33.80 40.24% 84066.15 71200 159064 84061.55 72710 105579 2841578 2841578 0.00
miss 0.08 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20167 6.7% 20.3 21.82sec 447503 0 0 0 0 0.0% 0.0% 0.0% 0.0% 192.5 32214 69531 47217 40.2% 0.0% 27.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.31 20.31 192.48 192.48 0.0000 0.6494 9087995.09 9087995.09 0.00 72712.10 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.1 59.80% 32213.81 28287 120534 32220.40 29008 80555 3707648 3707648 0.00
crit 77.4 40.20% 69531.37 58939 301371 69509.63 60737 158541 5380348 5380348 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 23989 8.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 174.5 25408 55374 37495 40.4% 0.1% 30.7%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.05 174.54 288.13 0.0000 0.7934 10803273.15 10803273.15 0.00 78008.17 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.6 59.55% 25408.34 21101 40897 25418.99 22905 28960 4359747 4359747 0.00
crit 116.4 40.39% 55373.78 43965 102254 55374.24 49256 65598 6443526 6443526 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (11620) 0.0% (3.9%) 10.5 44.34sec 496116 460839 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 10.54 0.00 0.00 1.0765 0.0000 0.00 0.00 0.00 460839.48 460839.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.28 59.58% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.25 40.31% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 11620 3.9% 10.5 44.34sec 496116 0 176890 382913 259715 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 20.14 0.00 0.00 0.0000 0.0000 5231449.76 5231449.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.02 59.69% 176890.46 153853 275756 177554.30 154708 243083 2126985 2126985 0.00
crit 8.11 40.25% 382913.05 320566 689472 383409.92 0 574560 3104464 3104464 0.00
miss 0.01 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 29826 9.9% 55.6 8.12sec 241691 220454 165054 357173 241691 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.59 55.59 0.00 0.00 1.0963 0.0000 13435598.29 13435598.29 0.00 220454.48 220454.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.31 59.92% 165054.48 135799 396163 165004.97 142306 192555 5498107 5498107 0.00
crit 22.22 39.98% 357172.92 282948 990526 357179.88 288993 488711 7937491 7937491 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14781 (22040) 4.9% (7.3%) 65.4 6.68sec 151585 107754 0 0 0 0.0% 0.1% 0.0% 0.0% 108.8 41295 90251 61106 40.5% 0.0% 15.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.38 65.38 108.76 108.76 1.4068 0.6312 6645977.84 6645977.84 0.00 107753.59 107753.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.31 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.7 59.53% 41294.64 35993 65277 41312.97 37484 47216 2673796 2673796 0.00
crit 44.0 40.47% 90250.98 74995 163211 90304.68 78671 108241 3972182 3972182 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7260 2.4% 47.5 8.88sec 68731 0 41234 109304 68756 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.50 47.48 0.00 0.00 0.0000 0.0000 3264766.14 3264766.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.21 59.41% 41234.21 35993 65277 41258.05 36352 48543 1163141 1163141 0.00
crit 19.23 40.49% 109304.42 90596 202384 109368.38 91197 144136 2101625 2101625 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 23 0.0% 0.1 121.19sec 90002 81325 0 0 0 0.0% 0.2% 0.0% 0.0% 0.1 23589 51509 34882 40.4% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.11 0.11 0.07 0.30 1.1115 0.6280 10328.28 10328.28 0.00 81325.07 81325.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.11 99.83% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.17% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 59.55% 23589.18 21183 36670 1172.76 0 36670 4160 4160 0.00
crit 0.1 40.45% 51509.18 44137 91686 2350.42 0 91686 6169 6169 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 11 0.0% 0.1 12.89sec 38306 0 23648 62062 38306 38.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.13 0.13 0.00 0.00 0.0000 0.0000 5099.42 5099.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.08 61.65% 23648.19 21183 36670 968.29 0 36670 1941 1941 0.00
crit 0.05 38.23% 62061.58 53319 113692 1952.76 0 113692 3159 3159 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (11) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 24697 8.2% 53.8 8.14sec 206888 192413 140555 305639 206888 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.75 53.75 0.00 0.00 1.0752 0.0000 11121058.61 11121058.61 0.00 192412.52 192412.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.05 59.63% 140555.33 110446 323346 140664.87 117909 172306 4504987 4504987 0.00
crit 21.65 40.27% 305638.58 230124 808460 305936.39 245461 394753 6616071 6616071 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11510 3.8% 235.6 1.96sec 21997 0 21997 0 21997 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.64 235.64 0.00 0.00 0.0000 0.0000 5183321.49 5183321.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.64 100.00% 21997.22 7034 371987 22013.63 15746 31571 5183321 5183321 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:35993.34
  • base_dd_max:35993.34
shadow_word_death 9733 3.2% 15.7 4.68sec 279562 258582 190570 411403 279570 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 1.0812 0.0000 4383487.33 4383487.33 0.00 258582.31 258582.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.34 59.56% 190569.77 152630 446332 190920.07 152630 297652 1779775 1779775 0.00
crit 6.33 40.36% 411403.35 318016 1115962 412646.63 0 1056039 2603712 2603712 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 36471 (80093) 12.2% (26.7%) 119.1 3.76sec 303055 281458 0 0 0 0.0% 0.1% 0.0% 0.0% 447.2 25011 54209 36739 40.2% 0.0% 141.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.06 119.06 447.22 447.22 1.0767 1.4210 16430279.69 16430279.69 0.00 47245.91 281458.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.97 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.09 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 267.6 59.83% 25010.59 21342 40629 25017.30 23557 27154 6692613 6692613 0.00
crit 179.6 40.17% 54209.02 44467 101583 54222.89 49896 60206 9737667 9737667 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18189 6.1% 195.4 2.28sec 41925 0 25383 66733 41959 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.45 195.29 0.00 0.00 0.0000 0.0000 8194090.09 8194090.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.69 59.75% 25383.03 22409 40629 25388.58 23707 27957 2962053 2962053 0.00
crit 78.40 40.15% 66733.24 56403 125965 66751.35 60302 74995 5232037 5232037 0.00
miss 0.19 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0853 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 25433 8.5% 258.0 1.73sec 44409 0 30388 66124 44844 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 258.03 255.53 0.00 0.00 0.0000 0.0000 11458604.29 11458604.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.17 59.55% 30388.42 26478 48441 30392.82 28341 33492 4624096 4624096 0.00
crit 103.36 40.45% 66124.45 55169 121116 66129.63 60577 74364 6834508 6834508 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1293 0.4% 3.1 88.00sec 183393 0 110736 276787 183401 43.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.12 3.12 0.00 0.00 0.0000 0.0000 572595.25 572595.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.75 56.06% 110736.15 83080 153360 93198.23 0 153360 193842 193842 0.00
crit 1.37 43.83% 276786.56 173104 383445 209619.89 0 383445 378754 378754 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 22422 (33378) 7.5% (11.1%) 37.6 11.95sec 399377 335602 0 0 0 0.0% 0.1% 0.0% 0.0% 207.2 33019 71860 48711 40.4% 0.0% 88.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.62 37.62 207.22 207.22 1.1900 1.9322 10093689.57 10093689.57 0.00 33753.11 335601.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.60 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.5 59.60% 33019.02 27457 53135 33034.76 30532 37172 4077879 4077879 0.00
crit 83.7 40.40% 71860.48 57209 132854 71880.89 63799 83986 6015810 6015810 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10956 3.6% 90.5 4.89sec 54509 0 32907 86847 54550 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.48 90.41 0.00 0.00 0.0000 0.0000 4931877.74 4931877.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.99 59.72% 32907.31 28830 53135 32918.23 30107 37858 1776667 1776667 0.00
crit 36.33 40.18% 86847.00 72566 164741 86877.05 75538 104763 3155210 3155210 0.00
miss 0.09 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 116291 / 9287
melee 115900 3.0% 35.6 11.06sec 115775 123854 76835 180253 115775 41.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.58 35.58 0.00 0.00 0.9348 0.0000 4118753.13 4118753.13 0.00 123853.65 123853.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.12 34.06% 76834.87 57590 120110 77024.68 62302 108897 930961 930961 0.00
crit 14.88 41.81% 180252.61 115181 288264 179898.36 132152 263466 2681354 2681354 0.00
glance 8.55 24.03% 59250.44 43193 90083 59252.12 0 90083 506438 506438 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0757 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 391 0.0% 1.4 1.68sec 9895 0 5884 14474 9895 46.8% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.40 0.00 0.00 0.0000 0.0000 13814.35 13814.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 53.04% 5883.81 4377 7078 3212.51 0 7078 4357 4357 0.00
crit 0.65 46.80% 14473.90 10506 16987 7170.92 0 16987 9457 9457 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 29.1 3.0 14.8sec 13.4sec 8.95% 50.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.95%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.3 0.0 21.8sec 21.8sec 13.44% 16.08%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:13.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 123.5sec 123.5sec 17.80% 17.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.80%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.57% 41.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.57%

    Trigger Attempt Success

    • trigger_pct:99.40%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.78% 49.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.78%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 42.6 17.0 10.3sec 7.4sec 31.33% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:24.65%
  • surge_of_darkness_2:6.68%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 22.98% 53.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.98%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.2sec 55.0sec 17.67% 17.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.67%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.85% 56.90%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.29% 16.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 20.3 60.9 3.0 3.0 316429.3
halo Mana 10.5 427064.4 40500.0 40499.9 12.2
mind_blast Mana 55.6 228174.8 4104.6 4104.6 58.9
mind_flay Mana 65.4 196144.7 3000.0 3000.0 50.5
mind_sear Mana 0.1 1032.5 9000.0 8997.1 10.0
shadow_word_death Mana 15.7 122309.9 7800.0 7800.5 35.8
shadow_word_pain Mana 119.1 1571616.3 13200.0 13199.7 23.0
vampiric_touch Mana 37.6 338600.5 9000.0 8999.9 44.4
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.54 261784.87 (11.53%) 7366.00 58071.89 18.16%
Shadow Orbs from Mind Blast Shadow Orb 55.53 54.45 (87.32%) 0.98 1.09 1.96%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.91 7.91 (12.68%) 1.00 0.00 0.00%
Devouring Plague Health Health 276.47 0.00 (0.00%) 0.00 5879043.73 100.00%
Vampiric Touch Mana Mana 297.63 1479101.08 (65.15%) 4969.59 35443.04 2.34%
halo_heal Health 10.54 0.00 (0.00%) 0.00 3648300.11 100.00%
external_healing Health 83.47 0.00 (0.00%) 0.00 29348744.75 100.00%
mp5_regen Mana 1801.93 529522.78 (23.32%) 293.86 11056.31 2.05%
pet - shadowfiend
external_healing Health 21.15 0.00 (0.00%) 0.00 7893103.18 100.00%
Resource RPS-Gain RPS-Loss
Mana 5038.55 6402.35
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -317709.70 -860100.00 166200.00
Shadow Orb 1.46 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%
shadowfiend-Mana Cap 2.1%
mindbender-Mana Cap 2.1%

Procs

Count Interval
Shadowy Recall Extra Tick 417.3 1.1sec
Shadowy Apparition Procced 258.0 1.7sec
Divine Insight Mind Blast CD Reset 54.5 13.4sec
FDCL Mind Spike proc 59.5 7.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 300254.28
Minimum 261555.64
Maximum 346609.93
Spread ( max - min ) 85054.30
Range [ ( max - min ) / 2 * 100% ] 14.16%
Standard Deviation 10793.0407
5th Percentile 283134.30
95th Percentile 318743.02
( 95th Percentile - 5th Percentile ) 35608.72
Mean Distribution
Standard Deviation 68.2721
95.00% Confidence Intervall ( 300120.47 - 300388.09 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4963
0.1 Scale Factor Error with Delta=300 994423
0.05 Scale Factor Error with Delta=300 3977693
0.01 Scale Factor Error with Delta=300 99442331
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 300254.28
Minimum 261555.64
Maximum 346609.93
Spread ( max - min ) 85054.30
Range [ ( max - min ) / 2 * 100% ] 14.16%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 131031724.52
Minimum 94550969.43
Maximum 171289489.75
Spread ( max - min ) 76738520.32
Range [ ( max - min ) / 2 * 100% ] 29.28%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.77 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 3.75 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.52 mind_blast,if=active_enemies<=5&cooldown_react
I 7.91 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.93 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 33.44 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 5.00 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.87 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 16.56 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 9.42 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.54 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.07 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 12.71 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 44.34 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.11 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 65.38 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 84.13 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLHMSZZZcXccHQWWHOXXXcXZHZZZccHQMXZWWWHZcXccZLHLLSXccHMQZZHccZHZZHQcXMZZHZccXWHZOZZLLLHMMMQRNHRSMXZZccccHXZOXcXXcHQXZXcXXHLLLMHXcXMSZHQRXccMXWHZZcccZWHOZcccXZHQZXALHLLMMMMSXNNHRXXOZcccHQZXZccccHMXZXcccHLLLMMSXHMQZWWHZcccHZXOZcccXHQXXZccXcHMZZLLLHMMMSOXcccHMQZZcccHXZZZccccHMZZZcccHLLGHLHSHGHHMRXcccWHQXZZccHMZZZccHHQXZOZALLHLMMMSNRXcHMZIFQXcHZWHIFQHXcMZIFHcccZLIFHLLHHMGI8FSWHNXcZVIFOHQXccZIFHXcXcHGIFMZLLLH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 303038 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
303038.2 303038.2 130.34 / 0.04% 17309 / 5.7% 42.3 6945.2 4962.9 Mana 0.07% 53.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.57 5.76 4.93 5.08 6.49 4.38
Normalized 1.00 0.76 0.65 0.67 0.86 0.58
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.19 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Haste > SP > Crit ~= Hit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.57, SpellDamage=5.76, HitRating=4.93, CritRating=5.08, HasteRating=6.49, MasteryRating=4.38 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.57, SpellDamage=5.76, HitRating=0.00, CritRating=5.08, HasteRating=6.49, MasteryRating=4.38 )

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:867339|647032|325334|273843|264168|223378|195776|113558|48164&chds=0,1734677&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++867339++devouring_plague,9482C9,0,0,15|t++647032++halo,9482C9,1,0,15|t++325334++vampiric_touch,9482C9,2,0,15|t++273843++shadow_word_pain,9482C9,3,0,15|t++264168++shadow_word_death,9482C9,4,0,15|t++223378++mind_blast,9482C9,5,0,15|t++195776++mind_spike,4A79D3,6,0,15|t++113558++mind_flay,9482C9,7,0,15|t++48164++mind_sear,9482C9,8,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,9,9,9,8,8,7,6,5,5,4,4,4,3,3,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_spike|essence_of_yulon|mind_blast|vampiric_touch|shadow_word_pain_mastery|devouring_plague_tick|halo_damage|mind_flay|multistrike_spell|vampiric_touch_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.57,6.49,5.76,5.08,4.93,4.38|7.39,6.31,5.58,4.90,4.74,4.20|7.75,6.68,5.95,5.27,5.12,4.57&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.57++Int,FFFFFF,0,0,15,0.1,e|t++++6.49++Haste,FFFFFF,0,1,15,0.1,e|t++++5.76++SP,FFFFFF,0,2,15,0.1,e|t++++5.08++Crit,FFFFFF,0,3,15,0.1,e|t++++4.93++Hit,FFFFFF,0,4,15,0.1,e|t++++4.38++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.092& http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkmoqvy0357777585430zyxxvtrqponmmlljihfehjklmmnnnoopppooonnnifdbaaZYYXWWVVVVWWXYYZZdeffghjjkkkkjiihhggfbbabbbZaaaaabbbcdddeeffffffkoqsuvwxyzz0000zzyxxrnligfdcaZYXXWWWXXYYZZabcdefhjlmnooonmllkkjihggffcbbaaZZZaaaaaaaaaZZYYZbceffghiijkkllllmmmljhfefedddddddddefgghhilmnnnnppqqqqponmlkjifeddddbbbbbbbbbbbbbbccbbbaacdfghhiijjkklllllllligedccbbaaZZYYYZZaabbbcdegijmpruvxxyyyzzz0zzyxxwurqpommlllkkkjjjiihhhghjlmnnoooppppqqqqpppomjigggfffeeeeeeeeeffffhhijkkklmmnnnnnnnnnnllkkkjjiihhghhhiijjkklmnooprtwz1233322221110000ywtqponnmlllkkkjjiiiihhijkklnoppqqroljhfedbZX&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5931,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=303038|max=510953&chxp=1,1,59,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,2,11,7,21,48,62,98,137,209,283,392,532,633,843,1016,1178,1358,1433,1607,1566,1665,1588,1526,1479,1265,1164,1012,805,676,547,478,366,244,200,153,100,108,60,33,27,17,13,12,5,6,0,2,1,1&chds=0,1665&chbh=5&chxt=x&chxl=0:|min=265962|avg=303038|max=350972&chxp=0,1,44,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:31.9,20.1,13.1,10.7,10.5,4.1,3.8,2.5,0.7,0.1,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 143.6s|mind_flay 90.7s|mind_spike 58.8s|mind_blast 48.2s|vampiric_touch 47.4s|devouring_plague 18.4s|shadow_word_death 16.9s|halo 11.2s|shadowfiend 3.3s|mind_sear 0.3s|waiting 0.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 303038
devouring_plague 10525 (35341) 3.5% (11.7%) 17.1 25.98sec 933286 867339 190945 408669 277919 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 0.00 0.00 1.0760 0.0000 4743584.69 4743584.69 0.00 867338.54 867338.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 59.90% 190944.99 169721 323211 190938.28 169721 241914 1952229 1952229 0.00
crit 6.83 40.02% 408669.04 353627 808124 409061.84 0 639481 2791356 2791356 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8186 2.7% 70.7 6.02sec 52222 0 32010 82770 52309 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.66 70.54 0.00 0.00 0.0000 0.0000 3690010.58 3690010.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.23 59.87% 32010.30 28287 53869 32024.72 28702 38013 1351829 1351829 0.00
crit 28.25 40.05% 82769.87 71200 167017 82787.04 71830 104875 2338182 2338182 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16629 5.5% 17.1 25.98sec 439175 0 0 0 0 0.0% 0.0% 0.0% 0.0% 161.7 31885 68158 46359 39.9% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 161.70 161.70 0.0000 0.6456 7495944.43 7495944.43 0.00 71807.80 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.2 60.10% 31885.40 28287 152835 31899.39 28779 51808 3098557 3098557 0.00
crit 64.5 39.90% 68158.27 58939 362013 68163.12 59737 104794 4397387 4397387 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25566 8.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 181.0 25799 56492 38193 40.4% 0.1% 31.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 37.33 181.03 301.48 0.0000 0.7938 11514503.17 11514503.17 0.00 80128.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.4 59.52% 25799.36 21101 42942 25811.46 23287 30618 4629262 4629262 0.00
crit 121.9 40.43% 56492.46 43965 107367 56494.84 49658 68241 6885241 6885241 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (16020) 0.0% (5.3%) 10.4 44.86sec 691277 647032 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.44 10.44 0.00 0.00 1.0685 0.0000 0.00 0.00 0.00 647031.83 647031.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.20 59.40% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.23 40.51% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 16020 5.3% 10.4 44.86sec 691277 0 177143 384054 260427 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.44 27.70 0.00 0.00 0.0000 0.0000 7214404.91 7214404.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.53 59.69% 177143.28 153853 289544 177277.87 155135 222753 2928938 2928938 0.00
crit 11.16 40.28% 384054.23 320566 723945 383322.30 320566 515929 4285467 4285467 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 23907 7.9% 45.1 10.08sec 238976 223378 163455 353028 238977 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.07 45.07 0.00 0.00 1.0698 0.0000 10769485.46 10769485.46 0.00 223377.70 223377.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.03 59.99% 163455.39 135799 415972 163445.27 140337 196481 4418794 4418794 0.00
crit 17.99 39.92% 353027.51 282948 1040052 353173.09 290488 466969 6350692 6350692 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 15341 (22916) 5.1% (7.5%) 65.6 6.65sec 156954 113558 0 0 0 0.0% 0.1% 0.0% 0.0% 110.0 42165 92539 62653 40.7% 0.0% 14.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.60 65.60 110.02 110.02 1.3822 0.6019 6893342.59 6893342.59 0.00 113557.98 113557.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.54 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.3 59.33% 42164.68 35993 68540 42187.87 38083 48074 2752307 2752307 0.00
crit 44.7 40.67% 92539.07 74995 171371 92602.57 80627 113112 4141036 4141036 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7574 2.5% 48.1 8.67sec 70692 0 42247 112476 70712 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.14 48.12 0.00 0.00 0.0000 0.0000 3402959.90 3402959.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.55 59.32% 42246.88 35993 68540 42271.31 36495 51046 1206029 1206029 0.00
crit 19.53 40.59% 112476.27 90596 212503 112547.95 91387 154079 2196931 2196931 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 27 0.0% 0.2 144.77sec 52406 48164 0 0 0 0.0% 0.2% 0.0% 0.0% 0.1 23978 53928 35849 39.6% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.24 0.24 0.09 0.35 1.0896 0.5869 12426.35 12426.35 0.00 48164.13 48164.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.24 99.83% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.17% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 60.32% 23978.19 21183 38503 1437.59 0 38503 5014 5014 0.00
crit 0.1 39.65% 53928.25 44137 96270 2929.21 0 96270 7412 7412 0.00
miss 0.0 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 14 0.0% 0.2 8.79sec 40991 0 23953 66341 40992 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.15 0.15 0.00 0.00 0.0000 0.0000 6232.56 6232.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.09 59.68% 23953.19 21183 38503 1153.79 0 38503 2174 2174 0.00
crit 0.06 40.24% 66340.62 53319 119377 2539.73 0 119377 4059 4059 0.00
miss 0.00 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (14) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 25581 8.4% 55.1 7.94sec 209134 195776 141525 309223 209133 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.08 55.08 0.00 0.00 1.0682 0.0000 11519658.84 11519658.84 0.00 195776.05 195776.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.78 59.52% 141524.69 110446 339513 141639.31 119368 172285 4639830 4639830 0.00
crit 22.25 40.39% 309222.51 230124 848883 309463.91 241833 409049 6879829 6879829 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11480 3.8% 237.4 1.95sec 21776 0 21776 0 21776 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.37 237.37 0.00 0.00 0.0000 0.0000 5169069.56 5169069.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 237.37 100.00% 21776.17 7034 390587 21793.76 16262 31172 5169070 5169070 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:28287.47
  • base_dd_max:28287.47
power_infusion 0 0.0% 4.3 120.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9931 3.3% 15.8 4.65sec 283383 264168 192710 416860 283385 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.77 15.77 0.00 0.00 1.0727 0.0000 4469201.64 4469201.64 0.00 264168.44 264168.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.37 59.41% 192710.30 152630 468649 193082.96 152630 289603 1805664 1805664 0.00
crit 6.39 40.52% 416860.00 318016 1171761 418063.33 0 772610 2663538 2663538 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 39689 (87299) 13.1% (28.8%) 134.4 3.34sec 292718 273843 0 0 0 0.0% 0.1% 0.0% 0.0% 479.3 25360 55059 37307 40.2% 0.0% 143.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.36 134.36 479.30 479.30 1.0689 1.3450 17880892.25 17880892.25 0.00 49893.15 273843.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.27 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.5 59.77% 25359.87 21342 42660 25366.15 23800 27944 7265559 7265559 0.00
crit 192.8 40.23% 55059.14 44467 106663 55073.37 50766 61144 10615333 10615333 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19823 6.5% 209.3 2.13sec 42666 0 25760 67877 42702 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 209.31 209.14 0.00 0.00 0.0000 0.0000 8930434.07 8930434.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.70 59.63% 25760.01 22409 42660 25765.80 24045 28209 3212328 3212328 0.00
crit 84.24 40.28% 67876.61 56403 132264 67899.06 60938 78021 5718106 5718106 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0851 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 27787 9.2% 277.0 1.61sec 45190 0 30861 67330 45645 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 277.03 274.27 0.00 0.00 0.0000 0.0000 12518898.28 12518898.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.08 59.46% 30860.67 26478 50863 30865.66 28831 34076 5032780 5032780 0.00
crit 111.19 40.54% 67329.63 55169 127172 67336.51 61092 76903 7486119 7486119 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1377 0.4% 3.2 86.63sec 192398 0 115391 290700 192395 44.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.17 3.17 0.00 0.00 0.0000 0.0000 610120.37 610120.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.77 55.86% 115390.88 83080 161028 97021.10 0 161028 204388 204388 0.00
crit 1.40 44.01% 290699.53 173104 402617 222436.73 0 402617 405733 405733 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 23032 (34290) 7.6% (11.3%) 38.2 11.73sec 403595 325334 0 0 0 0.0% 0.1% 0.0% 0.0% 207.4 33698 73800 49955 40.5% 0.0% 85.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.23 38.23 207.44 207.44 1.2406 1.8493 10362966.34 10362966.34 0.00 35795.92 325333.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.21 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.3 59.46% 33697.81 27457 55792 33720.02 30587 37625 4156502 4156502 0.00
crit 84.1 40.54% 73800.10 57209 139496 73836.71 65804 86184 6206464 6206464 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11258 3.7% 90.7 4.88sec 55860 0 33506 89010 55902 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.71 90.64 0.00 0.00 0.0000 0.0000 5066972.22 5066972.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.93 59.50% 33506.50 28830 55792 33520.12 30390 38698 1807067 1807067 0.00
crit 36.62 40.41% 89009.98 72566 172978 89055.27 76408 117280 3259906 3259906 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 116344 / 9290
melee 115949 3.0% 35.6 11.06sec 115814 123893 76861 180317 115812 41.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.58 35.58 0.00 0.00 0.9348 0.0000 4120178.08 4120178.08 0.00 123892.77 123892.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.12 34.06% 76860.65 57590 120110 77034.90 62095 108375 931374 931374 0.00
crit 14.87 41.80% 180316.59 115181 288264 179956.19 137313 288264 2681610 2681610 0.00
glance 8.55 24.03% 59322.35 43193 90083 59320.99 0 90083 507194 507194 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0684 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 395 0.0% 1.4 1.71sec 10017 0 5900 14534 10016 47.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 13972.68 13972.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.73 52.13% 5900.27 4377 7078 3173.61 0 7078 4291 4291 0.00
crit 0.67 47.75% 14533.67 10506 16987 7316.54 0 16987 9682 9682 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.1 0.0 26.0sec 26.0sec 14.80% 14.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:14.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 123.4sec 123.4sec 17.83% 17.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.83%

    Trigger Attempt Success

    • trigger_pct:99.88%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.61% 41.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.61%

    Trigger Attempt Success

    • trigger_pct:99.36%
power_infusion 4.3 0.0 120.6sec 120.6sec 18.65% 18.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.8sec 9.8sec 14.89% 49.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.89%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.81%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 43.6 16.0 10.1sec 7.4sec 28.59% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:23.25%
  • surge_of_darkness_2:5.34%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 22.96% 43.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.96%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.2sec 55.0sec 17.67% 17.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.67%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.93% 57.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.29% 16.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 17.1 51.2 3.0 3.0 311265.6
halo Mana 10.4 398919.8 38224.3 38224.1 18.1
mind_blast Mana 45.1 390331.7 8661.5 8661.5 27.6
mind_flay Mana 65.6 188153.5 2868.1 2868.2 54.7
mind_sear Mana 0.2 2083.4 8787.7 8786.4 6.0
shadow_word_death Mana 15.8 118404.9 7507.2 7507.8 37.7
shadow_word_pain Mana 134.4 1701449.8 12663.3 12663.2 23.1
vampiric_touch Mana 38.2 330214.2 8637.5 8637.3 46.7
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.54 246296.97 (11.01%) 6930.32 73554.39 23.00%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.58 (84.86%) 0.99 0.45 0.99%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.95 7.95 (15.14%) 1.00 0.00 0.00%
Devouring Plague Health Health 232.24 0.00 (0.00%) 0.00 4938449.26 100.00%
Vampiric Touch Mana Mana 298.08 1463526.85 (65.44%) 4909.77 53055.95 3.50%
halo_heal Health 10.44 0.00 (0.00%) 0.00 3601703.56 100.00%
external_healing Health 83.58 0.00 (0.00%) 0.00 29367144.99 100.00%
mp5_regen Mana 1801.93 526485.02 (23.54%) 292.18 14094.06 2.61%
pet - shadowfiend
external_healing Health 21.19 0.00 (0.00%) 0.00 7914425.28 100.00%
Resource RPS-Gain RPS-Loss
Mana 4962.88 6945.20
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -591445.87 -1202760.00 -27900.00
Shadow Orb 1.32 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
mindbender-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 418.6 1.1sec
Shadowy Apparition Procced 277.0 1.6sec
FDCL Mind Spike proc 59.6 7.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 303038.24
Minimum 265961.70
Maximum 350971.80
Spread ( max - min ) 85010.11
Range [ ( max - min ) / 2 * 100% ] 14.03%
Standard Deviation 10512.8772
5th Percentile 286259.12
95th Percentile 320877.25
( 95th Percentile - 5th Percentile ) 34618.13
Mean Distribution
Standard Deviation 66.4999
95.00% Confidence Intervall ( 302907.90 - 303168.57 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4623
0.1 Scale Factor Error with Delta=300 943467
0.05 Scale Factor Error with Delta=300 3773869
0.01 Scale Factor Error with Delta=300 94346729
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 303038.24
Minimum 265961.70
Maximum 350971.80
Spread ( max - min ) 85010.11
Range [ ( max - min ) / 2 * 100% ] 14.03%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 132271108.18
Minimum 93684726.28
Maximum 172600149.15
Spread ( max - min ) 78915422.87
Range [ ( max - min ) / 2 * 100% ] 29.83%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.82 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.75 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.16 mind_blast,if=active_enemies<=5&cooldown_react
I 7.95 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.65 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.75 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 4.18 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.33 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 8.94 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.44 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.94 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.21 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 46.15 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.24 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 65.60 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 100.53 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABHLMSZZZZRRXcHZOZZcccHQZZZccccHMZZXccccHLLLMMScccHMQZccccHZZZccccHMZZZccccHQZOXLLLHMMMRSXNccHMRXZccXcHQZOZXBcXHZZZZccccHLLLMSXccHQXZZXccXHMZZZccXHXZZOcXcXHMQZZALLLHMMMNScccHMZZccccHQZORXcXcHXZZZcXXHLLLMMScXcHQXZXccBcHMZZZccXcHZZZOccccHMQZZLLLHMMMOSXNcHRXZZcccHOQZXXcccHZZZOccccHLLLMMScXXHMQZZccXHZXZOccccHMZZccccHQZZLALLBHMMMMSXcccHXXIFOQRXHMZIFNRXcHQVIFOXcccHLIFLLQScHMIF8ZccccHGIFOXcccHMIFQZcccHVIFZOLLLS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 305028 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
305027.8 305027.8 130.18 / 0.04% 17274 / 5.7% 40.8 7242.2 4935.0 Mana 0.09% 52.8 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.73 5.75 5.84 5.13 7.42 4.31
Normalized 1.00 0.74 0.75 0.66 0.96 0.56
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.18 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Hit ~= SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.73, SpellDamage=5.75, HitRating=5.84, CritRating=5.13, HasteRating=7.42, MasteryRating=4.31 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.73, SpellDamage=5.75, HitRating=0.00, CritRating=5.13, HasteRating=7.42, MasteryRating=4.31 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:910938|662990|314907|297856|272019|230677|199795|109138|42630&chds=0,1821876&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++910938++devouring_plague,9482C9,0,0,15|t++662990++halo,9482C9,1,0,15|t++314907++vampiric_touch,9482C9,2,0,15|t++297856++shadow_word_death,9482C9,3,0,15|t++272019++shadow_word_pain,9482C9,4,0,15|t++230677++mind_blast,9482C9,5,0,15|t++199795++mind_spike,4A79D3,6,0,15|t++109138++mind_flay,9482C9,7,0,15|t++42630++mind_sear,9482C9,8,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,9,9,8,8,8,7,6,6,5,4,4,4,4,3,3,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,7BC29D,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|shadowy_apparition|essence_of_yulon|mind_spike|mind_blast|vampiric_touch|shadow_word_pain_mastery|devouring_plague_tick|halo_damage|mind_flay|multistrike_spell|shadow_word_death|devouring_plague|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.73,7.42,5.84,5.75,5.13,4.31|7.55,7.24,5.65,5.57,4.94,4.13|7.92,7.60,6.02,5.93,5.31,4.50&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.73++Int,FFFFFF,0,0,15,0.1,e|t++++7.42++Haste,FFFFFF,0,1,15,0.1,e|t++++5.84++Hit,FFFFFF,0,2,15,0.1,e|t++++5.75++SP,FFFFFF,0,3,15,0.1,e|t++++5.13++Crit,FFFFFF,0,4,15,0.1,e|t++++4.31++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.292& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gjlnptvy02354424320yxxwwvsrrqqpoonnlkjhgkmopppqrrsstttsssrrqligeddcbaZYYXXXXYYZaabbghijjkmmnnoonmllkjjiedddedcccccccdddddeeeefeeeeilnpqrstvwxyyyyyyxxxsomkihgedcbaZZYZZaabbcdefghjknprrsssrqpoonmmlkkjifeddcccccccccccccbbaabdfhiikklmnnoooooooomkhgeeddccbbbabcdefghhimnpqqruvvwwwvutsrqpplkjjjigggggfffgggggghhhggfehjlmnnppqrrssttssstspnlkiihhgffeeeeefgghhiijlmoqsvxz123332222222100zywutsrrrrrrrrrrrrrqqqpqsvxzzz0001111211110zwtrppoonnnmmmmmmmnnnnnpqrsttuvvwxxxxxxxxxxvuuuttsrrqpppppppqqqqrrstttuwz244567777777777787520yzyxwwvvuuuttssssrrstuuwxyz0111yvsqnljhfc&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6538,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=305028|max=466543&chxp=1,1,65,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,2,2,5,4,19,22,43,83,124,199,293,422,581,689,897,1082,1243,1412,1627,1670,1767,1765,1641,1549,1455,1230,1101,914,775,588,468,381,249,208,121,108,92,61,36,25,17,9,4,5,2,0,0,1&chds=0,1767&chbh=5&chxt=x&chxl=0:|min=262829|avg=305028|max=353216&chxp=0,1,47,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:32.0,20.1,12.6,10.8,10.6,4.1,3.8,2.5,0.7,0.1,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 144.4s|mind_flay 90.7s|mind_spike 56.6s|mind_blast 48.6s|vampiric_touch 47.6s|devouring_plague 18.4s|shadow_word_death 17.0s|halo 11.2s|shadowfiend 3.3s|mind_sear 0.3s|waiting 0.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 305028
devouring_plague 11143 (37156) 3.7% (12.2%) 17.0 26.01sec 982654 910938 202426 433588 294652 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 0.00 0.00 1.0788 0.0000 5022883.71 5022883.71 0.00 910937.84 910937.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 59.92% 202425.99 169721 353993 202400.27 171073 270969 2067786 2067786 0.00
crit 6.82 39.98% 433588.16 353627 885088 433724.13 0 705036 2955098 2955098 0.00
miss 0.02 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8581 2.8% 70.0 6.08sec 55265 0 33870 87549 55353 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.01 69.89 0.00 0.00 0.0000 0.0000 3868890.03 3868890.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.82 59.84% 33870.25 28287 59000 33882.41 30043 39725 1416508 1416508 0.00
crit 28.01 40.08% 87549.26 71200 182923 87555.07 74309 109307 2452382 2452382 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17432 5.7% 17.0 26.01sec 461048 0 0 0 0 0.0% 0.0% 0.0% 0.0% 160.4 33707 72026 49015 39.9% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 160.35 160.35 0.0000 0.6527 7859462.25 7859462.25 0.00 75096.62 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.3 60.05% 33706.60 28287 112026 33717.18 30195 44618 3245698 3245698 0.00
crit 64.1 39.95% 72025.68 58939 233415 72016.42 63179 93298 4613764 4613764 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25402 8.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 174.9 26629 58087 39303 40.3% 0.1% 30.8%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.99 174.91 291.03 0.0000 0.7942 11438293.35 11438293.35 0.00 82337.27 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.5 59.61% 26628.85 21101 47031 26639.00 23886 30346 4619607 4619607 0.00
crit 117.4 40.33% 58087.47 43965 117592 58084.52 50545 70092 6818686 6818686 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (16534) 0.0% (5.4%) 10.4 44.91sec 714249 662990 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 10.42 0.00 0.00 1.0773 0.0000 0.00 0.00 0.00 662989.98 662989.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.19 59.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.22 40.52% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 16534 5.4% 10.4 44.91sec 714249 0 182007 393958 267295 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 27.84 0.00 0.00 0.0000 0.0000 7440736.50 7440736.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.62 59.70% 182006.92 153853 317120 182012.03 156051 226668 3024879 3024879 0.00
crit 11.21 40.27% 393957.96 320566 792892 393026.69 0 580871 4415858 4415858 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 24862 8.2% 45.1 10.08sec 248565 230677 170068 367251 248566 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 1.0776 0.0000 11200735.52 11200735.52 0.00 230676.65 230676.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.05 60.02% 170067.53 135799 455588 170034.72 146368 202380 4599815 4599815 0.00
crit 17.97 39.89% 367250.50 282948 1139104 367408.39 302058 474857 6600921 6600921 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14744 (22016) 4.8% (7.2%) 65.4 6.66sec 151404 109138 0 0 0 0.0% 0.1% 0.0% 0.0% 105.0 42669 93206 63129 40.5% 0.0% 14.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.36 65.36 104.97 104.97 1.3873 0.6292 6626774.47 6626774.47 0.00 109138.27 109138.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.29 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.5 59.52% 42668.85 35993 75068 42676.75 38181 48255 2665741 2665741 0.00
crit 42.5 40.48% 93205.94 74995 187692 93236.02 80570 111219 3961033 3961033 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7272 2.4% 45.9 9.11sec 71270 0 42756 113208 71291 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.86 45.85 0.00 0.00 0.0000 0.0000 3268355.91 3268355.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.21 59.35% 42755.74 35993 75068 42770.07 37063 51463 1163299 1163299 0.00
crit 18.59 40.56% 113208.28 90596 232742 113272.07 91884 147076 2105057 2105057 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 26 0.0% 0.3 138.65sec 46212 42630 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 24279 53161 35767 39.8% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.25 0.25 0.08 0.33 1.0864 0.6003 11637.99 11637.99 0.00 42630.00 42630.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.25 99.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 60.16% 24279.18 21183 42170 1430.43 0 42170 4752 4752 0.00
crit 0.1 39.81% 53161.22 44137 105439 2822.06 0 105439 6886 6886 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 13 0.0% 0.1 10.20sec 40638 0 24250 64337 40638 40.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.14 0.14 0.00 0.00 0.0000 0.0000 5710.69 5710.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.08 59.03% 24249.91 21183 42170 1123.82 0 42170 2011 2011 0.00
crit 0.06 40.92% 64336.51 53319 130746 2408.43 0 130746 3699 3699 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (13) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 25101 8.2% 52.6 8.29sec 214807 199795 145851 317093 214807 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.62 52.62 0.00 0.00 1.0751 0.0000 11302425.85 11302425.85 0.00 199795.40 199795.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.33 59.55% 145850.60 110446 371848 145953.19 121777 178271 4570020 4570020 0.00
crit 21.23 40.35% 317093.36 230124 929729 317339.79 250332 418043 6732406 6732406 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11604 3.8% 230.4 2.01sec 22682 0 22682 0 22682 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 230.39 230.39 0.00 0.00 0.0000 0.0000 5225618.42 5225618.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 230.39 100.00% 22682.16 7034 427786 22697.06 16097 31327 5225618 5225618 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:182635.00
  • base_dd_max:182635.00
shadow_word_death 11254 3.7% 15.7 4.67sec 322008 297856 219468 473120 322011 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.73 15.73 0.00 0.00 1.0811 0.0000 5066529.54 5066529.54 0.00 297855.94 297855.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.35 59.43% 219467.87 175524 513282 219872.67 175524 331685 2052265 2052265 0.00
crit 6.37 40.49% 473120.19 365719 1283357 474229.69 0 1041467 3014265 3014265 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 39670 (87193) 13.0% (28.6%) 134.1 3.33sec 292871 272019 0 0 0 0.0% 0.1% 0.0% 0.0% 465.8 26138 56616 38366 40.1% 0.0% 142.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.13 134.13 465.84 465.84 1.0767 1.3810 17872745.71 17872745.71 0.00 49868.41 272019.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.03 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.9 59.88% 26138.19 21342 46723 26144.01 24484 28627 7290949 7290949 0.00
crit 186.9 40.12% 56615.73 44467 116821 56625.87 51985 62170 10581796 10581796 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19833 6.5% 203.6 2.19sec 43892 0 26571 69812 43928 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.56 203.39 0.00 0.00 0.0000 0.0000 8934577.03 8934577.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.45 59.71% 26570.97 22409 46723 26577.91 24768 29122 3227020 3227020 0.00
crit 81.76 40.20% 69812.14 56403 144860 69833.25 63441 79147 5707557 5707557 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 27690 9.1% 268.6 1.66sec 46437 0 31786 69139 46895 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 268.65 266.02 0.00 0.00 0.0000 0.0000 12475219.73 12475219.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 158.42 59.55% 31786.16 26478 55707 31790.58 29567 34957 5035554 5035554 0.00
crit 107.61 40.45% 69138.67 55169 139283 69140.66 62377 78407 7439666 7439666 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1281 0.4% 3.0 92.77sec 186575 0 113511 281555 186577 43.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 3.03 0.00 0.00 0.0000 0.0000 566062.86 566062.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.71 56.35% 113510.95 83080 166781 94778.48 0 166781 194061 194061 0.00
crit 1.32 43.55% 281555.46 173104 383445 210597.55 0 383445 372002 372002 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22354 (33334) 7.3% (10.9%) 38.3 11.71sec 392093 314907 0 0 0 0.0% 0.1% 0.0% 0.0% 198.2 34391 74854 50752 40.4% 0.0% 85.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.26 38.26 198.24 198.24 1.2451 1.9319 10060862.62 10060862.62 0.00 34840.41 314907.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.24 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.1 59.56% 34390.53 27457 61105 34406.54 31578 38738 4060745 4060745 0.00
crit 80.2 40.44% 74854.04 57209 152782 74880.27 66701 87093 6000117 6000117 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10980 3.6% 86.7 5.10sec 57017 0 34390 90750 57061 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.67 86.61 0.00 0.00 0.0000 0.0000 4941939.11 4941939.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.64 59.63% 34390.04 28830 61105 34402.26 30697 38827 1775981 1775981 0.00
crit 34.89 40.28% 90749.72 72566 189452 90781.93 77516 108315 3165959 3165959 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115863 / 9251
melee 115474 3.0% 35.6 11.06sec 115345 123392 76624 179709 115343 41.7% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.57 35.57 0.00 0.00 0.9348 0.0000 4103272.65 4103272.65 0.00 123391.85 123391.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.18 34.25% 76624.13 57590 120110 76823.17 62086 108509 933573 933573 0.00
crit 14.84 41.71% 179708.57 115181 288264 179329.45 137301 247330 2666435 2666435 0.00
glance 8.52 23.95% 59076.58 43193 90083 59066.34 0 90083 503264 503264 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0757 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 390 0.0% 1.4 1.72sec 9918 0 5885 14450 9918 47.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 13767.51 13767.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.73 52.71% 5884.91 4377 7078 3194.91 0 7078 4306 4306 0.00
crit 0.65 47.17% 14449.82 10506 16987 7134.69 0 16987 9462 9462 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4169.46
  • base_dd_max:4169.46

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.28%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.0sec 26.0sec 15.14% 14.93%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:15.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.1sec 124.1sec 17.69% 17.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.69%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.63% 41.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.63%

    Trigger Attempt Success

    • trigger_pct:99.41%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.86% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.86%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 42.1 14.9 10.4sec 7.7sec 27.95% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:22.75%
  • surge_of_darkness_2:5.19%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.7sec 39.8sec 22.89% 53.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.89%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.2sec 55.0sec 17.68% 17.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.68%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 332.0 0.0sec 0.4sec 32.04% 32.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.86% 56.91%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.29% 16.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 327759.5
halo Mana 10.4 421909.6 40500.0 40499.8 17.6
mind_blast Mana 45.1 405553.7 9000.0 9000.0 27.6
mind_flay Mana 65.4 196068.1 3000.0 3000.0 50.5
mind_sear Mana 0.3 2266.2 9000.0 8998.5 5.1
shadow_word_death Mana 15.7 122736.7 7800.0 7800.6 41.3
shadow_word_pain Mana 134.1 1770480.6 13200.0 13199.8 22.2
vampiric_touch Mana 38.3 344368.4 9000.0 9000.0 43.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.54 262893.56 (11.82%) 7397.13 56966.08 17.81%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.54 (84.87%) 0.99 0.49 1.08%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.94 7.94 (15.13%) 1.00 0.00 0.00%
Devouring Plague Health Health 230.25 0.00 (0.00%) 0.00 4896059.25 100.00%
Vampiric Touch Mana Mana 284.84 1427962.85 (64.21%) 5013.16 21269.83 1.47%
halo_heal Health 10.42 0.00 (0.00%) 0.00 3768798.11 100.00%
external_healing Health 83.60 0.00 (0.00%) 0.00 29229286.19 100.00%
mp5_regen Mana 1801.93 532882.94 (23.96%) 295.73 7696.14 1.42%
pet - shadowfiend
external_healing Health 21.17 0.00 (0.00%) 0.00 7901262.06 100.00%
Resource RPS-Gain RPS-Loss
Mana 4934.98 7242.19
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -742628.97 -1392900.00 -215400.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.5%
shadowfiend-Mana Cap 1.5%
mindbender-Mana Cap 1.5%

Procs

Count Interval
Shadowy Recall Extra Tick 405.9 1.1sec
Shadowy Apparition Procced 268.7 1.7sec
FDCL Mind Spike proc 56.9 7.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 305027.83
Minimum 262828.59
Maximum 353216.26
Spread ( max - min ) 90387.67
Range [ ( max - min ) / 2 * 100% ] 14.82%
Standard Deviation 10499.8609
5th Percentile 288229.46
95th Percentile 322777.71
( 95th Percentile - 5th Percentile ) 34548.25
Mean Distribution
Standard Deviation 66.4176
95.00% Confidence Intervall ( 304897.65 - 305158.00 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4551
0.1 Scale Factor Error with Delta=300 941132
0.05 Scale Factor Error with Delta=300 3764529
0.01 Scale Factor Error with Delta=300 94113247
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 305027.83
Minimum 262828.59
Maximum 353216.26
Spread ( max - min ) 90387.67
Range [ ( max - min ) / 2 * 100% ] 14.82%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 133189461.29
Minimum 95782049.13
Maximum 172514103.55
Spread ( max - min ) 76732054.42
Range [ ( max - min ) / 2 * 100% ] 28.81%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.80 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.73 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.94 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.31 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 4.11 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.98 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 8.45 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.42 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.05 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.31 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 44.17 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.25 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 65.36 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 100.40 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZWccccHXZOZZcccHQZZZccccHMXZZRXXcHLLLMMRSXHMQZZccccHXZOZXccHZXZZcccHMQZZLLLSHMMMRONXcHMZZZcXccHQZOZccccHZZZcccSHLLLMXcccHMQZZcccHZXZOXccHMZZZccccHQSOXZALLHLMMMXXccHMZZXcccHQXZZccXcHMZSZccXRHLLLMRXcXHMQXZccccHXZOZcccHZZSZXcXcHMQZZLLLXHMMMOccccHMZZXcXcHQZZSXccHMZZccccHLLLMMRXcHMQXXZcccXHZZOZScccHZZZccccHMQZZLALLHMMMOXcXcHMZIFQSXcHXVIFORXccHGIFMZccXcHIFLLLQRXHIF8MXcSccHGIFZccccHMIFQXcXcHXIFZOLLL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 303415 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
303414.5 303414.5 139.26 / 0.05% 18417 / 6.1% 38.9 7190.6 5762.7 Mana 0.47% 53.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.58 5.79 5.29 5.21 6.83 4.68
Normalized 1.00 0.76 0.70 0.69 0.90 0.62
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.19 0.19 0.20 0.20 0.19 0.20
Gear Ranking
Optimizers
Ranking
  • Int > Haste > SP > Hit ~= Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.58, SpellDamage=5.79, HitRating=5.29, CritRating=5.21, HasteRating=6.83, MasteryRating=4.68 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.58, SpellDamage=5.79, HitRating=0.00, CritRating=5.21, HasteRating=6.83, MasteryRating=4.68 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:880862|512329|336586|265600|248048|238810|107127|74426&chds=0,1761724&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++880862++devouring_plague,9482C9,0,0,15|t++512329++halo,9482C9,1,0,15|t++336586++vampiric_touch,9482C9,2,0,15|t++265600++shadow_word_death,9482C9,3,0,15|t++248048++shadow_word_pain,9482C9,4,0,15|t++238810++mind_blast,9482C9,5,0,15|t++107127++mind_flay,9482C9,6,0,15|t++74426++mind_sear,9482C9,7,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,12,10,9,8,8,7,7,7,5,5,4,4,4,4,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|mind_blast|shadowy_apparition|essence_of_yulon|mindbender: melee|vampiric_touch|devouring_plague_tick|shadow_word_pain_mastery|mind_flay|halo_damage|devouring_plague|vampiric_touch_mastery|multistrike_spell|devouring_plague_mastery|shadow_word_death|mind_flay_mastery|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.58,6.83,5.79,5.29,5.21,4.68|7.38,6.64,5.59,5.09,5.02,4.49|7.77,7.03,5.98,5.49,5.41,4.88&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.58++Int,FFFFFF,0,0,15,0.1,e|t++++6.83++Haste,FFFFFF,0,1,15,0.1,e|t++++5.79++SP,FFFFFF,0,2,15,0.1,e|t++++5.29++Hit,FFFFFF,0,3,15,0.1,e|t++++5.21++Crit,FFFFFF,0,4,15,0.1,e|t++++4.68++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.104& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:egjmquwz146778676430zzxvtrqpoonmmllkjjjjmoqrsstsssrrssrrrrqqnkjhhhhhhhhhggffedddccceeeefgijjkklkkllllkkihggfecbaaabccdefgghijkllmnquwyzzzzzyyxxwvvuuttqmkhffeeddddcccccbbbbbbcdefgikmnpqrrsssssssrqpnmligfecbbaaaaaaaaabbbbbdfhjllllllllllmmnnnonlkjijjjjkkkllkkkjjjiiijkkklmopqqrrrrrqqqqqonmlkigfedccddeeffgghhijjkkmoqsttssrrqqppoonnmmkigedddddddddddddddddddefgijlnprtuvwxyzzzz0zzyxwusqpomlkkjjjjjjjjjkkklmoqsuuuuuuuuuuuuuuuutsqpoooooooooooponnmmllmmmmnnoppqqrqqqqqqqqppoonmlkkjiiiijkklmmnooprstuvy12333333221110zzyxwurqqppooooooooonnnmmnooooopqqrrrromkigedbYW&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6431,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=303415|max=471817&chxp=1,1,64,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,1,2,6,16,20,61,102,166,291,406,626,770,1049,1277,1532,1650,1794,1809,1894,1908,1739,1618,1370,1206,977,764,564,419,303,230,161,101,55,43,22,15,11,4,4,2,0,0,0,0,2,0,0,1&chds=0,1908&chbh=5&chxt=x&chxl=0:|min=258687|avg=303415|max=367377&chxp=0,1,41,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:34.0,26.1,13.6,9.9,4.9,3.7,2.5,1.9,0.1,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 153.1s|mind_flay 117.4s|mind_blast 61.2s|vampiric_touch 44.6s|devouring_plague 22.0s|shadow_word_death 16.9s|halo 11.5s|mindbender 8.6s|mind_sear 0.6s|waiting 2.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 303415
devouring_plague 12756 (42990) 4.2% (14.2%) 20.4 21.77sec 949441 880862 192080 416115 281737 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.40 20.40 0.00 0.00 1.0779 0.0000 5748159.13 5748159.13 0.00 880861.81 880861.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.20 59.81% 192079.55 169721 307820 192059.90 169721 233476 2343773 2343773 0.00
crit 8.18 40.10% 416115.07 353627 769642 416320.58 0 643629 3404386 3404386 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9954 3.3% 84.5 5.08sec 53087 0 32233 84243 53157 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.49 84.37 0.00 0.00 0.0000 0.0000 4485102.68 4485102.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.30 59.61% 32233.17 28287 51304 32242.68 29020 37484 1621289 1621289 0.00
crit 33.99 40.29% 84242.76 71200 159064 84237.66 72806 104690 2863813 2863813 0.00
miss 0.08 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20279 6.7% 20.4 21.77sec 447874 0 0 0 0 0.0% 0.0% 0.0% 0.0% 193.4 32227 69557 47245 40.2% 0.0% 27.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.40 20.40 193.41 193.41 0.0000 0.6491 9137770.27 9137770.27 0.00 72790.62 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.6 59.77% 32226.52 28287 152321 32232.35 28935 126733 3725414 3725414 0.00
crit 77.8 40.23% 69556.80 58939 317373 69534.96 60807 247456 5412357 5412357 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 23841 7.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 167.6 25406 55241 37427 40.3% 0.1% 29.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.30 167.60 286.88 0.0000 0.7954 10737089.25 10737089.25 0.00 80544.08 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.0 59.60% 25405.67 21101 40897 25414.75 23170 28999 4343738 4343738 0.00
crit 115.7 40.34% 55241.41 43965 102254 55235.55 48607 64309 6393351 6393351 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (13033) 0.0% (4.3%) 10.6 43.94sec 551459 512329 0 0 0 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.64 10.64 0.00 0.00 1.0765 0.0000 0.00 0.00 0.00 512328.98 512328.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.33 59.45% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.30 40.44% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 13033 4.3% 10.6 43.94sec 551459 0 176566 381785 259103 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.64 22.65 0.00 0.00 0.0000 0.0000 5869753.13 5869753.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.52 59.69% 176566.15 153853 275756 177227.72 154403 248477 2387503 2387503 0.00
crit 9.12 40.26% 381785.27 320566 689472 382245.11 0 655612 3482250 3482250 0.00
miss 0.01 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 32454 10.7% 55.8 8.11sec 261840 238810 179005 386819 261842 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.83 55.83 0.00 0.00 1.0964 0.0000 14618281.73 14618281.73 0.00 238810.08 238810.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.47 59.95% 179004.66 135799 396163 178977.37 154200 216171 5991621 5991621 0.00
crit 22.30 39.95% 386819.19 282948 990526 386900.05 303772 487478 8626661 8626661 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18765 (27990) 6.2% (9.2%) 83.4 5.26sec 150752 107127 0 0 0 0.0% 0.1% 0.0% 0.0% 138.5 41192 89954 60909 40.4% 0.0% 19.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.44 83.44 138.46 138.46 1.4072 0.6313 8433363.54 8433363.54 0.00 107126.78 107126.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.36 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.08 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.5 59.56% 41192.13 35993 65277 41207.53 37785 45930 3397212 3397212 0.00
crit 56.0 40.44% 89953.78 74995 163211 90006.22 79784 104202 5036152 5036152 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9225 3.0% 60.5 7.07sec 68509 0 41200 109036 68537 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.51 60.48 0.00 0.00 0.0000 0.0000 4145463.11 4145463.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.01 59.54% 41200.04 35993 65277 41215.43 36591 47002 1483639 1483639 0.00
crit 24.41 40.36% 109036.26 90596 202384 109108.37 91884 140400 2661824 2661824 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 100 0.0% 0.5 124.09sec 82235 74426 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 23860 52195 35186 40.0% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.54 0.54 0.32 1.26 1.1062 0.6251 44506.61 44506.61 0.00 74425.77 74425.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.54 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 60.02% 23859.82 21183 36670 4680.62 0 36670 18115 18115 0.00
crit 0.5 39.97% 52195.32 44137 91686 9420.44 0 91686 26392 26392 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 49 0.0% 0.6 31.32sec 39696 0 23837 63454 39694 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.55 0.55 0.00 0.00 0.0000 0.0000 21967.13 21967.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.33 59.86% 23837.34 21183 36670 3816.14 0 36670 7896 7896 0.00
crit 0.22 40.07% 63454.12 53319 113692 8264.97 0 113692 14071 14071 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (49) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 1.0829 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10680 3.5% 235.9 1.96sec 20394 0 20394 0 20394 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.86 235.86 0.00 0.00 0.0000 0.0000 4810065.96 4810065.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.86 100.00% 20393.89 7034 371987 20400.05 15041 28721 4810066 4810066 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:35993.34
  • base_dd_max:35993.34
shadow_word_death 9940 3.3% 15.6 4.71sec 287124 265600 196027 422359 287127 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.59 15.59 0.00 0.00 1.0811 0.0000 4477224.04 4477224.04 0.00 265600.29 265600.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.29 59.60% 196026.52 152630 446332 196338.74 152630 308288 1821681 1821681 0.00
crit 6.29 40.32% 422359.10 318016 1115962 423326.86 0 909365 2655543 2655543 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 38372 (84292) 12.7% (27.8%) 142.2 3.15sec 267045 248048 0 0 0 0.0% 0.1% 0.0% 0.0% 471.3 24985 54125 36677 40.1% 0.0% 141.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.20 142.20 471.33 471.33 1.0766 1.3565 17287226.78 17287226.78 0.00 47919.70 248047.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 142.09 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 282.2 59.88% 24985.23 21342 40629 24991.52 23611 27301 7051083 7051083 0.00
crit 189.1 40.12% 54124.52 44467 101583 54137.81 50394 60589 10236144 10236144 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19154 6.3% 205.9 2.16sec 41903 0 25379 66689 41936 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.92 205.76 0.00 0.00 0.0000 0.0000 8628772.91 8628772.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.97 59.76% 25379.19 22409 40629 25384.59 23748 27744 3120836 3120836 0.00
crit 82.59 40.14% 66688.60 56403 125965 66708.38 60648 75698 5507937 5507937 0.00
miss 0.20 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 26765 8.8% 271.7 1.64sec 44380 0 30387 66093 44816 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 271.70 269.06 0.00 0.00 0.0000 0.0000 12058349.51 12058349.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.33 59.59% 30387.00 26478 48441 30392.10 28422 33833 4872000 4872000 0.00
crit 108.73 40.41% 66092.97 55169 121116 66098.04 59822 73794 7186350 7186350 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1235 0.4% 3.0 90.63sec 182782 0 110843 277437 182791 43.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 546868.68 546868.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.69 56.63% 110843.30 83080 153360 92412.65 0 153360 187799 187799 0.00
crit 1.29 43.26% 277437.49 173104 383445 204309.75 0 383445 359070 359070 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22431 (33332) 7.4% (11.0%) 37.5 11.97sec 400288 336586 0 0 0 0.0% 0.1% 0.0% 0.0% 206.9 33075 71972 48807 40.4% 0.0% 88.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.48 37.48 206.88 206.88 1.1893 1.9321 10097066.47 10097066.47 0.00 33770.53 336585.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.46 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.2 59.56% 33075.43 27457 53135 33091.57 30479 36993 4075200 4075200 0.00
crit 83.7 40.44% 71972.44 57209 132854 71996.15 64323 81584 6021867 6021867 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10901 3.6% 90.2 4.89sec 54391 0 32844 86549 54431 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.22 90.15 0.00 0.00 0.0000 0.0000 4906908.90 4906908.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.77 59.64% 32844.13 28830 53135 32853.32 29678 36792 1765944 1765944 0.00
crit 36.29 40.26% 86549.45 72566 164741 86594.24 75719 103100 3140965 3140965 0.00
miss 0.09 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 90225 / 23480
melee 89942 7.7% 113.2 3.88sec 92889 95032 64802 142910 92889 40.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.23 113.23 0.00 0.00 0.9775 0.0000 10517566.13 10517566.13 0.00 95031.95 95031.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.80 35.15% 64802.22 50679 105697 64923.61 56536 80935 2578835 2578835 0.00
crit 46.10 40.71% 142910.23 101359 253672 142866.97 117245 182352 6587909 6587909 0.00
glance 27.22 24.04% 49631.81 38010 79273 49662.97 42170 63600 1350822 1350822 0.00
dodge 0.06 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.49 23.49 0.00 0.00 1.0780 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 284 0.0% 4.2 77.04sec 7825 0 4935 11664 7825 43.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.18 0.00 0.00 0.0000 0.0000 32734.97 32734.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.38 56.87% 4934.99 3835 7078 4542.05 0 7078 11740 11740 0.00
crit 1.80 43.03% 11663.96 7669 16987 9840.10 0 16987 20995 20995 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3651.90
  • base_dd_max:3651.90

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.28%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 30.6 3.2 14.2sec 12.8sec 9.35% 52.45%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.35%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.4 0.0 21.7sec 21.7sec 25.52% 27.22%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 125.2sec 125.2sec 17.49% 17.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.49%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.5sec 23.5sec 41.65% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.65%

    Trigger Attempt Success

    • trigger_pct:99.41%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.9sec 9.9sec 14.71% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.71%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 22.97% 53.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.97%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.9 0.0 56.5sec 56.4sec 17.30% 17.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.30%

    Trigger Attempt Success

    • trigger_pct:99.89%
mindbender-shadowcrawl 23.5 0.0 19.2sec 19.2sec 85.38% 75.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.09% 29.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.25% 16.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 20.4 61.2 3.0 3.0 316672.3
halo Mana 10.6 431083.6 40500.0 40500.0 13.6
mind_blast Mana 55.8 217848.6 3902.1 3902.1 67.1
mind_flay Mana 83.4 250322.5 3000.0 3000.0 50.3
mind_sear Mana 0.5 4870.8 9000.0 8999.8 9.1
shadow_word_death Mana 15.6 121637.9 7800.0 7800.6 36.8
shadow_word_pain Mana 142.2 1877048.4 13200.0 13199.9 20.2
vampiric_touch Mana 37.5 337340.2 9000.0 8999.8 44.5
Resource Gains Type Count Total Average Overflow
mindbender Mana 113.11 569412.95 (21.93%) 5034.10 23074.08 3.89%
Shadow Orbs from Mind Blast Shadow Orb 55.77 54.77 (87.44%) 0.98 1.00 1.80%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.87 7.87 (12.56%) 1.00 0.00 0.00%
Devouring Plague Health Health 277.79 0.00 (0.00%) 0.00 5907035.24 100.00%
Vampiric Touch Mana Mana 297.02 1493356.08 (57.51%) 5027.71 18350.88 1.21%
halo_heal Health 10.64 0.00 (0.00%) 0.00 3677141.65 100.00%
external_healing Health 83.37 0.00 (0.00%) 0.00 29313562.98 100.00%
mp5_regen Mana 1801.93 533961.37 (20.56%) 296.33 6617.72 1.22%
pet - mindbender
external_healing Health 26.94 0.00 (0.00%) 0.00 9959620.74 100.00%
Resource RPS-Gain RPS-Loss
Mana 5762.74 7190.63
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -342467.59 -900733.33 74995.24
Shadow Orb 1.49 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%
shadowfiend-Mana Cap 1.3%
mindbender-Mana Cap 1.3%

Procs

Count Interval
Shadowy Recall Extra Tick 441.3 1.0sec
Shadowy Apparition Procced 271.7 1.6sec
Divine Insight Mind Blast CD Reset 57.4 12.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 303414.53
Minimum 258687.24
Maximum 367376.83
Spread ( max - min ) 108689.59
Range [ ( max - min ) / 2 * 100% ] 17.91%
Standard Deviation 11232.4238
5th Percentile 285450.49
95th Percentile 322284.20
( 95th Percentile - 5th Percentile ) 36833.71
Mean Distribution
Standard Deviation 71.0515
95.00% Confidence Intervall ( 303275.27 - 303553.79 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5264
0.1 Scale Factor Error with Delta=300 1077037
0.05 Scale Factor Error with Delta=300 4308148
0.01 Scale Factor Error with Delta=300 107703702
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 303414.53
Minimum 258687.24
Maximum 367376.83
Spread ( max - min ) 108689.59
Range [ ( max - min ) / 2 * 100% ] 17.91%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 126053939.82
Minimum 87154230.27
Maximum 174647789.69
Spread ( max - min ) 87493559.42
Range [ ( max - min ) / 2 * 100% ] 34.70%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.94 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.73 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 3.80 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.86 mind_blast,if=active_enemies<=5&cooldown_react
I 7.87 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.68 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 33.43 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 2.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.79 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 16.61 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.64 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.04 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 12.04 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.54 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 83.44 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 109.90 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9HLMSZZZZHcccZOZWHQcccZZZHZccccMZHZZcHQZLLLMMSccHMZZZ9ccHZZOWWcHQcWWWHZZZccccHMZHQLLLSMMHMOYcccZHZZcHGHOZWHZc9ccZHQOZcccSLHLLMcHccMMZZccccHQZZccccHMZZZcccHSZZOL9HLGHLMMHNcHGHZZcHccHMQZZccccHSZOZcccHLLLMMcHGHMZZZcc9HZZOZcccHQSZZcHccMZZWHLLLHMHMGHcHccMZZWHcccZZSHOQcc9MZWHZZcccHLHLLMQccMHZZZccHZZOSZcccHQZZZcccHMZZZLLL9HMMMOHNQMZZIFSccHZHGIFcccMHZIFQcHcZLIFLLcccHGI8FMcSccH9HGIFcccHMZIFQccHZZIFLLHL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 305344 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
305344.2 305344.2 134.84 / 0.04% 17921 / 5.9% 36.0 7832.1 5719.7 Mana 0.07% 52.9 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.89 5.83 5.04 5.45 6.69 4.48
Normalized 1.00 0.74 0.64 0.69 0.85 0.57
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.19 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > Haste > SP > Crit > Hit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.89, SpellDamage=5.83, HitRating=5.04, CritRating=5.45, HasteRating=6.69, MasteryRating=4.48 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.89, SpellDamage=5.83, HitRating=0.00, CritRating=5.45, HasteRating=6.69, MasteryRating=4.48 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:868382|682079|327450|268448|248575|241454|112764|48967&chds=0,1736765&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++868382++devouring_plague,9482C9,0,0,15|t++682079++halo,9482C9,1,0,15|t++327450++vampiric_touch,9482C9,2,0,15|t++268448++shadow_word_death,9482C9,3,0,15|t++248575++mind_blast,9482C9,4,0,15|t++241454++shadow_word_pain,9482C9,5,0,15|t++112764++mind_flay,9482C9,6,0,15|t++48967++mind_sear,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,9,9,8,8,7,7,6,6,4,4,4,4,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|mindbender: melee|vampiric_touch|shadow_word_pain_mastery|mind_flay|halo_damage|devouring_plague_tick|vampiric_touch_mastery|multistrike_spell|devouring_plague|shadow_word_death|mind_flay_mastery|devouring_plague_mastery|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.89,6.69,5.83,5.45,5.04,4.48|7.70,6.50,5.64,5.26,4.84,4.29|8.08,6.88,6.02,5.63,5.23,4.67&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.89++Int,FFFFFF,0,0,15,0.1,e|t++++6.69++Haste,FFFFFF,0,1,15,0.1,e|t++++5.83++SP,FFFFFF,0,2,15,0.1,e|t++++5.45++Crit,FFFFFF,0,3,15,0.1,e|t++++5.04++Hit,FFFFFF,0,4,15,0.1,e|t++++4.48++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.473& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gjloquy136767657532zzyxvtsqponmmllkjihgfklmmnmonooopqqqqqqqpjihgggeeddcbaaZZZZZZZZZddffghkkkkllkjjihhggcbbbbaYYYZaaccdfghhijklmnnnuwxyzz001111100zyxwvomkigedcaZYXXWWWXXXYYZZabdefgkmnoppppoonmmlkjiihgdccbaZZZZZZZZZZZZZZZYbdefgghhhijjkklmmnoomkjjijjjjjjjiiihiiiijjjnnpppprrrrrrqpponmlkfedddcaabbabbcddeeffghhhhhhklmnonnnnnnnnnmmlkkkgfedccbaaZZYYYYYZZZaabbcdfhjloqrtuwwxyyzzzzyyyxvvsrqponmllkkjjjjiiiiiijlnoppppqqqrrrrqrrrrqonmllllllllkkklkkkjjjjkkllllmmnnooooooonnnlllkkjiihhggfgghijklmnoqrtuvy03577877665433210zyvtqponnmllkkkkjjjiiiiilmmmnpqrsssspnljhfecYW&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6153,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=305344|max=496261&chxp=1,1,62,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,3,5,15,18,35,65,88,143,181,266,361,441,632,708,880,1039,1157,1305,1498,1546,1597,1634,1568,1464,1387,1263,1181,932,762,637,541,437,316,252,201,130,80,69,65,32,22,17,6,6,2,1,1,2&chds=0,1634&chbh=5&chxt=x&chxl=0:|min=264771|avg=305344|max=351488&chxp=0,1,47,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.2,25.3,10.7,10.5,4.1,3.7,2.5,1.9,0.2,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 172.3s|mind_flay 113.8s|mind_blast 48.2s|vampiric_touch 47.3s|devouring_plague 18.3s|shadow_word_death 16.9s|halo 11.3s|mindbender 8.6s|mind_sear 1.0s|waiting 0.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 305344
devouring_plague 10508 (35332) 3.4% (11.6%) 17.0 26.01sec 934153 868382 191117 408589 277808 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 0.00 0.00 1.0758 0.0000 4736288.94 4736288.94 0.00 868382.38 868382.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 59.97% 191116.75 169721 323211 191120.70 169721 252094 1953895 1953895 0.00
crit 6.81 39.94% 408589.23 353627 808124 408917.41 0 593166 2782394 2782394 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8178 2.7% 70.6 6.02sec 52189 0 32001 82725 52273 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.63 70.51 0.00 0.00 0.0000 0.0000 3686027.66 3686027.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.23 59.89% 32000.58 28287 53869 32011.24 28731 39190 1351392 1351392 0.00
crit 28.22 40.02% 82724.87 71200 167017 82735.01 71672 111531 2334636 2334636 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16646 5.5% 17.0 26.01sec 440139 0 0 0 0 0.0% 0.0% 0.0% 0.0% 161.7 31901 68209 46417 40.0% 0.0% 23.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 161.66 161.66 0.0000 0.6450 7503816.34 7503816.34 0.00 71962.49 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.0 60.02% 31900.62 28287 190277 31912.32 28756 76332 3095331 3095331 0.00
crit 64.6 39.98% 68208.91 58939 475748 68211.32 59999 151483 4408485 4408485 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25464 8.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 175.5 25704 56003 37906 40.3% 0.1% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.75 175.46 302.57 0.0000 0.7963 11468996.63 11468996.63 0.00 82091.45 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 180.4 59.63% 25703.59 21101 42942 25711.62 23300 29259 4637171 4637171 0.00
crit 122.0 40.32% 56002.69 43965 107367 55991.75 49509 67099 6831825 6831825 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (17060) 0.0% (5.6%) 10.5 44.51sec 728254 682079 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 10.54 0.00 0.00 1.0678 0.0000 0.00 0.00 0.00 682079.35 682079.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.28 59.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.25 40.33% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 17060 5.6% 10.5 44.51sec 728254 0 177091 384094 260340 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 29.49 0.00 0.00 0.0000 0.0000 7678167.30 7678167.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.61 59.72% 177090.83 153853 289544 177263.94 155135 221277 3119133 3119133 0.00
crit 11.87 40.25% 384094.09 320566 723945 383188.59 320566 520967 4559034 4559034 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26577 8.7% 45.1 10.08sec 265770 248575 182082 392464 265770 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.05 45.05 0.00 0.00 1.0692 0.0000 11973089.22 11973089.22 0.00 248574.53 248574.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.05 60.05% 182082.39 135799 415972 182051.86 153319 219774 4925908 4925908 0.00
crit 17.96 39.86% 392463.93 282948 1040052 392571.80 299461 496752 7047181 7047181 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 19120 (28585) 6.2% (9.3%) 82.4 5.33sec 155794 112764 0 0 0 0.0% 0.1% 0.0% 0.0% 137.5 42059 92254 62424 40.6% 0.0% 18.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.38 82.38 137.53 137.53 1.3816 0.6009 8585156.95 8585156.95 0.00 112764.20 112764.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.31 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.7 59.43% 42058.86 35993 68540 42083.53 38458 47468 3437526 3437526 0.00
crit 55.8 40.57% 92253.95 74995 171371 92318.44 81137 110614 5147631 5147631 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9464 3.1% 60.1 7.11sec 70751 0 42251 112486 70773 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.06 60.04 0.00 0.00 0.0000 0.0000 4249551.62 4249551.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.57 59.24% 42251.21 35993 68540 42276.04 37582 50095 1502887 1502887 0.00
crit 24.42 40.67% 112485.63 90596 212503 112588.96 93740 147405 2746665 2746665 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 107 0.0% 0.9 143.75sec 52584 48967 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 23979 53230 35734 40.2% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.92 0.92 0.34 1.36 1.0749 0.5874 48477.14 48477.14 0.00 48966.81 48966.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.92 99.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 59.80% 23979.29 21183 38503 5288.27 0 38503 19452 19452 0.00
crit 0.5 40.19% 53229.69 44137 96270 10715.88 0 96270 29025 29025 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 53 0.0% 0.6 39.73sec 40195 0 23929 64976 40192 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.59 0.59 0.00 0.00 0.0000 0.0000 23894.72 23894.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.36 60.17% 23929.17 21183 38503 4286.04 0 38503 8560 8560 0.00
crit 0.24 39.70% 64976.28 53319 119377 9247.30 0 119377 15335 15335 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (53) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 1.0823 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10613 3.5% 238.1 1.95sec 20068 0 20069 0 20069 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.13 238.13 0.00 0.00 0.0000 0.0000 4778948.33 4778948.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 238.13 100.00% 20068.71 7034 381934 20079.26 14869 27524 4778948 4778948 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:28287.47
  • base_dd_max:28287.47
power_infusion 0 0.0% 4.3 121.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 10060 3.3% 15.7 4.67sec 287963 268448 196091 423310 287966 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.72 15.72 0.00 0.00 1.0727 0.0000 4528175.17 4528175.17 0.00 268447.66 268447.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.34 59.42% 196090.60 152630 468649 196527.07 152630 323092 1832313 1832313 0.00
crit 6.37 40.50% 423309.90 318016 1171761 424288.92 0 930963 2695862 2695862 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41979 (92349) 13.8% (30.3%) 161.2 2.78sec 258082 241454 0 0 0 0.0% 0.1% 0.0% 0.0% 506.8 25368 55085 37319 40.2% 0.0% 143.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.21 161.21 506.81 506.81 1.0689 1.2776 18913446.78 18913446.78 0.00 50752.38 241454.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 161.09 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 303.0 59.78% 25367.58 21342 42660 25373.87 23967 28198 7685982 7685982 0.00
crit 203.8 40.22% 55084.74 44467 106663 55100.84 51159 61143 11227464 11227464 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20971 6.9% 221.4 2.02sec 42670 0 25765 67895 42705 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.41 221.22 0.00 0.00 0.0000 0.0000 9447407.51 9447407.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.94 59.64% 25764.65 22409 42660 25772.40 24154 28300 3399270 3399270 0.00
crit 89.08 40.27% 67895.41 56403 132264 67919.84 61404 77042 6048138 6048138 0.00
miss 0.21 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 29399 9.6% 292.9 1.52sec 45223 0 30881 67357 45673 40.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 292.89 290.00 0.00 0.00 0.0000 0.0000 13245341.35 13245341.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.40 59.45% 30880.75 26478 50863 30886.65 28662 33733 5323740 5323740 0.00
crit 117.61 40.55% 67357.30 55169 127172 67367.29 61540 75883 7921602 7921602 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1300 0.4% 3.0 93.03sec 192091 0 115257 289953 192104 44.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 576212.70 576212.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.67 55.78% 115256.59 83080 161028 95722.00 0 161028 192862 192862 0.00
crit 1.32 44.08% 289952.74 173104 402617 217717.59 0 402617 383351 383351 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 23131 (34397) 7.6% (11.3%) 38.4 11.67sec 403487 327450 0 0 0 0.0% 0.1% 0.0% 0.0% 208.4 33694 73744 49936 40.6% 0.0% 85.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.35 38.35 208.38 208.38 1.2322 1.8515 10405827.61 10405827.61 0.00 35731.24 327449.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.33 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.9 59.45% 33693.88 27457 55792 33716.66 30708 38321 4173920 4173920 0.00
crit 84.5 40.55% 73744.49 57209 139496 73785.36 65320 85761 6231908 6231908 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11266 3.7% 91.0 4.86sec 55674 0 33445 88695 55716 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.04 90.97 0.00 0.00 0.0000 0.0000 5068801.03 5068801.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.17 59.54% 33444.81 28830 55792 33458.20 30048 38782 1811552 1811552 0.00
crit 36.72 40.37% 88695.22 72566 172978 88743.79 76083 105852 3257249 3257249 0.00
miss 0.09 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 90085 / 23447
melee 89804 7.6% 113.2 3.88sec 92741 94880 64750 142583 92741 40.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.25 113.25 0.00 0.00 0.9775 0.0000 10502825.82 10502825.82 0.00 94879.90 94879.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.87 35.21% 64750.05 50679 105697 64875.96 56718 79324 2581785 2581785 0.00
crit 46.11 40.72% 142582.61 101359 253672 142534.85 117364 177868 6574484 6574484 0.00
glance 27.16 23.98% 49585.86 38010 79273 49616.83 41939 64038 1346558 1346558 0.00
dodge 0.05 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.49 23.49 0.00 0.00 1.0657 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 281 0.0% 4.2 76.85sec 7790 0 4920 11615 7790 42.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.17 4.17 0.00 0.00 0.0000 0.0000 32467.90 32467.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.37 56.96% 4919.97 3835 7078 4527.44 0 7078 11680 11680 0.00
crit 1.79 42.94% 11615.40 7669 16987 9792.38 0 16987 20788 20788 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4018.26
  • base_dd_max:4018.26

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.78%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.0sec 26.0sec 28.68% 27.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.9sec 124.9sec 17.52% 17.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.52%

    Trigger Attempt Success

    • trigger_pct:99.88%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.5sec 23.5sec 41.60% 41.60%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.60%

    Trigger Attempt Success

    • trigger_pct:99.38%
power_infusion 4.3 0.0 121.3sec 121.3sec 18.53% 18.53%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.85% 49.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.85%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.6sec 39.7sec 22.92% 43.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.92%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.3sec 55.0sec 17.68% 17.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.68%

    Trigger Attempt Success

    • trigger_pct:99.89%
mindbender-shadowcrawl 23.5 0.0 19.2sec 19.2sec 85.38% 75.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.09% 28.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.25% 16.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 311573.8
halo Mana 10.5 402221.4 38149.8 38149.6 19.1
mind_blast Mana 45.1 389819.8 8652.9 8652.9 30.7
mind_flay Mana 82.4 236462.2 2870.3 2870.3 54.3
mind_sear Mana 0.9 8146.3 8838.1 8836.5 6.0
shadow_word_death Mana 15.7 118010.5 7504.1 7504.7 38.4
shadow_word_pain Mana 161.2 2043035.1 12673.0 12672.9 20.4
vampiric_touch Mana 38.4 331513.6 8644.0 8643.9 46.7
Resource Gains Type Count Total Average Overflow
mindbender Mana 113.14 560281.39 (21.74%) 4952.08 32359.43 5.46%
Shadow Orbs from Mind Blast Shadow Orb 45.01 44.54 (84.88%) 0.99 0.47 1.04%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.93 7.93 (15.12%) 1.00 0.00 0.00%
Devouring Plague Health Health 232.18 0.00 (0.00%) 0.00 4937149.59 100.00%
Vampiric Touch Mana Mana 299.36 1486350.02 (57.67%) 4965.13 36872.14 2.42%
halo_heal Health 10.54 0.00 (0.00%) 0.00 3644334.42 100.00%
external_healing Health 83.47 0.00 (0.00%) 0.00 29344050.02 100.00%
mp5_regen Mana 1801.93 530705.96 (20.59%) 294.52 9873.13 1.83%
pet - mindbender
external_healing Health 26.90 0.00 (0.00%) 0.00 9945607.33 100.00%
Resource RPS-Gain RPS-Loss
Mana 5719.70 7832.12
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -650461.74 -1142533.33 -234220.00
Shadow Orb 1.34 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.9%
shadowfiend-Mana Cap 1.9%
mindbender-Mana Cap 1.9%

Procs

Count Interval
Shadowy Recall Extra Tick 443.4 1.0sec
Shadowy Apparition Procced 292.9 1.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 305344.24
Minimum 264770.81
Maximum 351487.72
Spread ( max - min ) 86716.91
Range [ ( max - min ) / 2 * 100% ] 14.20%
Standard Deviation 10876.2502
5th Percentile 287664.49
95th Percentile 323506.52
( 95th Percentile - 5th Percentile ) 35842.03
Mean Distribution
Standard Deviation 68.7985
95.00% Confidence Intervall ( 305209.39 - 305479.08 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4873
0.1 Scale Factor Error with Delta=300 1009815
0.05 Scale Factor Error with Delta=300 4039262
0.01 Scale Factor Error with Delta=300 100981552
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 305344.24
Minimum 264770.81
Maximum 351487.72
Spread ( max - min ) 86716.91
Range [ ( max - min ) / 2 * 100% ] 14.20%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 126917626.98
Minimum 89100699.12
Maximum 169123103.71
Spread ( max - min ) 80022404.59
Range [ ( max - min ) / 2 * 100% ] 31.53%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.95 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 4.30 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.79 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.73 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 7.93 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.51 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.30 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 1.95 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.18 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.54 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.92 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.32 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.92 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 82.38 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 129.75 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9BHLMSZZZZccccHZOZccccHQZZZccccHMZZZccccHLLLMMSccHMQZZ9cccHZZOccccHMZZccccHQZZOLLLHMMMMScccHZZOZcccHQZZZc9BccHMZZZccccHLLLMMSccHMQZZZcccHZZZOccccHMZZccccHQZZZLL9LHMMMMSNcccHZZOccccHQZZZcccHMZZccccHLLLMMScccHMQZZcc9BHZZZOccccHMZZZcccHQZZOLLLHMMMMSNcccHZZZOccccHMQZZccc9HZZOccccHLLLMScccHMQZZcccHZZOZcccHZZZccccHMQZZLLL9BHMMMOSNccHMZIFQcccHZVIFZccccHGIFMZcccHLIFLLQSccHIF8MZcccc9HGIFccccMHZIFQcccWHZVIFMLLLS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 308328 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
308327.6 308327.6 128.96 / 0.04% 17114 / 5.6% 35.1 8108.3 5681.9 Mana 0.09% 52.0 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.85 5.95 5.81 5.25 7.87 4.45
Normalized 1.00 0.76 0.74 0.67 1.00 0.57
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.18 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Haste ~= Int > SP ~= Hit > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.85, SpellDamage=5.95, HitRating=5.81, CritRating=5.25, HasteRating=7.87, MasteryRating=4.45 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.85, SpellDamage=5.95, HitRating=0.00, CritRating=5.25, HasteRating=7.87, MasteryRating=4.45 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:910384|730312|316938|302906|255870|242160|108284|38120&chds=0,1820767&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++910384++devouring_plague,9482C9,0,0,15|t++730312++halo,9482C9,1,0,15|t++316938++vampiric_touch,9482C9,2,0,15|t++302906++shadow_word_death,9482C9,3,0,15|t++255870++mind_blast,9482C9,4,0,15|t++242160++shadow_word_pain,9482C9,5,0,15|t++108284++mind_flay,9482C9,6,0,15|t++38120++mind_sear,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,10,9,8,8,7,6,6,6,4,4,4,4,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|mindbender: melee|vampiric_touch|shadow_word_pain_mastery|halo_damage|mind_flay|devouring_plague_tick|shadow_word_death|devouring_plague|vampiric_touch_mastery|multistrike_spell|mind_flay_mastery|devouring_plague_mastery|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.87,7.85,5.95,5.81,5.25,4.45|7.69,7.67,5.77,5.63,5.07,4.27|8.05,8.03,6.14,5.99,5.43,4.64&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.87++Haste,FFFFFF,0,0,15,0.1,e|t++++7.85++Int,FFFFFF,0,1,15,0.1,e|t++++5.95++SP,FFFFFF,0,2,15,0.1,e|t++++5.81++Hit,FFFFFF,0,3,15,0.1,e|t++++5.25++Crit,FFFFFF,0,4,15,0.1,e|t++++4.45++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.454& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cehknqsvxz0100y1zxxvvvtrponnmmllllkjiigglmnnonpopppqrrrrrrrqkjihghffeddcbaaaaZZaaaaeefghillllmmkkkjiihhdcbbbaZZZaaaccdeffghhijjjjjprstutvvvwwwwwwvvuutnljigfdcbaZYXXXXXXYYZZabcefgimnpqqrrqqpponnmlkjjiedccbaaaaaaaaaaaaaZZZcefghhiijkkllmmnnnooljiihhhhggfffeeefffggghllnnoqtttuuutssrqpoojihhgfddddddeffghhiijjkkkkkopqrsrsrssssssrrqqppljhhffeeddcccccccddeffghijlnpsuvwyzz0000000yyyxvvsrrqpooonnnnnnoooooooqsvwyxyyzzz0000zz000ywusrrrrrrrrqqqrqqqpppprrsssstuuvvvvvvvvvvusrrrqpponnmmllmnnoopqrrsuvvxz14567787766544432210xvuvutssssrrrrqqqqqpqtuttuwxyz000wurpnljhca&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6372,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=308328|max=483849&chxp=1,1,64,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,3,5,3,7,32,46,76,96,187,209,313,441,566,739,864,1080,1198,1477,1504,1688,1694,1720,1607,1584,1445,1295,1088,890,761,629,467,373,275,211,126,104,58,54,23,21,15,5,4,2,1,1,1,1,1&chds=0,1720&chbh=5&chxt=x&chxl=0:|min=269054|avg=308328|max=357392&chxp=0,1,44,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.0,25.1,10.8,10.6,4.1,3.8,2.5,1.9,0.2,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 171.4s|mind_flay 113.3s|mind_blast 48.5s|vampiric_touch 47.5s|devouring_plague 18.4s|shadow_word_death 17.0s|halo 11.3s|mindbender 8.6s|mind_sear 1.0s|waiting 0.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 308328
devouring_plague 11121 (37108) 3.6% (12.1%) 17.0 26.03sec 981972 910384 202229 432669 294294 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 0.00 0.00 1.0787 0.0000 5012985.14 5012985.14 0.00 910383.69 910383.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.20 59.90% 202228.75 169721 353993 202194.12 171411 258374 2063288 2063288 0.00
crit 6.82 40.02% 432668.61 353627 885088 432887.99 0 721385 2949697 2949697 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8579 2.8% 70.0 6.06sec 55277 0 33883 87627 55363 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.96 69.85 0.00 0.00 0.0000 0.0000 3867193.03 3867193.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.84 59.89% 33882.87 28287 59000 33891.41 29933 40581 1417537 1417537 0.00
crit 27.96 40.02% 87627.41 71200 182923 87620.61 74060 111546 2449656 2449656 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17408 5.7% 17.0 26.03sec 460666 0 0 0 0 0.0% 0.0% 0.0% 0.0% 160.3 33661 71911 48968 40.0% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 160.25 160.25 0.0000 0.6527 7847211.69 7847211.69 0.00 75024.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.1 59.98% 33661.34 28287 125722 33671.69 30158 54668 3235521 3235521 0.00
crit 64.1 40.02% 71911.43 58939 261951 71908.47 62366 116442 4611691 4611691 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25599 8.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.4 26563 57761 39120 40.3% 0.1% 30.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.69 170.41 294.65 0.0000 0.7964 11526552.62 11526552.62 0.00 84930.17 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.8 59.65% 26562.71 21101 47031 26567.98 24108 30398 4668788 4668788 0.00
crit 118.7 40.29% 57760.93 43965 117592 57740.94 50039 67299 6857765 6857765 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (18303) 0.0% (5.9%) 10.5 44.83sec 786359 730312 0 0 0 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 10.47 0.00 0.00 1.0768 0.0000 0.00 0.00 0.00 730311.56 730311.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.23 59.54% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.23 40.38% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 18303 5.9% 10.5 44.83sec 786359 0 181922 393980 267150 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 30.81 0.00 0.00 0.0000 0.0000 8231341.56 8231341.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.41 59.75% 181922.25 153853 317120 181932.86 156492 233423 3349235 3349235 0.00
crit 12.39 40.22% 393979.80 320566 792892 393117.92 320566 532064 4882106 4882106 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27560 8.9% 45.0 10.08sec 275698 255870 189036 407003 275699 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.04 45.04 0.00 0.00 1.0775 0.0000 12416865.05 12416865.05 0.00 255870.12 255870.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.06 60.07% 189036.00 135799 455588 189005.03 158885 230191 5114376 5114376 0.00
crit 17.94 39.84% 407003.27 282948 1139104 407154.63 308321 521802 7302489 7302489 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18273 (27302) 5.9% (8.8%) 81.6 5.37sec 150216 108284 0 0 0 0.0% 0.1% 0.0% 0.0% 130.4 42603 92905 62960 40.5% 0.0% 18.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.64 81.64 130.38 130.38 1.3873 0.6284 8208563.84 8208563.84 0.00 108283.87 108283.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.56 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.6 59.53% 42602.98 35993 75068 42610.44 39091 47821 3306610 3306610 0.00
crit 52.8 40.47% 92904.83 74995 187692 92932.71 81444 110724 4901953 4901953 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9029 2.9% 56.9 7.45sec 71199 0 42788 113145 71219 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.95 56.93 0.00 0.00 0.0000 0.0000 4054693.17 4054693.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.84 59.43% 42787.53 35993 75068 42798.06 37331 49686 1447846 1447846 0.00
crit 23.04 40.47% 113145.05 90596 232742 113189.76 92039 155221 2606848 2606848 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 89 0.0% 1.0 150.69sec 40417 38120 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 24574 53688 36309 40.3% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.98 0.98 0.27 1.09 1.0613 0.5988 39645.21 39645.21 0.00 38120.39 38120.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.98 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.7 59.65% 24573.53 21183 42170 4843.74 0 42170 16004 16004 0.00
crit 0.4 40.33% 53687.74 44137 105439 9581.41 0 105439 23642 23642 0.00
miss 0.0 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 44 0.0% 0.5 34.61sec 41060 0 24530 65144 41058 40.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.47 0.47 0.00 0.00 0.0000 0.0000 19452.24 19452.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.28 59.11% 24530.08 21183 42170 3750.90 0 42170 6870 6870 0.00
crit 0.19 40.77% 65143.93 53319 130746 7943.70 0 130746 12582 12582 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (44) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 1.0828 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10801 3.5% 231.3 2.01sec 21025 0 21025 0 21025 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 231.31 231.31 0.00 0.00 0.0000 0.0000 4863141.65 4863141.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 231.31 100.00% 21025.26 7034 427786 21037.45 15083 28793 4863142 4863142 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:53087.47
  • base_dd_max:53087.47
shadow_word_death 11415 3.7% 15.7 4.68sec 327452 302906 223444 481355 327460 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.70 15.70 0.00 0.00 1.0811 0.0000 5139713.09 5139713.09 0.00 302906.24 302906.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.34 59.53% 223444.37 175524 513282 223784.57 175524 378194 2087684 2087684 0.00
crit 6.34 40.40% 481354.93 365719 1283357 482310.38 0 1045770 3052029 3052029 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41899 (92119) 13.6% (29.9%) 159.2 2.81sec 260653 242160 0 0 0 0.0% 0.1% 0.0% 0.0% 491.6 26155 56654 38401 40.2% 0.0% 143.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.23 159.23 491.59 491.59 1.0764 1.3142 18877724.52 18877724.52 0.00 50772.70 242160.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.11 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 294.2 59.85% 26154.87 21342 46723 26160.95 24659 28271 7694960 7694960 0.00
crit 197.4 40.15% 56654.47 44467 116821 56665.06 52662 63907 11182765 11182765 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20952 6.8% 214.8 2.07sec 43940 0 26594 69879 43977 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.82 214.64 0.00 0.00 0.0000 0.0000 9439330.84 9439330.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.13 59.70% 26593.90 22409 46723 26601.08 24376 29289 3407575 3407575 0.00
crit 86.32 40.21% 69879.06 56403 144860 69900.21 63633 81029 6031756 6031756 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 29268 9.5% 283.7 1.57sec 46485 0 31828 69197 46946 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 283.69 280.91 0.00 0.00 0.0000 0.0000 13187490.62 13187490.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.26 59.54% 31828.48 26478 55707 31833.11 29758 35479 5323699 5323699 0.00
crit 113.64 40.46% 69196.93 55169 139283 69201.01 62982 78734 7863792 7863792 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1221 0.4% 2.9 93.68sec 186502 0 113329 281191 186500 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 2.89 0.00 0.00 0.0000 0.0000 539781.79 539781.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.63 56.22% 113328.83 83080 166781 92747.63 0 166781 184388 184388 0.00
crit 1.26 43.67% 281190.71 173104 383445 205624.72 0 383445 355394 355394 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 22472 (33481) 7.3% (10.9%) 38.5 11.62sec 391529 316938 0 0 0 0.0% 0.1% 0.0% 0.0% 199.5 34367 74753 50691 40.4% 0.0% 85.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.48 38.48 199.50 199.50 1.2354 1.9343 10112797.23 10112797.23 0.00 34762.83 316938.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.46 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.9 59.58% 34366.97 27457 61105 34382.22 31540 39404 4085056 4085056 0.00
crit 80.6 40.42% 74753.38 57209 152782 74776.00 66466 89199 6027741 6027741 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11010 3.6% 87.2 5.07sec 56832 0 34347 90468 56873 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.18 87.12 0.00 0.00 0.0000 0.0000 4954767.37 4954767.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.02 59.71% 34346.68 28830 61105 34358.16 31228 39329 1786752 1786752 0.00
crit 35.02 40.20% 90467.88 72566 189452 90505.17 78763 108859 3168015 3168015 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 89466 / 23284
melee 89184 7.5% 113.2 3.88sec 92120 94244 64418 141750 92119 40.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.24 113.24 0.00 0.00 0.9775 0.0000 10431703.81 10431703.81 0.00 94244.22 94244.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.99 35.31% 64417.91 50679 105697 64534.05 56905 78726 2575954 2575954 0.00
crit 45.97 40.59% 141749.96 101359 253672 141689.48 119526 181312 6515632 6515632 0.00
glance 27.18 24.00% 49302.85 38010 79273 49329.02 41075 64369 1340119 1340119 0.00
dodge 0.05 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.49 23.49 0.00 0.00 1.0779 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 281 0.0% 4.2 77.10sec 7764 0 4913 11584 7764 42.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.18 0.00 0.00 0.0000 0.0000 32462.01 32462.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.39 57.06% 4912.78 3835 7078 4529.04 0 7078 11720 11720 0.00
crit 1.79 42.83% 11584.23 7669 16987 9780.95 0 16987 20742 20742 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3803.10
  • base_dd_max:3803.10

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.0sec 26.0sec 28.76% 27.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.7sec 125.7sec 17.37% 17.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.37%

    Trigger Attempt Success

    • trigger_pct:99.86%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.5sec 23.5sec 41.61% 41.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.61%

    Trigger Attempt Success

    • trigger_pct:99.41%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.82% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.82%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.27%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 23.00% 53.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.00%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.5sec 55.2sec 17.65% 17.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.65%

    Trigger Attempt Success

    • trigger_pct:99.88%
twist_of_fate 1.0 342.7 0.0sec 0.4sec 32.05% 32.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-shadowcrawl 23.5 0.0 19.2sec 19.2sec 85.38% 75.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.09% 28.84%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.25% 16.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 327500.5
halo Mana 10.5 423937.8 40500.0 40499.7 19.4
mind_blast Mana 45.0 405340.9 9000.0 9000.0 30.6
mind_flay Mana 81.6 244912.2 3000.0 3000.0 50.1
mind_sear Mana 1.0 8826.8 9000.0 8998.6 4.5
shadow_word_death Mana 15.7 122440.0 7800.0 7800.7 42.0
shadow_word_pain Mana 159.2 2101852.9 13200.0 13199.9 19.7
vampiric_touch Mana 38.5 346352.4 9000.0 8999.9 43.5
Resource Gains Type Count Total Average Overflow
mindbender Mana 113.14 571494.37 (22.32%) 5051.42 21119.42 3.56%
Shadow Orbs from Mind Blast Shadow Orb 45.00 44.52 (84.90%) 0.99 0.48 1.07%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.92 7.92 (15.10%) 1.00 0.00 0.00%
Devouring Plague Health Health 230.11 0.00 (0.00%) 0.00 4893088.19 100.00%
Vampiric Touch Mana Mana 286.62 1451945.40 (56.71%) 5065.75 6421.56 0.44%
halo_heal Health 10.47 0.00 (0.00%) 0.00 3778465.86 100.00%
external_healing Health 83.55 0.00 (0.00%) 0.00 29218482.15 100.00%
mp5_regen Mana 1801.93 536848.52 (20.97%) 297.93 3730.57 0.69%
pet - mindbender
external_healing Health 26.91 0.00 (0.00%) 0.00 9953098.17 100.00%
Resource RPS-Gain RPS-Loss
Mana 5681.86 8108.31
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -792629.16 -1393195.24 -324233.33
Shadow Orb 1.34 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%
shadowfiend-Mana Cap 0.7%
mindbender-Mana Cap 0.7%

Procs

Count Interval
Shadowy Recall Extra Tick 429.0 1.0sec
Shadowy Apparition Procced 283.7 1.6sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 308327.62
Minimum 269053.51
Maximum 357392.12
Spread ( max - min ) 88338.61
Range [ ( max - min ) / 2 * 100% ] 14.33%
Standard Deviation 10401.5792
5th Percentile 291461.44
95th Percentile 325689.25
( 95th Percentile - 5th Percentile ) 34227.81
Mean Distribution
Standard Deviation 65.7959
95.00% Confidence Intervall ( 308198.66 - 308456.58 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4371
0.1 Scale Factor Error with Delta=300 923596
0.05 Scale Factor Error with Delta=300 3694385
0.01 Scale Factor Error with Delta=300 92359640
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 308327.62
Minimum 269053.51
Maximum 357392.12
Spread ( max - min ) 88338.61
Range [ ( max - min ) / 2 * 100% ] 14.33%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 128339250.65
Minimum 92224037.99
Maximum 167584234.02
Spread ( max - min ) 75360196.02
Range [ ( max - min ) / 2 * 100% ] 29.36%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.95 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.78 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.71 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 7.92 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.51 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 36.94 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 1.84 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.72 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.47 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.03 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.67 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.98 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 81.64 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 127.88 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9HLMSZZZZccccHZOZZcccHQZZZccccHMZZZccccHLLLMMSccHMQZZ9cccHZZZOccccHMZZccccHQZZOLLLHMMMMScccHZZOZcccHQZZZ9ccHMZZccccHLLLMMSccHMQZZccccHZZOccccHMZZZccccHQZOZL9LHLMMMSccccHMZZZcccHQZZOccccHMZZccccHLLLMMSccHMQZZcc9cHZZOccccHZZZccccHMQZZLLLSHMMMOYNccHZZZZccccHMQZZcc9cHZZOcccSHLLLMccccHMQZZcccHZZOZcccHZZZccccHMQSZLLL9HMMMOccccHMZIFQcccHZVIFOccccHGIFMScccHLIFLLQccHMIF8ZZccc9HGIFOcccMHZIFQScccHZIFMLLL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 298898 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
298897.8 298897.8 134.93 / 0.05% 17891 / 6.0% 40.8 7100.5 4700.8 Mana 0.29% 51.9 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.39 5.52 5.22 4.88 7.00 4.72
Normalized 1.00 0.75 0.71 0.66 0.95 0.64
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.19 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > Haste > SP > Hit > Crit ~= Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.39, SpellDamage=5.52, HitRating=5.22, CritRating=4.88, HasteRating=7.00, MasteryRating=4.72 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.39, SpellDamage=5.52, HitRating=0.00, CritRating=4.88, HasteRating=7.00, MasteryRating=4.72 )

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:879568|524002|336094|265041|244978|238140|201826|110777|72034&chds=0,1759135&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++879568++devouring_plague,9482C9,0,0,15|t++524002++halo,9482C9,1,0,15|t++336094++vampiric_touch,9482C9,2,0,15|t++265041++shadow_word_death,9482C9,3,0,15|t++244978++shadow_word_pain,9482C9,4,0,15|t++238140++mind_blast,9482C9,5,0,15|t++201826++mind_flay_insanity,9482C9,6,0,15|t++110777++mind_flay,9482C9,7,0,15|t++72034++mind_sear,9482C9,8,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,11,9,8,7,7,6,6,4,4,4,4,3,3,3,3,3,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|shadowy_apparition|essence_of_yulon|devouring_plague_tick|vampiric_touch|shadow_word_pain_mastery|mind_flay_insanity|halo_damage|devouring_plague|mind_flay|multistrike_spell|devouring_plague_mastery|shadow_word_death|vampiric_touch_mastery|shadowfiend: melee|mind_flay_insanity_mastery|mind_flay_mastery|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.39,7.00,5.52,5.22,4.88,4.72|7.20,6.81,5.33,5.03,4.69,4.52|7.58,7.19,5.71,5.42,5.07,4.91&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.39++Int,FFFFFF,0,0,15,0.1,e|t++++7.00++Haste,FFFFFF,0,1,15,0.1,e|t++++5.52++SP,FFFFFF,0,2,15,0.1,e|t++++5.22++Hit,FFFFFF,0,3,15,0.1,e|t++++4.88++Crit,FFFFFF,0,4,15,0.1,e|t++++4.72++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.881& http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gikmptvz2467786764310zzyxvutsrqqpoonnmlkmprtuuvvuuutttsrrqppmjgedcccbccccccccccccccefgghijkllmmmnnnnnnmkjiihgfeddccccccddddeeffghhknqtvwxxyyyyyyyxxxwwtqnkihggfffeeeeeedddddeeggijknpqrsstttttttsrqponligfeddccccccccccccdddehjlnnnooooooooooooomkigeeeeeeeffffggggghhhkllmnoqrssttttttttssponnmkihggfeeeeeeeeeeeeffffhjlnppppppppppppppponljhffffeeeffffffffffffgijkmnqsuvxxyzzzz000zyxwvusqonmmllllllllllmmmmmopruvvwwwwwwwwwwvvvvusqnmlllkkkkkkkkkkkkkkklmmnnopqrrssssssssssrqqqpponmmllllllllmmmmmnnnopqsvwxxyyyzzzz0zzzzzzywussssrrrrrrqqqqppppppqrrrtuvvvvuspnljhfdbY&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6497,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=298898|max=460072&chxp=1,1,65,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,3,3,6,22,23,38,95,115,185,221,359,487,598,787,988,1149,1357,1418,1619,1633,1729,1578,1621,1486,1303,1211,1013,895,695,538,464,373,279,184,168,104,85,51,39,21,14,11,7,9,1,1,0,2&chds=0,1729&chbh=5&chxt=x&chxl=0:|min=257355|avg=298898|max=347678&chxp=0,1,46,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:33.8,16.7,13.5,12.5,8.8,4.8,3.7,2.5,0.7,0.1,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 152.1s|mind_flay 75.4s|mind_blast 60.7s|mind_flay_insanity 56.3s|vampiric_touch 39.5s|devouring_plague 21.8s|shadow_word_death 16.7s|halo 11.2s|shadowfiend 3.3s|mind_sear 0.4s|waiting 1.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 298898
devouring_plague 12625 (42507) 4.2% (14.2%) 20.2 21.99sec 948020 879568 192087 416324 281566 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 0.00 0.00 1.0778 0.0000 5689099.23 5689099.23 0.00 879567.65 879567.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.11 59.93% 192086.78 169721 307820 192085.18 169721 249049 2325915 2325915 0.00
crit 8.08 39.98% 416324.23 353627 769642 416644.23 0 672958 3363184 3363184 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9841 3.3% 83.6 5.12sec 53035 0 32217 84184 53106 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.62 83.51 0.00 0.00 0.0000 0.0000 4434809.37 4434809.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.83 59.67% 32217.37 28287 51304 32227.09 28892 37121 1605344 1605344 0.00
crit 33.61 40.25% 84183.93 71200 159064 84178.38 72684 101183 2829465 2829465 0.00
miss 0.07 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20041 6.7% 20.2 21.99sec 446973 0 0 0 0 0.0% 0.0% 0.0% 0.0% 191.6 32163 69396 47143 40.2% 0.0% 27.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 191.57 191.57 0.0000 0.6491 9031315.67 9031315.67 0.00 72622.35 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.5 59.77% 32163.13 28287 101130 32173.16 28869 66671 3682718 3682718 0.00
crit 77.1 40.23% 69396.07 58939 250037 69381.84 60666 142466 5348597 5348597 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 23778 8.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 167.2 25405 55245 37428 40.3% 0.1% 29.5%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.20 167.22 286.14 0.0000 0.7955 10709580.01 10709580.01 0.00 80510.45 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 170.6 59.61% 25404.81 21101 40897 25411.58 22986 29013 4333298 4333298 0.00
crit 115.4 40.34% 55245.30 43965 102254 55234.05 49190 65380 6376282 6376282 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (13013) 0.0% (4.4%) 10.4 45.07sec 564129 524002 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 1.0766 0.0000 0.00 0.00 0.00 524002.34 524002.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.17 59.44% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.20 40.46% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 13013 4.4% 10.4 45.07sec 564129 0 176432 381782 259092 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 22.62 0.00 0.00 0.0000 0.0000 5860442.18 5860442.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.50 59.67% 176431.87 153853 275756 176856.07 0 222061 2381251 2381251 0.00
crit 9.11 40.29% 381782.20 320566 689472 381780.98 0 624392 3479191 3479191 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 32085 10.7% 55.3 8.19sec 261437 238140 178915 386338 261437 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.28 55.28 0.00 0.00 1.0978 0.0000 14453451.81 14453451.81 0.00 238140.34 238140.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.20 60.05% 178914.98 135799 396163 178892.66 149767 214598 5940003 5940003 0.00
crit 22.04 39.86% 386337.87 282948 990526 386381.11 311079 510748 8513449 8513449 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 12438 (18571) 4.2% (6.2%) 53.2 8.03sec 156895 110777 0 0 0 0.0% 0.1% 0.0% 0.0% 90.6 41437 91397 61692 40.5% 0.0% 12.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.20 53.20 90.63 90.63 1.4163 0.6250 5590816.59 5590816.59 0.00 110777.47 110777.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.15 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.9 59.46% 41437.09 35993 65277 41468.12 37012 48089 2232763 2232763 0.00
crit 36.7 40.54% 91396.53 74995 163211 91462.61 78793 117139 3358054 3358054 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 17455 (25238) 5.8% (8.4%) 38.5 11.18sec 295545 201826 0 0 0 0.0% 0.1% 0.0% 0.0% 65.7 81849 175818 119660 40.2% 0.0% 9.4%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.46 38.46 65.71 65.71 1.4644 0.6476 7862903.28 7862903.28 0.00 201825.74 201825.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.43 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.3 59.76% 81849.47 71987 130553 81873.49 72624 99696 3214343 3214343 0.00
crit 26.4 40.24% 175817.63 149990 326421 175772.54 150786 220372 4648560 4648560 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 7783 2.6% 28.8 14.66sec 121861 0 74314 193251 122005 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.75 28.72 0.00 0.00 0.0000 0.0000 3503922.27 3503922.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.16 59.75% 74313.94 35993 130553 74357.35 47506 99534 1275306 1275306 0.00
crit 11.53 40.15% 193251.17 90596 404768 193268.61 0 285138 2228617 2228617 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6133 2.0% 39.6 10.46sec 69690 0 41513 111131 69710 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.55 39.54 0.00 0.00 0.0000 0.0000 2756487.49 2756487.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.47 59.35% 41513.05 35993 65277 41548.13 35993 50454 974231 974231 0.00
crit 16.04 40.56% 111130.64 90596 202384 111218.45 90596 161108 1782257 1782257 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 64 0.0% 0.4 124.72sec 80331 72034 0 0 0 0.0% 0.1% 0.0% 0.0% 0.2 23973 52338 35288 39.9% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.36 0.36 0.20 0.81 1.1161 0.6248 28597.33 28597.33 0.00 72033.57 72033.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.36 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.5 60.07% 23973.01 21183 36670 3129.17 0 36670 11669 11669 0.00
crit 0.3 39.91% 52338.03 44137 91686 6290.53 0 91686 16928 16928 0.00
miss 0.0 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 31 0.0% 0.4 21.03sec 39605 0 23922 63443 39603 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.35 0.35 0.00 0.00 0.0000 0.0000 13953.39 13953.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.21 60.19% 23922.12 21183 36670 2547.07 0 36670 5073 5073 0.00
crit 0.14 39.73% 63443.14 53319 113692 5418.80 0 113692 8880 8880 0.00
miss 0.00 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (31) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 11064 3.7% 232.8 1.99sec 21408 0 21408 0 21408 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 232.76 232.76 0.00 0.00 0.0000 0.0000 4982851.70 4982851.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 232.76 100.00% 21407.79 7034 371987 21418.49 15774 29600 4982852 4982852 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:74853.19
  • base_dd_max:74853.19
shadow_word_death 9815 3.3% 15.4 4.74sec 286512 265041 195289 421615 286515 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 1.0810 0.0000 4422203.32 4422203.32 0.00 265040.65 265040.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.19 59.55% 195288.83 152630 446332 195612.27 152630 295289 1794996 1794996 0.00
crit 6.23 40.37% 421615.07 318016 1115962 422352.41 0 912656 2627207 2627207 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37659 (82727) 12.6% (27.7%) 141.3 3.17sec 263752 244978 0 0 0 0.0% 0.1% 0.0% 0.0% 462.7 24978 54121 36666 40.1% 0.0% 138.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.31 141.31 462.73 462.73 1.0766 1.3488 16966335.94 16966335.94 0.00 48010.94 244978.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.20 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 277.1 59.89% 24978.16 21342 40629 24984.39 23638 27376 6922504 6922504 0.00
crit 185.6 40.11% 54120.59 44467 101583 54132.63 50329 59555 10043832 10043832 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18795 6.3% 202.1 2.20sec 41889 0 25365 66669 41922 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 202.12 201.97 0.00 0.00 0.0000 0.0000 8466702.32 8466702.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.71 59.77% 25365.29 22409 40629 25370.61 23719 27908 3061969 3061969 0.00
crit 81.07 40.14% 66668.91 56403 125965 66686.21 60334 75753 5404733 5404733 0.00
miss 0.18 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0853 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 26272 8.8% 266.6 1.68sec 44392 0 30375 66070 44809 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 266.64 264.17 0.00 0.00 0.0000 0.0000 11836943.15 11836943.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.35 59.56% 30375.38 26478 48441 30379.34 28254 33445 4779608 4779608 0.00
crit 106.82 40.44% 66069.78 55169 121116 66073.99 60522 74793 7057335 7057335 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1252 0.4% 3.0 91.00sec 182226 0 110096 275314 182232 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.05 3.05 0.00 0.00 0.0000 0.0000 555019.52 555019.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.71 56.13% 110095.92 83080 153360 91614.15 0 153360 188226 188226 0.00
crit 1.33 43.74% 275314.10 173104 383445 204966.78 0 383445 366794 366794 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 19829 (29525) 6.6% (9.9%) 33.1 13.51sec 401491 336094 0 0 0 0.0% 0.1% 0.0% 0.0% 183.2 32992 71927 48710 40.4% 0.0% 78.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.10 33.10 183.21 183.21 1.1946 1.9258 8924012.76 8924012.76 0.00 33867.30 336093.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.08 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.2 59.63% 32992.12 27457 53135 33008.81 30172 37005 3604222 3604222 0.00
crit 74.0 40.37% 71927.26 57209 132854 71944.94 64287 83065 5319791 5319791 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 9696 3.2% 80.0 5.49sec 54532 0 32886 86930 54571 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.03 79.97 0.00 0.00 0.0000 0.0000 4364128.87 4364128.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.77 59.73% 32885.96 28830 53135 32896.75 29465 37227 1570902 1570902 0.00
crit 32.13 40.18% 86929.81 72566 164741 86961.04 74053 104187 2793227 2793227 0.00
miss 0.07 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115596 / 9228
melee 115211 3.0% 35.6 11.06sec 115079 123110 76472 179074 115080 41.8% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.57 35.57 0.00 0.00 0.9348 0.0000 4093638.23 4093638.23 0.00 123109.53 123109.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.17 34.21% 76471.92 57590 120110 76644.71 61396 114888 930640 930640 0.00
crit 14.87 41.79% 179074.21 115181 288264 178681.71 126699 244363 2662324 2662324 0.00
glance 8.50 23.90% 58897.65 43193 90083 58890.31 0 90083 500674 500674 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0758 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 385 0.0% 1.4 1.76sec 9798 0 5833 14371 9798 46.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 13593.52 13593.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 53.40% 5833.03 4377 7078 3175.04 0 7078 4321 4321 0.00
crit 0.65 46.50% 14371.24 10506 16987 7021.07 0 16987 9272 9272 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6741.11
  • base_dd_max:6741.11

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 30.1 3.1 14.4sec 13.0sec 9.35% 52.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.35%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.2 0.0 22.0sec 22.0sec 25.77% 27.16%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.2sec 125.2sec 17.47% 17.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.47%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.52% 41.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.52%

    Trigger Attempt Success

    • trigger_pct:99.41%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.0sec 10.0sec 14.59% 49.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.59%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.5sec 39.7sec 22.94% 52.99%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.94%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 56.5sec 56.3sec 17.29% 17.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.29%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.97% 56.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.29% 16.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 20.2 60.6 3.0 3.0 316200.3
halo Mana 10.4 420733.4 40500.0 40500.0 13.9
mind_blast Mana 55.3 217109.9 3927.1 3927.1 66.6
mind_flay Mana 53.2 159611.2 3000.0 3000.0 52.3
mind_flay_insanity Mana 38.5 115385.8 3000.0 3000.1 98.5
mind_sear Mana 0.4 3203.6 9000.0 8999.1 8.9
shadow_word_death Mana 15.4 120398.0 7800.0 7800.5 36.7
shadow_word_pain Mana 141.3 1865213.3 13200.0 13199.7 20.0
vampiric_touch Mana 33.1 297870.1 9000.0 8999.9 44.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.54 264719.81 (12.50%) 7448.96 55120.75 17.23%
Shadow Orbs from Mind Blast Shadow Orb 55.24 54.23 (87.45%) 0.98 1.00 1.82%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.78 7.78 (12.55%) 1.00 0.00 0.00%
Devouring Plague Health Health 275.08 0.00 (0.00%) 0.00 5849448.03 100.00%
Vampiric Touch Mana Mana 263.18 1319894.80 (62.31%) 5015.22 19251.44 1.44%
halo_heal Health 10.39 0.00 (0.00%) 0.00 3586803.73 100.00%
external_healing Health 83.63 0.00 (0.00%) 0.00 29379823.92 100.00%
mp5_regen Mana 1801.93 533592.76 (25.19%) 296.12 6986.33 1.29%
pet - shadowfiend
external_healing Health 21.19 0.00 (0.00%) 0.00 7911638.98 100.00%
Resource RPS-Gain RPS-Loss
Mana 4700.78 7100.48
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -779304.83 -1350600.00 -139200.00
Shadow Orb 1.44 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%
shadowfiend-Mana Cap 1.3%
mindbender-Mana Cap 1.3%

Procs

Count Interval
Shadowy Recall Extra Tick 434.1 1.0sec
Shadowy Apparition Procced 266.7 1.7sec
Divine Insight Mind Blast CD Reset 56.3 13.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 298897.81
Minimum 257354.83
Maximum 347677.50
Spread ( max - min ) 90322.67
Range [ ( max - min ) / 2 * 100% ] 15.11%
Standard Deviation 10883.0273
5th Percentile 281611.69
95th Percentile 317394.01
( 95th Percentile - 5th Percentile ) 35782.31
Mean Distribution
Standard Deviation 68.8413
95.00% Confidence Intervall ( 298762.88 - 299032.73 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5092
0.1 Scale Factor Error with Delta=300 1011074
0.05 Scale Factor Error with Delta=300 4044297
0.01 Scale Factor Error with Delta=300 101107437
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 298897.81
Minimum 257354.83
Maximum 347677.50
Spread ( max - min ) 90322.67
Range [ ( max - min ) / 2 * 100% ] 15.11%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 130453576.19
Minimum 94208366.27
Maximum 174217188.00
Spread ( max - min ) 80008821.72
Range [ ( max - min ) / 2 * 100% ] 30.67%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.65 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 3.76 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.44 mind_blast,if=active_enemies<=5&cooldown_react
I 7.78 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 3.35 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 35.11 mind_flay_insanity,interrupt=1,chain=1
L 29.52 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 32.59 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 3.22 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 8.10 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 16.44 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.39 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.47 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 8.07 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.36 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 53.20 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 108.57 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZZccccHZOZcccHQKKKKccccHMZZZccccHLLLMMSccHMQKKHcccZZOHcccHQKKKKccccHMZZZLLHLMMMSOccccHMQKKccccHZZOccccHMZZZccHQKKKLLHLMSZZZccHcZZOZccccHQKKKccccHMZZZALLHLMHMMNQSKHKJccccMHZZcHQcKHKOccccHLLLMcHQSKKKHccccMZWHZccccZZHOccccMZHQKLLLSMMHMOYcccZHZZccccMHQKKcccHZZOZcccHLLLHMQSHcKHMZZccccHQKKcccHMZZZcccHZZOZHALLLMGHKNSccMWHZIFQccKHJIFcccMHQKIFccZHLLIFLQSKHK8IFNccHMQKIFHccZHQKIFccHMZZIFLL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 302025 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
302025.4 302025.4 123.98 / 0.04% 16343 / 5.4% 37.3 7852.8 4948.0 Mana 0.04% 52.6 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.64 5.69 6.33 5.14 8.01 4.74
Normalized 1.00 0.74 0.83 0.67 1.05 0.62
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.18 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Hit > SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.64, SpellDamage=5.69, HitRating=6.33, CritRating=5.14, HasteRating=8.01, MasteryRating=4.74 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.64, SpellDamage=5.69, HitRating=0.00, CritRating=5.14, HasteRating=8.01, MasteryRating=4.74 )

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:867036|732837|328230|267835|248449|238357|189014|122734|29397&chds=0,1734072&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++867036++devouring_plague,9482C9,0,0,15|t++732837++halo,9482C9,1,0,15|t++328230++vampiric_touch,9482C9,2,0,15|t++267835++shadow_word_death,9482C9,3,0,15|t++248449++mind_blast,9482C9,4,0,15|t++238357++shadow_word_pain,9482C9,5,0,15|t++189014++mind_flay_insanity,9482C9,6,0,15|t++122734++mind_flay,9482C9,7,0,15|t++29397++mind_sear,9482C9,8,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,9,8,7,6,6,5,4,4,4,4,3,3,3,2,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|vampiric_touch|shadow_word_pain_mastery|halo_damage|devouring_plague_tick|mind_flay|mind_flay_insanity|multistrike_spell|vampiric_touch_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery|mind_flay_insanity_mastery|stormlash|mind_sear|shadowfiend: stormlash|mind_sear_mastery&
http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.01,7.64,6.33,5.69,5.14,4.74|7.84,7.46,6.15,5.51,4.97,4.56|8.19,7.81,6.51,5.86,5.32,4.91&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.01++Haste,FFFFFF,0,0,15,0.1,e|t++++7.64++Int,FFFFFF,0,1,15,0.1,e|t++++6.33++Hit,FFFFFF,0,2,15,0.1,e|t++++5.69++SP,FFFFFF,0,3,15,0.1,e|t++++5.14++Crit,FFFFFF,0,4,15,0.1,e|t++++4.74++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.625& http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:jmnpquy14687775754421000zyvutssrqqponljhmnoopoqpqrsssssrrqppigfdccbaZYXWWVVWWXYaabcghijkknnnooonmmkjihhdcbbbcbbccccddeeffgghhiijiioqstvvxyz1223322100zspnljigfdbZZYXXXXYZbbcdefhijloqrsttsrqponmlkjihhhedcccbcccccccccccccbacfhijijklnnopppqqqqqnkihggffeeddcdcdeeghijkpqssttvwwwwwvutrponmhgfeffdeeeddeeeeeeeeeeeeedcghijkkllmnoopppppoookigfeeddcbaaZZZaabbdddefhjlnptvxz01112211211zyywwsrponnnmmmlllllllllkkmoqstttuuvvvwwwvvvvuspnlkjjiihhhggggghhhiiillmmnnoppqqrrrrrqqqqonmmmmllkkjjjjjkklmmmnopqrruwy13345544443322110zxvsrqqppooonnnmmmlllllmnoopqrtuvwwtrpmkjhfdb&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6372,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=302025|max=473958&chxp=1,1,64,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,0,3,4,4,24,23,42,87,130,210,297,453,604,789,1032,1197,1522,1572,1791,1754,1779,1764,1694,1520,1405,1160,974,788,626,476,335,284,207,133,99,60,49,34,27,14,10,4,3,4,1,1,0,0,1&chds=0,1791&chbh=5&chxt=x&chxl=0:|min=262793|avg=302025|max=353159&chxp=0,1,43,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.6,16.5,10.7,10.2,10.2,4.1,3.7,2.4,0.7,0.1,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 173.8s|mind_flay 74.5s|mind_blast 48.2s|mind_flay_insanity 45.9s|vampiric_touch 45.8s|devouring_plague 18.3s|shadow_word_death 16.8s|halo 11.0s|shadowfiend 3.3s|mind_sear 0.6s|waiting 0.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 302025
devouring_plague 10491 (35256) 3.5% (11.7%) 17.0 26.04sec 932954 867036 190966 408440 277566 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 0.00 0.00 1.0761 0.0000 4728094.79 4728094.79 0.00 867036.22 867036.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 60.02% 190966.01 169721 323211 190961.79 169721 240053 1952400 1952400 0.00
crit 6.80 39.90% 408439.72 353627 808124 408694.15 0 747390 2775695 2775695 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8171 2.7% 70.6 6.01sec 52184 0 31999 82740 52267 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.58 70.46 0.00 0.00 0.0000 0.0000 3683025.88 3683025.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.22 59.91% 31999.22 28287 53869 32011.16 28618 38395 1350951 1350951 0.00
crit 28.19 40.00% 82739.74 71200 167017 82750.98 71605 104016 2332075 2332075 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16594 5.5% 17.0 26.04sec 439169 0 0 0 0 0.0% 0.0% 0.0% 0.0% 161.4 31877 68099 46358 40.0% 0.0% 23.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 161.37 161.37 0.0000 0.6458 7480786.12 7480786.12 0.00 71787.06 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.9 60.02% 31877.14 28287 162805 31890.70 28802 45015 3087543 3087543 0.00
crit 64.5 39.98% 68098.95 58939 407060 68104.93 60175 99455 4393243 4393243 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25750 8.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 175.6 25688 55971 37891 40.3% 0.1% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.76 175.61 306.12 0.0000 0.7964 11599272.75 11599272.75 0.00 82942.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.5 59.61% 25688.49 21101 42942 25696.74 23477 29272 4687335 4687335 0.00
crit 123.5 40.34% 55970.74 43965 107367 55960.96 49586 67019 6911938 6911938 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (17846) 0.0% (5.9%) 10.3 45.52sec 782311 732837 0 0 0 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 0.00 0.00 1.0676 0.0000 0.00 0.00 0.00 732837.03 732837.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.09 59.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.19 40.71% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 17846 5.9% 10.3 45.52sec 782311 0 176770 384969 260630 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 30.89 0.00 0.00 0.0000 0.0000 8051680.47 8051680.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.43 59.67% 176769.80 153853 289544 176831.18 156220 220040 3258434 3258434 0.00
crit 12.45 40.30% 384968.75 320566 723945 384263.74 320566 537962 4793246 4793246 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26583 8.8% 45.1 10.08sec 265792 248449 182110 392224 265787 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.07 45.07 0.00 0.00 1.0698 0.0000 11977977.60 11977977.60 0.00 248449.06 248449.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.04 60.00% 182109.83 135799 415972 182081.11 153654 213945 4924176 4924176 0.00
crit 17.98 39.91% 392223.78 282948 1040052 392332.09 302895 511153 7053802 7053802 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 13605 (20368) 4.5% (6.7%) 52.8 8.13sec 173084 122734 0 0 0 0.0% 0.1% 0.0% 0.0% 95.4 42772 94857 64068 40.9% 0.0% 12.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.85 52.85 95.38 95.38 1.4102 0.5843 6110526.77 6110526.77 0.00 122733.82 122733.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.80 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.4 59.11% 42771.73 35993 68540 42813.39 38050 50029 2411548 2411548 0.00
crit 39.0 40.89% 94857.27 74995 171371 94929.23 79585 116560 3698978 3698978 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 13020 (19275) 4.3% (6.4%) 33.9 12.58sec 256051 189014 0 0 0 0.0% 0.1% 0.0% 0.0% 49.7 81119 172845 117870 40.1% 0.0% 7.1%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.89 33.89 49.73 49.73 1.3547 0.6397 5861694.98 5861694.98 0.00 189013.75 189013.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.86 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.8 59.93% 81119.34 71987 137081 81127.79 72411 97896 2417763 2417763 0.00
crit 19.9 40.07% 172845.01 149990 342742 172745.02 149990 216535 3443932 3443932 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6255 2.1% 21.8 19.21sec 129440 0 79592 204875 129575 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.75 21.73 0.00 0.00 0.0000 0.0000 2815359.31 2815359.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.03 59.96% 79591.50 35993 137081 79693.31 57994 103533 1036945 1036945 0.00
crit 8.68 39.95% 204874.62 90596 425007 204900.52 0 318419 1778414 1778414 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6762 2.2% 41.7 10.05sec 72840 0 43069 116059 72858 40.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.69 41.68 0.00 0.00 0.0000 0.0000 3036702.12 3036702.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.61 59.04% 43068.66 35993 68540 43114.46 36909 54315 1059803 1059803 0.00
crit 17.03 40.87% 116059.21 90596 212503 116148.62 91907 160936 1976899 1976899 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 40 0.0% 0.5 170.06sec 32824 29397 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 24407 52326 35723 40.5% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.54 0.54 0.12 0.50 1.1176 0.5667 17843.77 17843.77 0.00 29396.65 29396.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.54 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.3 59.42% 24406.54 21183 38503 2092.55 0 36670 7244 7244 0.00
crit 0.2 40.55% 52326.35 44137 96270 4116.83 0 77071 10599 10599 0.00
miss 0.0 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 20 0.0% 0.2 5.90sec 40136 0 24371 63503 40135 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.22 0.22 0.00 0.00 0.0000 0.0000 8787.78 8787.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.13 59.63% 24371.25 21183 38503 1657.25 0 36670 3182 3182 0.00
crit 0.09 40.31% 63502.97 53319 119377 3511.75 0 95569 5606 5606 0.00
miss 0.00 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (20) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 11033 3.7% 238.7 1.95sec 20811 0 20811 0 20811 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.73 238.73 0.00 0.00 0.0000 0.0000 4968310.30 4968310.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 238.73 100.00% 20811.16 7034 390587 20823.84 15647 28198 4968310 4968310 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:71986.69
  • base_dd_max:71986.69
power_infusion 0 0.0% 4.3 120.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9970 3.3% 15.6 4.69sec 287279 267835 196087 422942 287285 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.63 15.63 0.00 0.00 1.0727 0.0000 4488922.44 4488922.44 0.00 267835.47 267835.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.32 59.66% 196087.05 152630 468649 196413.69 152630 286934 1828024 1828024 0.00
crit 6.29 40.26% 422941.93 318016 1171761 423816.89 0 924933 2660899 2660899 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41774 (91923) 13.8% (30.5%) 162.6 2.75sec 254748 238357 0 0 0 0.0% 0.1% 0.0% 0.0% 504.9 25345 55015 37276 40.2% 0.0% 142.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.58 162.58 504.94 504.94 1.0688 1.2710 18822480.51 18822480.51 0.00 50786.37 238356.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.46 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.9 59.79% 25345.04 21342 42660 25351.26 23851 27975 7651371 7651371 0.00
crit 203.1 40.21% 55015.04 44467 106663 55028.02 51377 61260 11171110 11171110 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20883 6.9% 220.7 2.02sec 42637 0 25756 67858 42670 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.67 220.50 0.00 0.00 0.0000 0.0000 9408666.75 9408666.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.60 59.68% 25755.74 22409 42660 25761.41 24171 28840 3389499 3389499 0.00
crit 88.70 40.23% 67858.07 56403 132264 67880.44 61453 77459 6019168 6019168 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 29267 9.7% 291.7 1.53sec 45200 0 30862 67290 45635 40.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 291.75 288.96 0.00 0.00 0.0000 0.0000 13186916.92 13186916.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.77 59.44% 30861.83 26478 50863 30866.63 28815 33901 5301264 5301264 0.00
crit 117.19 40.56% 67289.58 55169 127172 67296.06 60897 75869 7885653 7885653 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1299 0.4% 3.0 90.95sec 192217 0 115318 290118 192212 44.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 575104.97 575104.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.67 55.82% 115317.51 83080 161028 95552.00 0 161028 192597 192597 0.00
crit 1.32 44.07% 290117.77 173104 402617 216971.66 0 402617 382508 382508 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:106984.80
  • base_dd_max:106984.80
vampiric_touch 22485 (33441) 7.4% (11.1%) 37.7 11.88sec 399083 328230 0 0 0 0.0% 0.1% 0.0% 0.0% 202.5 33691 73808 49948 40.5% 0.0% 83.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.69 37.69 202.46 202.46 1.2159 1.8472 10112459.37 10112459.37 0.00 35827.16 328230.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.67 99.95% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.4 59.48% 33691.27 27457 55792 33712.23 30886 38146 4056960 4056960 0.00
crit 82.0 40.52% 73808.01 57209 139496 73838.56 66242 87358 6055499 6055499 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10956 3.6% 88.5 4.99sec 55667 0 33457 88772 55704 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.53 88.47 0.00 0.00 0.0000 0.0000 4928354.89 4928354.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.76 59.64% 33456.87 28830 55792 33468.90 30404 38800 1765316 1765316 0.00
crit 35.63 40.27% 88771.67 72566 172978 88818.80 77144 106883 3163039 3163039 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115538 / 9222
melee 115148 3.0% 35.6 11.07sec 114995 123021 76435 179152 114993 41.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.57 35.57 0.00 0.00 0.9348 0.0000 4089940.05 4089940.05 0.00 123020.52 123020.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.17 34.21% 76434.86 57590 120110 76621.26 59884 109990 930088 930088 0.00
crit 14.83 41.70% 179152.08 115181 288264 178799.06 136166 259754 2657006 2657006 0.00
glance 8.53 23.99% 58939.94 43193 90083 58932.23 0 90083 502846 502846 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0685 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 390 0.0% 1.4 1.75sec 9842 0 5829 14385 9842 47.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.40 0.00 0.00 0.0000 0.0000 13775.49 13775.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.89% 5829.10 4377 7078 3161.24 0 7078 4315 4315 0.00
crit 0.66 46.99% 14384.81 10506 16987 7152.68 0 16987 9460 9460 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6741.11
  • base_dd_max:6741.11

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.1sec 26.1sec 28.40% 27.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.9sec 124.9sec 17.51% 17.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.51%

    Trigger Attempt Success

    • trigger_pct:99.87%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.59% 41.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.59%

    Trigger Attempt Success

    • trigger_pct:99.36%
power_infusion 4.3 0.0 120.7sec 120.7sec 18.65% 18.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.77% 49.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.77%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 22.97% 43.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.97%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.4sec 55.2sec 17.64% 17.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.64%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.0 0.0 74.2sec 74.2sec 83.38% 75.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 53.41% 57.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:53.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 311160.6
halo Mana 10.3 392174.8 38104.4 38104.2 20.5
mind_blast Mana 45.1 390333.3 8661.5 8661.5 30.7
mind_flay Mana 52.8 148158.4 2803.5 2803.5 61.7
mind_flay_insanity Mana 33.9 100977.1 2979.6 2979.7 85.9
mind_sear Mana 0.5 4874.2 8966.5 8966.3 3.7
shadow_word_death Mana 15.6 117297.1 7506.2 7506.7 38.3
shadow_word_pain Mana 162.6 2059310.5 12666.3 12666.1 20.1
vampiric_touch Mana 37.7 325401.4 8634.1 8634.0 46.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.53 247984.45 (11.12%) 6979.41 71793.47 22.45%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.55 (84.97%) 0.99 0.48 1.06%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.88 7.88 (15.03%) 1.00 0.00 0.00%
Devouring Plague Health Health 231.84 0.00 (0.00%) 0.00 4929820.20 100.00%
Vampiric Touch Mana Mana 290.93 1450362.34 (65.05%) 4985.22 29810.90 2.01%
halo_heal Health 10.29 0.00 (0.00%) 0.00 3553413.68 100.00%
external_healing Health 83.72 0.00 (0.00%) 0.00 29439129.70 100.00%
mp5_regen Mana 1801.93 531277.74 (23.83%) 294.84 9301.34 1.72%
pet - shadowfiend
external_healing Health 21.30 0.00 (0.00%) 0.00 7951261.86 100.00%
Resource RPS-Gain RPS-Loss
Mana 4948.04 7852.80
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -1011385.26 -1592760.00 -496860.00
Shadow Orb 1.33 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.8%
shadowfiend-Mana Cap 1.8%
mindbender-Mana Cap 1.8%

Procs

Count Interval
Shadowy Recall Extra Tick 443.1 1.0sec
Shadowy Apparition Procced 291.8 1.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 302025.42
Minimum 262793.37
Maximum 353159.14
Spread ( max - min ) 90365.77
Range [ ( max - min ) / 2 * 100% ] 14.96%
Standard Deviation 9999.9032
5th Percentile 286209.22
95th Percentile 318895.94
( 95th Percentile - 5th Percentile ) 32686.72
Mean Distribution
Standard Deviation 63.2551
95.00% Confidence Intervall ( 301901.44 - 302149.40 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4211
0.1 Scale Factor Error with Delta=300 853640
0.05 Scale Factor Error with Delta=300 3414563
0.01 Scale Factor Error with Delta=300 85364099
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 302025.42
Minimum 262793.37
Maximum 353159.14
Spread ( max - min ) 90365.77
Range [ ( max - min ) / 2 * 100% ] 14.96%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 131862968.49
Minimum 95425538.99
Maximum 173540591.56
Spread ( max - min ) 78115052.56
Range [ ( max - min ) / 2 * 100% ] 29.62%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.75 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.64 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.88 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.41 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 33.48 mind_flay_insanity,interrupt=1,chain=1
L 29.50 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.58 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 2.10 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 10.16 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.39 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.29 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.54 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.19 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.54 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 52.85 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 130.98 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABHLMSZZZZccccHZOZccccHQKKKccccHMZZZccccHLLLMScccHMQKKcccHZZOZcccHZZZccccHMQKKLLLSHMMMOccccHMZZZcccHQKKcBcccHMZZZccccHLLLMMSccHMQKKccccHZZOccccHMZZccccHQKKKALLHLMMMMSNcHZZZZccccHMQKKcccHZZZccccHLLLMMcSccHQKKccBccHMZZZccccHZZZOcccHMQKKLLLSHMMMOccccHMZZccccHQKKccccHMZZccccHLLLMMSccHMQKKccccHZZOccccHMZZZccccHQKKLLABLHMMMMSccccHZZIFQccHKMVIFccccHQKIFccccHLLIFLQScHKI8FMccccHGIFKcccMHVIFQKcccKHIFOZLLL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 304743 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
304742.8 304742.8 123.43 / 0.04% 16308 / 5.4% 36.3 8137.6 4887.0 Mana 0.04% 51.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.74 5.86 6.89 5.18 8.39 4.72
Normalized 1.00 0.76 0.89 0.67 1.08 0.61
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Hit > SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.74, SpellDamage=5.86, HitRating=6.89, CritRating=5.18, HasteRating=8.39, MasteryRating=4.72 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.74, SpellDamage=5.86, HitRating=0.00, CritRating=5.18, HasteRating=8.39, MasteryRating=4.72 )

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:909643|745533|315685|302920|256127|238887|196963|114578|16595&chds=0,1819286&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++909643++devouring_plague,9482C9,0,0,15|t++745533++halo,9482C9,1,0,15|t++315685++vampiric_touch,9482C9,2,0,15|t++302920++shadow_word_death,9482C9,3,0,15|t++256127++mind_blast,9482C9,4,0,15|t++238887++shadow_word_pain,9482C9,5,0,15|t++196963++mind_flay_insanity,9482C9,6,0,15|t++114578++mind_flay,9482C9,7,0,15|t++16595++mind_sear,9482C9,8,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,9,7,7,6,6,5,4,4,4,4,4,3,3,2,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|vampiric_touch|shadow_word_pain_mastery|halo_damage|devouring_plague_tick|mind_flay_insanity|mind_flay|shadow_word_death|multistrike_spell|devouring_plague|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery|mind_flay_insanity_mastery|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.39,7.74,6.89,5.86,5.18,4.72|8.21,7.57,6.71,5.68,5.01,4.54|8.56,7.92,7.07,6.03,5.36,4.89&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.39++Haste,FFFFFF,0,0,15,0.1,e|t++++7.74++Int,FFFFFF,0,1,15,0.1,e|t++++6.89++Hit,FFFFFF,0,2,15,0.1,e|t++++5.86++SP,FFFFFF,0,3,15,0.1,e|t++++5.18++Crit,FFFFFF,0,4,15,0.1,e|t++++4.72++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,10.073& http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gikloruwy12211z2000yyyxxvvuttsssrrrpomkinopqrqsrstuuuvuutssrjhgfedccaZYXXWWXXYZbccdhikllmppppqqpoomkkjiedcdddccddddeeeeefffffgggfekmoprrstvxyz00000zzyspnmkjhgecbaZZZZZZacddefgjklnrtuvvvuutrqponmlkjjigfedddddddedeeeeeddcbehijlklmnpqqrrrrrrrqnjhgffddcbaaZZZabceghijopstuvyzz000zyxvtsrrlkjjjjhhhhhhhhhiiiiiiijiihgkmnoqpqqstuuvvvvvvvupnmljjiigffeeeeeffgijjklmoqstxz13444443222110zyyxvtsrrqrrrrrssssssstsrtwz233445566777665552zwtrrqqpooonnnnnoooppqttuvvwxyyzz00000zzzzwvvuuutssrqqqpppqqqqrrsstttvwz245677787777776776520yzyyyyxxxwwwvvuutttuwwwxyz123330xuspnljge&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6749,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=304743|max=451529&chxp=1,1,67,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,6,6,7,12,47,55,74,116,167,228,350,443,573,727,930,1029,1274,1379,1427,1513,1593,1533,1478,1409,1293,1259,1006,923,855,716,578,467,365,302,194,183,129,104,65,54,44,28,16,14,6,5,4,0,2&chds=0,1593&chbh=5&chxt=x&chxl=0:|min=270023|avg=304743|max=346705&chxp=0,1,45,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.4,16.4,10.8,10.2,10.2,4.1,3.7,2.5,0.7,0.1,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 173.1s|mind_flay 73.7s|mind_blast 48.6s|vampiric_touch 46.2s|mind_flay_insanity 45.9s|devouring_plague 18.3s|shadow_word_death 16.8s|halo 11.1s|shadowfiend 3.3s|mind_sear 0.6s|waiting 0.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 304743
devouring_plague 11091 (37008) 3.6% (12.2%) 17.0 26.08sec 981225 909643 202282 432467 294043 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 1.0787 0.0000 4999753.50 4999753.50 0.00 909643.07 909643.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.20 59.98% 202281.72 169721 353993 202238.76 169721 262964 2062906 2062906 0.00
crit 6.79 39.94% 432467.19 353627 885088 432692.71 0 698337 2936847 2936847 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8558 2.8% 69.9 6.07sec 55233 0 33883 87528 55321 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.86 69.75 0.00 0.00 0.0000 0.0000 3858673.32 3858673.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.78 59.90% 33882.66 28287 59000 33889.99 29883 40191 1415559 1415559 0.00
crit 27.91 40.02% 87528.48 71200 182923 87526.03 74045 108026 2443115 2443115 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17358 5.7% 17.0 26.08sec 460261 0 0 0 0 0.0% 0.0% 0.0% 0.0% 160.0 33650 71885 48927 40.0% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 159.96 159.96 0.0000 0.6528 7826246.32 7826246.32 0.00 74951.12 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.0 60.04% 33649.66 28287 92852 33660.62 30121 43751 3231856 3231856 0.00
crit 63.9 39.96% 71885.32 58939 225631 71876.29 63115 92627 4594390 4594390 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25816 8.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.8 26574 57816 39148 40.3% 0.1% 30.2%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.75 170.76 297.01 0.0000 0.7965 11627283.06 11627283.06 0.00 85486.56 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.2 59.66% 26573.59 21101 47031 26577.98 23619 30604 4708362 4708362 0.00
crit 119.7 40.29% 57816.35 43965 117592 57796.35 51250 68806 6918921 6918921 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (18327) 0.0% (6.0%) 10.3 45.54sec 802878 745533 0 0 0 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 10.28 0.00 0.00 1.0770 0.0000 0.00 0.00 0.00 745532.92 745532.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.12 59.52% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.15 40.38% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 18327 6.0% 10.3 45.54sec 802878 0 182105 395311 267836 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 30.83 0.00 0.00 0.0000 0.0000 8256031.50 8256031.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.41 59.74% 182105.50 153853 317120 182127.01 155629 228816 3353242 3353242 0.00
crit 12.40 40.23% 395310.82 320566 792892 394668.98 322784 513801 4902789 4902789 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27596 9.1% 45.1 10.08sec 275992 256127 189044 407024 275991 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 1.0776 0.0000 12435471.68 12435471.68 0.00 256126.87 256126.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.01 59.94% 189044.42 135799 455588 189027.62 156970 224175 5105436 5105436 0.00
crit 18.01 39.97% 407024.06 282948 1139104 407113.09 303140 541721 7330036 7330036 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 12571 (18809) 4.1% (6.2%) 51.8 8.25sec 163019 114578 0 0 0 0.0% 0.1% 0.0% 0.0% 88.3 42886 94636 63945 40.7% 0.0% 12.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.83 51.83 88.32 88.32 1.4228 0.6234 5647346.42 5647346.42 0.00 114577.55 114577.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.79 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.4 59.31% 42885.96 35993 75068 42905.67 38306 48929 2246288 2246288 0.00
crit 35.9 40.69% 94636.04 74995 187692 94678.18 80667 115412 3401058 3401058 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 13566 (20073) 4.5% (6.6%) 33.8 12.61sec 267723 196963 0 0 0 0.0% 0.1% 0.0% 0.0% 49.4 85115 181609 123758 40.0% 0.0% 7.1%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.77 33.77 49.38 49.38 1.3593 0.6436 6110614.48 6110614.48 0.00 196963.40 196963.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.74 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.6 59.95% 85114.81 71987 150136 85027.49 73763 104051 2519644 2519644 0.00
crit 19.8 40.05% 181609.18 149990 375384 181294.74 150843 236837 3590970 3590970 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6507 2.1% 21.6 19.38sec 135742 0 83381 214907 135881 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.57 0.00 0.00 0.0000 0.0000 2930399.62 2930399.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.93 59.94% 83380.94 35993 150136 83403.89 57406 117435 1077811 1077811 0.00
crit 8.62 39.97% 214906.70 90596 465484 214735.85 0 330786 1852589 1852589 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6238 2.0% 38.6 10.84sec 72629 0 43161 115643 72651 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.59 38.58 0.00 0.00 0.0000 0.0000 2802519.06 2802519.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.83 59.17% 43161.40 35993 75068 43188.94 36198 53769 985178 985178 0.00
crit 15.72 40.74% 115643.44 90596 227634 115696.58 90596 166770 1817341 1817341 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 24 0.0% 0.6 177.56sec 18688 16595 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 24356 52112 35708 40.9% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.57 0.57 0.07 0.30 1.1270 0.5529 10687.19 10687.19 0.00 16595.01 16595.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.57 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 59.08% 24356.46 21183 42170 1275.80 0 42170 4307 4307 0.00
crit 0.1 40.91% 52112.11 44137 105439 2510.46 0 105439 6381 6381 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 11 0.0% 0.1 4.13sec 39456 0 24338 63170 39456 39.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.13 0.13 0.00 0.00 0.0000 0.0000 5088.28 5088.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.08 60.97% 24338.25 21183 42170 999.69 0 42170 1914 1914 0.00
crit 0.05 38.97% 63170.04 53319 106143 2071.34 0 106143 3175 3175 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (11) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 11203 3.7% 231.8 2.01sec 21772 0 21772 0 21772 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 231.77 231.77 0.00 0.00 0.0000 0.0000 5046064.68 5046064.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 231.77 100.00% 21772.38 7034 427786 21781.96 16554 30370 5046065 5046065 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:29280.36
  • base_dd_max:29280.36
shadow_word_death 11322 3.7% 15.6 4.71sec 327453 302920 223390 480839 327464 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.57 15.57 0.00 0.00 1.0810 0.0000 5099661.91 5099661.91 0.00 302920.22 302920.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.26 59.43% 223389.53 175524 513282 223793.82 175524 416537 2067591 2067591 0.00
crit 6.31 40.49% 480839.47 365719 1283357 481762.92 0 857092 3032070 3032070 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41748 (91754) 13.7% (30.1%) 160.8 2.79sec 257167 238887 0 0 0 0.0% 0.1% 0.0% 0.0% 490.3 26129 56603 38363 40.1% 0.0% 142.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 160.75 160.75 490.30 490.30 1.0765 1.3071 18809259.80 18809259.80 0.00 50791.95 238887.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.63 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 293.5 59.85% 26129.10 21342 46723 26134.59 24598 28266 7667835 7667835 0.00
crit 196.8 40.15% 56602.68 44467 116821 56612.75 52605 62928 11141425 11141425 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20855 6.8% 214.2 2.08sec 43864 0 26571 69771 43898 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.20 214.03 0.00 0.00 0.0000 0.0000 9395493.79 9395493.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.89 59.75% 26570.91 22409 46723 26576.60 24708 29170 3398068 3398068 0.00
crit 85.96 40.16% 69770.76 56403 144860 69786.61 63621 80316 5997426 5997426 0.00
miss 0.18 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0851 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 29152 9.6% 282.8 1.58sec 46449 0 31790 69117 46886 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 282.78 280.15 0.00 0.00 0.0000 0.0000 13134964.80 13134964.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 166.85 59.56% 31790.23 26478 55707 31793.74 29445 35406 5304118 5304118 0.00
crit 113.30 40.44% 69116.70 55169 139283 69118.37 62790 78524 7830847 7830847 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1211 0.4% 2.9 91.43sec 186544 0 113334 281611 186544 43.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.86 2.86 0.00 0.00 0.0000 0.0000 534418.17 534418.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.61 56.30% 113334.37 83080 166781 92871.84 0 166781 182798 182798 0.00
crit 1.25 43.59% 281611.42 173104 383445 204473.98 0 383445 351621 351621 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 21734 (32394) 7.1% (10.6%) 37.7 11.80sec 386281 315685 0 0 0 0.0% 0.1% 0.0% 0.0% 193.2 34302 74657 50620 40.4% 0.0% 82.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.73 37.73 193.19 193.19 1.2236 1.9326 9779222.03 9779222.03 0.00 34741.71 315685.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.71 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.1 59.56% 34302.07 27457 61105 34318.97 31360 39273 3947245 3947245 0.00
crit 78.1 40.44% 74657.38 57209 152782 74677.61 66968 86077 5831977 5831977 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10660 3.5% 84.4 5.20sec 56820 0 34282 90398 56856 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.41 84.36 0.00 0.00 0.0000 0.0000 4796280.57 4796280.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.30 59.63% 34281.69 28830 61105 34291.27 30520 39242 1724365 1724365 0.00
crit 33.98 40.28% 90398.06 72566 189452 90428.70 76540 108366 3071916 3071916 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115147 / 9194
melee 114756 3.0% 35.6 11.06sec 114619 122618 76289 178546 114620 41.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.57 35.57 0.00 0.00 0.9348 0.0000 4077032.89 4077032.89 0.00 122617.53 122617.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.17 34.21% 76288.90 57590 120110 76454.96 61910 112277 928397 928397 0.00
crit 14.83 41.69% 178545.91 115181 288264 178165.19 132458 248546 2647674 2647674 0.00
glance 8.54 24.00% 58687.83 43193 90083 58716.67 0 90083 500962 500962 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0757 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 391 0.0% 1.4 1.73sec 9822 0 5823 14330 9822 47.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.41 0.00 0.00 0.0000 0.0000 13828.89 13828.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.79% 5822.54 4377 7078 3181.49 0 7078 4328 4328 0.00
crit 0.66 47.09% 14330.45 10506 16987 7153.24 0 16987 9501 9501 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4169.46
  • base_dd_max:4169.46

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.28%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.1sec 26.1sec 28.44% 27.66%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.7sec 125.7sec 17.39% 17.39%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.39%

    Trigger Attempt Success

    • trigger_pct:99.86%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.5sec 23.5sec 41.64% 41.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.64%

    Trigger Attempt Success

    • trigger_pct:99.42%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.9sec 9.9sec 14.73% 49.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.73%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.7sec 39.8sec 22.89% 52.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.89%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.4sec 55.1sec 17.64% 17.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.64%

    Trigger Attempt Success

    • trigger_pct:99.88%
twist_of_fate 1.0 338.5 0.0sec 0.4sec 32.05% 32.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.2sec 74.2sec 83.38% 75.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 53.27% 57.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:53.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.29% 16.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 17.0 51.0 3.0 3.0 327261.3
halo Mana 10.3 416459.9 40500.0 40499.6 19.8
mind_blast Mana 45.1 405515.9 9000.0 9000.0 30.7
mind_flay Mana 51.8 155501.0 3000.0 3000.0 54.3
mind_flay_insanity Mana 33.8 101314.8 3000.0 3000.1 89.2
mind_sear Mana 0.6 5146.2 9000.0 8999.0 2.1
shadow_word_death Mana 15.6 121482.5 7800.0 7800.5 42.0
shadow_word_pain Mana 160.7 2121864.1 13200.0 13199.7 19.5
vampiric_touch Mana 37.7 339593.0 9000.0 8999.9 42.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.54 266256.06 (12.09%) 7492.73 53561.10 16.75%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.50 (85.00%) 0.99 0.52 1.15%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.85 7.85 (15.00%) 1.00 0.00 0.00%
Devouring Plague Health Health 229.71 0.00 (0.00%) 0.00 4884649.66 100.00%
Vampiric Touch Mana Mana 277.55 1400469.00 (63.60%) 5045.85 11745.48 0.83%
halo_heal Health 10.28 0.00 (0.00%) 0.00 3713110.70 100.00%
external_healing Health 83.73 0.00 (0.00%) 0.00 29275125.52 100.00%
mp5_regen Mana 1801.93 535380.13 (24.31%) 297.11 5198.95 0.96%
pet - shadowfiend
external_healing Health 21.26 0.00 (0.00%) 0.00 7934240.90 100.00%
Resource RPS-Gain RPS-Loss
Mana 4886.97 8137.64
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -1163353.33 -1752600.00 -602400.00
Shadow Orb 1.34 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.0%
shadowfiend-Mana Cap 1.0%
mindbender-Mana Cap 1.0%

Procs

Count Interval
Shadowy Recall Extra Tick 428.4 1.0sec
Shadowy Apparition Procced 282.8 1.6sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 304742.83
Minimum 270023.28
Maximum 346704.85
Spread ( max - min ) 76681.57
Range [ ( max - min ) / 2 * 100% ] 12.58%
Standard Deviation 9955.9000
5th Percentile 289102.79
95th Percentile 321718.75
( 95th Percentile - 5th Percentile ) 32615.96
Mean Distribution
Standard Deviation 62.9767
95.00% Confidence Intervall ( 304619.39 - 304866.26 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4100
0.1 Scale Factor Error with Delta=300 846144
0.05 Scale Factor Error with Delta=300 3384579
0.01 Scale Factor Error with Delta=300 84614486
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 304742.83
Minimum 270023.28
Maximum 346704.85
Spread ( max - min ) 76681.57
Range [ ( max - min ) / 2 * 100% ] 12.58%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 133105480.19
Minimum 96792928.02
Maximum 177359044.75
Spread ( max - min ) 80566116.73
Range [ ( max - min ) / 2 * 100% ] 30.26%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.72 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.60 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.85 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.43 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 33.35 mind_flay_insanity,interrupt=1,chain=1
L 29.47 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.50 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 2.15 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 10.66 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.40 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.28 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.36 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.57 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 51.83 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 129.12 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZZccccHZOZZccccHQKKKcccHMZZZccccHLLLMMSccHMQKKccccHZZOccccHMZZccccHQKKLLLSHMMMMYcccHZZOZcccHQKKKccccHMZZZcccHLLLMMSccHMQKKccccHZZOccccHMZZccccHQKKKALLHLMMMMNScHZZZZcccHMQKKccccHZZOZcccHLLLMMccScHMQKKcccHZZOZcccHZZZccccHMQKKLLLSHMMMOccccHMZZZccccHQKKKccccHMZZccccHLLLMMSccHMQKKccccHZZOccccHMZZccccHQKKKLALLHMMMMSNccHZZIFQccHKJIFcccHMQKIFccHLLLMIFQSHKK8JIFccHMQKIFcccHZZIFQccHKJIFLLL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 346 - 555 ( 450.6 )

Performance:
Total Events Processed: 1034943048
Max Event Queue: 280
Sim Seconds: 11265181
CPU Seconds: 1341.9200
Physical Seconds: 205.2670
Speed Up: 8395

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
Standard Deviation 55.7076
5th Percentile 368.65
95th Percentile 536.85
( 95th Percentile - 5th Percentile ) 168.19
Mean Distribution
Standard Deviation 0.3524
95.00% Confidence Intervall ( 449.92 - 451.30 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 587
0.1% Error 58712
0.1 Scale Factor Error with Delta=300 26
0.05 Scale Factor Error with Delta=300 105
0.01 Scale Factor Error with Delta=300 2649
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 5724426 12704 2.70 192045 416086 20.3 20.3 40.2% 0.1% 0.0% 0.0% 21.82sec 5724426 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 4453806 9884 11.18 32172 84066 84.1 84.0 40.2% 0.1% 0.0% 0.0% 5.09sec 4453806 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 9087995 20196 25.66 32214 69531 20.3 192.5 40.2% 0.0% 0.0% 0.0% 21.82sec 9087995 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 10803273 24007 23.27 25408 55374 0.0 174.5 40.4% 0.1% 0.0% 0.0% 0.00sec 10803273 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.40 0 0 10.5 10.5 40.3% 0.1% 0.0% 0.0% 44.34sec 0 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 5231450 11610 2.68 176890 382913 10.5 20.1 40.2% 0.1% 0.0% 0.0% 44.34sec 5231450 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 0 0 15.34 0 0 10.5 115.2 43.8% 0.0% 0.0% 0.0% 44.34sec 40483381 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 13435598 29817 7.40 165054 357173 55.6 55.6 40.0% 0.1% 0.0% 0.0% 8.12sec 13435598 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 6645978 14769 14.50 41295 90251 65.4 108.8 40.5% 0.0% 0.0% 0.0% 6.68sec 6645978 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 3264766 7245 6.32 41234 109304 47.5 47.5 40.5% 0.1% 0.0% 0.0% 8.88sec 3264766 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear ticks -48045 10328 23 0.01 23589 51509 0.1 0.1 40.4% 0.0% 0.0% 0.0% 121.19sec 10328 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_mastery 124469 5099 11 0.02 23648 62062 0.1 0.1 38.2% 0.1% 0.0% 0.0% 12.89sec 5099 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 11121059 24680 7.16 140555 305639 53.8 53.8 40.3% 0.1% 0.0% 0.0% 8.14sec 11121059 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 5183321 11503 31.38 21997 0 235.6 235.6 0.0% 0.0% 0.0% 0.0% 1.96sec 5183321 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 4383487 9728 2.09 190570 411403 15.7 15.7 40.4% 0.1% 0.0% 0.0% 4.68sec 4383487 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 16430280 36512 59.63 25011 54209 119.1 447.2 40.2% 0.0% 0.0% 0.0% 3.76sec 16430280 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 8194090 18185 26.00 25383 66733 195.4 195.3 40.1% 0.1% 0.0% 0.0% 2.28sec 8194090 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 11458604 25429 34.02 30388 66124 258.0 255.5 40.4% 0.0% 0.0% 0.0% 1.73sec 11458604 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 572595 1271 0.42 110736 276787 3.1 3.1 43.8% 0.1% 0.0% 0.0% 88.00sec 572595 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 10093690 22430 27.63 33019 71860 37.6 207.2 40.4% 0.0% 0.0% 0.0% 11.95sec 10093690 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 4931878 10945 12.04 32907 86847 90.5 90.4 40.2% 0.1% 0.0% 0.0% 4.89sec 4931878 450.61sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 4118753 115805 60.02 76835 180253 35.6 35.6 41.8% 0.1% 24.0% 0.0% 11.06sec 4118753 35.57sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.07sec 0 35.57sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 13814 388 2.36 5884 14474 1.4 1.4 46.8% 0.2% 0.0% 0.0% 1.68sec 13814 35.57sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 4743585 10527 2.27 190945 408669 17.1 17.1 40.0% 0.1% 0.0% 0.0% 25.98sec 4743585 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 3690011 8189 9.39 32010 82770 70.7 70.5 40.0% 0.1% 0.0% 0.0% 6.02sec 3690011 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 7495944 16658 21.56 31885 68158 17.1 161.7 39.9% 0.0% 0.0% 0.0% 25.98sec 7495944 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 11514503 25588 24.14 25799 56492 0.0 181.0 40.4% 0.1% 0.0% 0.0% 0.00sec 11514503 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 1.39 0 0 10.4 10.4 40.5% 0.1% 0.0% 0.0% 44.86sec 0 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 7214405 16010 3.69 177143 384054 10.4 27.7 40.3% 0.0% 0.0% 0.0% 44.86sec 7214405 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 0 0 15.49 0 0 10.4 116.3 43.8% 0.0% 0.0% 0.0% 44.86sec 40805172 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 10769485 23900 6.00 163455 353028 45.1 45.1 39.9% 0.1% 0.0% 0.0% 10.08sec 10769485 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 6893343 15319 14.67 42165 92539 65.6 110.0 40.7% 0.0% 0.0% 0.0% 6.65sec 6893343 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 3402960 7552 6.41 42247 112476 48.1 48.1 40.6% 0.1% 0.0% 0.0% 8.67sec 3402960 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear ticks -48045 12426 28 0.01 23978 53928 0.2 0.1 39.6% 0.0% 0.0% 0.0% 144.77sec 12426 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_mastery 124469 6233 14 0.02 23953 66341 0.2 0.2 40.2% 0.1% 0.0% 0.0% 8.79sec 6233 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 11519659 25565 7.33 141525 309223 55.1 55.1 40.4% 0.1% 0.0% 0.0% 7.94sec 11519659 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 5169070 11471 31.61 21776 0 237.4 237.4 0.0% 0.0% 0.0% 0.0% 1.95sec 5169070 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.65sec 0 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 4469202 9918 2.10 192710 416860 15.8 15.8 40.5% 0.1% 0.0% 0.0% 4.65sec 4469202 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 17880892 39735 63.91 25360 55059 134.4 479.3 40.2% 0.0% 0.0% 0.0% 3.34sec 17880892 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 8930434 19819 27.85 25760 67877 209.3 209.1 40.3% 0.1% 0.0% 0.0% 2.13sec 8930434 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 12518898 27782 36.52 30861 67330 277.0 274.3 40.5% 0.0% 0.0% 0.0% 1.61sec 12518898 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 610120 1354 0.42 115391 290700 3.2 3.2 44.0% 0.1% 0.0% 0.0% 86.63sec 610120 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 10362966 23029 27.66 33698 73800 38.2 207.4 40.5% 0.0% 0.0% 0.0% 11.73sec 10362966 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 5066972 11245 12.07 33506 89010 90.7 90.6 40.4% 0.1% 0.0% 0.0% 4.88sec 5066972 450.61sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 4120178 115851 60.02 76861 180317 35.6 35.6 41.8% 0.1% 24.0% 0.0% 11.06sec 4120178 35.56sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.11sec 0 35.56sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 13973 393 2.35 5900 14534 1.4 1.4 47.8% 0.1% 0.0% 0.0% 1.71sec 13973 35.56sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 5022884 11147 2.27 202426 433588 17.0 17.0 40.0% 0.1% 0.0% 0.0% 26.01sec 5022884 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 3868890 8586 9.31 33870 87549 70.0 69.9 40.1% 0.1% 0.0% 0.0% 6.08sec 3868890 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 7859462 17465 21.38 33707 72026 17.0 160.4 39.9% 0.0% 0.0% 0.0% 26.01sec 7859462 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 11438293 25418 23.32 26629 58087 0.0 174.9 40.3% 0.1% 0.0% 0.0% 0.00sec 11438293 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 1.39 0 0 10.4 10.4 40.5% 0.1% 0.0% 0.0% 44.91sec 0 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 7440737 16513 3.71 182007 393958 10.4 27.8 40.3% 0.0% 0.0% 0.0% 44.91sec 7440737 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 0 0 15.49 0 0 10.4 116.4 43.8% 0.0% 0.0% 0.0% 44.91sec 42550160 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 11200736 24857 6.00 170068 367251 45.1 45.1 39.9% 0.1% 0.0% 0.0% 10.08sec 11200736 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 6626774 14726 14.00 42669 93206 65.4 105.0 40.5% 0.0% 0.0% 0.0% 6.66sec 6626774 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 3268356 7253 6.10 42756 113208 45.9 45.8 40.6% 0.1% 0.0% 0.0% 9.11sec 3268356 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear ticks -48045 11638 26 0.01 24279 53161 0.3 0.1 39.8% 0.0% 0.0% 0.0% 138.65sec 11638 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_mastery 124469 5711 13 0.02 24250 64337 0.1 0.1 40.9% 0.1% 0.0% 0.0% 10.20sec 5711 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 11302426 25083 7.01 145851 317093 52.6 52.6 40.4% 0.1% 0.0% 0.0% 8.29sec 11302426 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 5225618 11597 30.68 22682 0 230.4 230.4 0.0% 0.0% 0.0% 0.0% 2.01sec 5225618 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 5066530 11244 2.10 219468 473120 15.7 15.7 40.5% 0.1% 0.0% 0.0% 4.67sec 5066530 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 17872746 39717 62.11 26138 56616 134.1 465.8 40.1% 0.0% 0.0% 0.0% 3.33sec 17872746 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 8934577 19828 27.08 26571 69812 203.6 203.4 40.2% 0.1% 0.0% 0.0% 2.19sec 8934577 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 12475220 27685 35.42 31786 69139 268.6 266.0 40.4% 0.0% 0.0% 0.0% 1.66sec 12475220 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 566063 1256 0.40 113511 281555 3.0 3.0 43.5% 0.1% 0.0% 0.0% 92.77sec 566063 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 10060863 22357 26.43 34391 74854 38.3 198.2 40.4% 0.0% 0.0% 0.0% 11.71sec 10060863 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 4941939 10967 11.53 34390 90750 86.7 86.6 40.3% 0.1% 0.0% 0.0% 5.10sec 4941939 450.61sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 4103273 115373 60.01 76624 179709 35.6 35.6 41.7% 0.1% 23.9% 0.0% 11.06sec 4103273 35.57sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.11sec 0 35.57sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 13768 387 2.34 5885 14450 1.4 1.4 47.2% 0.1% 0.0% 0.0% 1.72sec 13768 35.57sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 5748159 12756 2.72 192080 416115 20.4 20.4 40.1% 0.1% 0.0% 0.0% 21.77sec 5748159 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 4485103 9953 11.23 32233 84243 84.5 84.4 40.3% 0.1% 0.0% 0.0% 5.08sec 4485103 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 9137770 20306 25.79 32227 69557 20.4 193.4 40.2% 0.0% 0.0% 0.0% 21.77sec 9137770 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 10737089 23860 22.35 25406 55241 0.0 167.6 40.3% 0.1% 0.0% 0.0% 0.00sec 10737089 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.42 0 0 10.6 10.6 40.4% 0.1% 0.0% 0.0% 43.94sec 0 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 5869753 13026 3.02 176566 381785 10.6 22.7 40.3% 0.0% 0.0% 0.0% 43.94sec 5869753 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 0 0 15.64 0 0 10.6 117.4 43.8% 0.0% 0.0% 0.0% 43.94sec 41122734 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 14618282 32441 7.43 179005 386819 55.8 55.8 39.9% 0.1% 0.0% 0.0% 8.11sec 14618282 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 8433364 18741 18.46 41192 89954 83.4 138.5 40.4% 0.0% 0.0% 0.0% 5.26sec 8433364 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 4145463 9200 8.05 41200 109036 60.5 60.5 40.4% 0.1% 0.0% 0.0% 7.07sec 4145463 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear ticks -48045 44507 99 0.04 23860 52195 0.5 0.3 40.0% 0.0% 0.0% 0.0% 124.09sec 44507 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_mastery 124469 21967 49 0.07 23837 63454 0.6 0.6 40.1% 0.1% 0.0% 0.0% 31.32sec 21967 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.06 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.66sec 0 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 4810066 10675 31.41 20394 0 235.9 235.9 0.0% 0.0% 0.0% 0.0% 1.96sec 4810066 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 4477224 9936 2.08 196027 422359 15.6 15.6 40.3% 0.1% 0.0% 0.0% 4.71sec 4477224 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 17287227 38416 62.84 24985 54125 142.2 471.3 40.1% 0.0% 0.0% 0.0% 3.15sec 17287227 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 8628773 19149 27.40 25379 66689 205.9 205.8 40.1% 0.1% 0.0% 0.0% 2.16sec 8628773 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 12058350 26760 35.83 30387 66093 271.7 269.1 40.4% 0.0% 0.0% 0.0% 1.64sec 12058350 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 546869 1214 0.40 110843 277437 3.0 3.0 43.3% 0.1% 0.0% 0.0% 90.63sec 546869 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 10097066 22438 27.58 33075 71972 37.5 206.9 40.4% 0.0% 0.0% 0.0% 11.97sec 10097066 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 4906909 10890 12.00 32844 86549 90.2 90.1 40.3% 0.1% 0.0% 0.0% 4.89sec 4906909 450.61sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 10517566 89802 58.01 64802 142910 113.2 113.2 40.7% 0.1% 24.0% 0.0% 3.88sec 10517566 117.12sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.18sec 0 117.12sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 32735 279 2.14 4935 11664 4.2 4.2 43.0% 0.1% 0.0% 0.0% 77.04sec 32735 117.12sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 4736289 10511 2.27 191117 408589 17.0 17.0 39.9% 0.1% 0.0% 0.0% 26.01sec 4736289 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3686028 8180 9.39 32001 82725 70.6 70.5 40.0% 0.1% 0.0% 0.0% 6.02sec 3686028 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 7503816 16675 21.55 31901 68209 17.0 161.7 40.0% 0.0% 0.0% 0.0% 26.01sec 7503816 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 11468997 25487 23.39 25704 56003 0.0 175.5 40.3% 0.1% 0.0% 0.0% 0.00sec 11468997 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.40 0 0 10.5 10.5 40.3% 0.1% 0.0% 0.0% 44.51sec 0 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 7678167 17040 3.93 177091 384094 10.5 29.5 40.2% 0.0% 0.0% 0.0% 44.51sec 7678167 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 0 0 15.69 0 0 10.5 117.8 43.7% 0.0% 0.0% 0.0% 44.51sec 41177942 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 11973089 26571 6.00 182082 392464 45.1 45.1 39.9% 0.1% 0.0% 0.0% 10.08sec 11973089 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 8585157 19078 18.34 42059 92254 82.4 137.5 40.6% 0.0% 0.0% 0.0% 5.33sec 8585157 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 4249552 9431 8.00 42251 112486 60.1 60.0 40.7% 0.1% 0.0% 0.0% 7.11sec 4249552 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear ticks -48045 48477 108 0.05 23979 53230 0.9 0.3 40.2% 0.0% 0.0% 0.0% 143.75sec 48477 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_mastery 124469 23895 53 0.08 23929 64976 0.6 0.6 39.7% 0.1% 0.0% 0.0% 39.73sec 23895 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.06 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.64sec 0 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 4778948 10606 31.71 20069 0 238.1 238.1 0.0% 0.0% 0.0% 0.0% 1.95sec 4778948 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.26sec 0 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 4528175 10049 2.09 196091 423310 15.7 15.7 40.5% 0.1% 0.0% 0.0% 4.67sec 4528175 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 18913447 42030 67.57 25368 55085 161.2 506.8 40.2% 0.0% 0.0% 0.0% 2.78sec 18913447 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 9447408 20966 29.46 25765 67895 221.4 221.2 40.3% 0.1% 0.0% 0.0% 2.02sec 9447408 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 13245341 29394 38.61 30881 67357 292.9 290.0 40.6% 0.0% 0.0% 0.0% 1.52sec 13245341 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 576213 1279 0.40 115257 289953 3.0 3.0 44.1% 0.1% 0.0% 0.0% 93.03sec 576213 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 10405828 23124 27.78 33694 73744 38.4 208.4 40.6% 0.0% 0.0% 0.0% 11.67sec 10405828 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 5068801 11249 12.11 33445 88695 91.0 91.0 40.4% 0.1% 0.0% 0.0% 4.86sec 5068801 450.61sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 10502826 89659 58.01 64750 142583 113.2 113.2 40.7% 0.1% 24.0% 0.0% 3.88sec 10502826 117.14sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.18sec 0 117.14sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 32468 277 2.13 4920 11615 4.2 4.2 42.9% 0.1% 0.0% 0.0% 76.85sec 32468 117.14sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 5012985 11125 2.27 202229 432669 17.0 17.0 40.0% 0.1% 0.0% 0.0% 26.03sec 5012985 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3867193 8582 9.30 33883 87627 70.0 69.9 40.0% 0.1% 0.0% 0.0% 6.06sec 3867193 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 7847212 17438 21.37 33661 71911 17.0 160.3 40.0% 0.0% 0.0% 0.0% 26.03sec 7847212 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 11526553 25615 22.72 26563 57761 0.0 170.4 40.3% 0.1% 0.0% 0.0% 0.00sec 11526553 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 1.39 0 0 10.5 10.5 40.4% 0.1% 0.0% 0.0% 44.83sec 0 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 8231342 18267 4.10 181922 393980 10.5 30.8 40.2% 0.0% 0.0% 0.0% 44.83sec 8231342 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 0 0 15.73 0 0 10.5 118.1 43.7% 0.0% 0.0% 0.0% 44.83sec 42992361 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 12416865 27556 6.00 189036 407003 45.0 45.0 39.8% 0.1% 0.0% 0.0% 10.08sec 12416865 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 8208564 18241 17.38 42603 92905 81.6 130.4 40.5% 0.0% 0.0% 0.0% 5.37sec 8208564 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 4054693 8998 7.58 42788 113145 56.9 56.9 40.5% 0.1% 0.0% 0.0% 7.45sec 4054693 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear ticks -48045 39645 88 0.04 24574 53688 1.0 0.3 40.3% 0.0% 0.0% 0.0% 150.69sec 39645 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_mastery 124469 19452 43 0.06 24530 65144 0.5 0.5 40.8% 0.1% 0.0% 0.0% 34.61sec 19452 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.06 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.65sec 0 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 4863142 10792 30.80 21025 0 231.3 231.3 0.0% 0.0% 0.0% 0.0% 2.01sec 4863142 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 5139713 11406 2.09 223444 481355 15.7 15.7 40.4% 0.1% 0.0% 0.0% 4.68sec 5139713 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 18877725 41950 65.55 26155 56654 159.2 491.6 40.2% 0.0% 0.0% 0.0% 2.81sec 18877725 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 9439331 20948 28.58 26594 69879 214.8 214.6 40.2% 0.1% 0.0% 0.0% 2.07sec 9439331 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 13187491 29266 37.40 31828 69197 283.7 280.9 40.5% 0.0% 0.0% 0.0% 1.57sec 13187491 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 539782 1198 0.39 113329 281191 2.9 2.9 43.7% 0.1% 0.0% 0.0% 93.68sec 539782 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 10112797 22473 26.60 34367 74753 38.5 199.5 40.4% 0.0% 0.0% 0.0% 11.62sec 10112797 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 4954767 10996 11.60 34347 90468 87.2 87.1 40.2% 0.1% 0.0% 0.0% 5.07sec 4954767 450.61sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 10431704 89058 58.01 64418 141750 113.2 113.2 40.6% 0.1% 24.0% 0.0% 3.88sec 10431704 117.13sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.19sec 0 117.13sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 32462 277 2.14 4913 11584 4.2 4.2 42.8% 0.1% 0.0% 0.0% 77.10sec 32462 117.13sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 5689099 12625 2.69 192087 416324 20.2 20.2 40.0% 0.1% 0.0% 0.0% 21.99sec 5689099 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 4434809 9842 11.12 32217 84184 83.6 83.5 40.2% 0.1% 0.0% 0.0% 5.12sec 4434809 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 9031316 20070 25.54 32163 69396 20.2 191.6 40.2% 0.0% 0.0% 0.0% 21.99sec 9031316 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 10709580 23799 22.30 25405 55245 0.0 167.2 40.3% 0.1% 0.0% 0.0% 0.00sec 10709580 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 1.38 0 0 10.4 10.4 40.5% 0.1% 0.0% 0.0% 45.07sec 0 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 5860442 13006 3.01 176432 381782 10.4 22.6 40.3% 0.0% 0.0% 0.0% 45.07sec 5860442 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 0 0 15.37 0 0 10.4 115.5 43.8% 0.0% 0.0% 0.0% 45.07sec 40435724 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 14453452 32075 7.36 178915 386338 55.3 55.3 39.9% 0.1% 0.0% 0.0% 8.19sec 14453452 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 5590817 12424 12.08 41437 91397 53.2 90.6 40.5% 0.0% 0.0% 0.0% 8.03sec 5590817 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 2756487 6117 5.27 41513 111131 39.6 39.5 40.6% 0.1% 0.0% 0.0% 10.46sec 2756487 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 7862903 17473 8.76 81849 175818 38.5 65.7 40.2% 0.0% 0.0% 0.0% 11.18sec 7862903 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 3503922 7776 3.82 74314 193251 28.8 28.7 40.2% 0.1% 0.0% 0.0% 14.66sec 3503922 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear ticks -48045 28597 64 0.03 23973 52338 0.4 0.2 39.9% 0.0% 0.0% 0.0% 124.72sec 28597 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_mastery 124469 13953 31 0.05 23922 63443 0.4 0.4 39.7% 0.1% 0.0% 0.0% 21.03sec 13953 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 4982852 11058 30.99 21408 0 232.8 232.8 0.0% 0.0% 0.0% 0.0% 1.99sec 4982852 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 4422203 9814 2.06 195289 421615 15.4 15.4 40.4% 0.1% 0.0% 0.0% 4.74sec 4422203 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 16966336 37703 61.70 24978 54121 141.3 462.7 40.1% 0.0% 0.0% 0.0% 3.17sec 16966336 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 8466702 18790 26.89 25365 66669 202.1 202.0 40.1% 0.1% 0.0% 0.0% 2.20sec 8466702 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 11836943 26269 35.17 30375 66070 266.6 264.2 40.4% 0.0% 0.0% 0.0% 1.68sec 11836943 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.66sec 0 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 555020 1232 0.41 110096 275314 3.0 3.0 43.7% 0.1% 0.0% 0.0% 91.00sec 555020 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 8924013 19831 24.43 32992 71927 33.1 183.2 40.4% 0.0% 0.0% 0.0% 13.51sec 8924013 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 4364129 9685 10.65 32886 86930 80.0 80.0 40.2% 0.1% 0.0% 0.0% 5.49sec 4364129 450.61sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 4093638 115112 60.02 76472 179074 35.6 35.6 41.8% 0.1% 23.9% 0.0% 11.06sec 4093638 35.56sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.10sec 0 35.56sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 13594 382 2.34 5833 14371 1.4 1.4 46.5% 0.1% 0.0% 0.0% 1.76sec 13594 35.56sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 4728095 10493 2.27 190966 408440 17.0 17.0 39.9% 0.1% 0.0% 0.0% 26.04sec 4728095 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 3683026 8173 9.38 31999 82740 70.6 70.5 40.0% 0.1% 0.0% 0.0% 6.01sec 3683026 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 7480786 16624 21.52 31877 68099 17.0 161.4 40.0% 0.0% 0.0% 0.0% 26.04sec 7480786 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 11599273 25776 23.41 25688 55971 0.0 175.6 40.3% 0.1% 0.0% 0.0% 0.00sec 11599273 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 1.37 0 0 10.3 10.3 40.7% 0.1% 0.0% 0.0% 45.52sec 0 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 8051680 17869 4.11 176770 384969 10.3 30.9 40.3% 0.0% 0.0% 0.0% 45.52sec 8051680 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 0 0 15.83 0 0 10.3 118.9 43.7% 0.0% 0.0% 0.0% 45.52sec 41533969 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 11977978 26582 6.00 182110 392224 45.1 45.1 39.9% 0.1% 0.0% 0.0% 10.08sec 11977978 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 6110527 13579 12.72 42772 94857 52.8 95.4 40.9% 0.0% 0.0% 0.0% 8.13sec 6110527 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 3036702 6739 5.55 43069 116059 41.7 41.7 40.9% 0.1% 0.0% 0.0% 10.05sec 3036702 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 5861695 13026 6.63 81119 172845 33.9 49.7 40.1% 0.0% 0.0% 0.0% 12.58sec 5861695 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 2815359 6248 2.89 79592 204875 21.8 21.7 40.0% 0.1% 0.0% 0.0% 19.21sec 2815359 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear ticks -48045 17844 40 0.02 24407 52326 0.5 0.1 40.5% 0.0% 0.0% 0.0% 170.06sec 17844 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_mastery 124469 8788 20 0.03 24371 63503 0.2 0.2 40.3% 0.1% 0.0% 0.0% 5.90sec 8788 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 4968310 11026 31.79 20811 0 238.7 238.7 0.0% 0.0% 0.0% 0.0% 1.95sec 4968310 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.66sec 0 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 4488922 9962 2.08 196087 422942 15.6 15.6 40.3% 0.1% 0.0% 0.0% 4.69sec 4488922 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 18822481 41828 67.33 25345 55015 162.6 504.9 40.2% 0.0% 0.0% 0.0% 2.75sec 18822481 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 9408667 20880 29.36 25756 67858 220.7 220.5 40.2% 0.1% 0.0% 0.0% 2.02sec 9408667 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 13186917 29265 38.48 30862 67290 291.7 289.0 40.6% 0.0% 0.0% 0.0% 1.53sec 13186917 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.66sec 0 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 575105 1276 0.40 115318 290118 3.0 3.0 44.1% 0.1% 0.0% 0.0% 90.95sec 575105 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 10112459 22472 26.99 33691 73808 37.7 202.5 40.5% 0.0% 0.0% 0.0% 11.88sec 10112459 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 4928355 10937 11.78 33457 88772 88.5 88.5 40.3% 0.1% 0.0% 0.0% 4.99sec 4928355 450.61sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 4089940 115031 60.02 76435 179152 35.6 35.6 41.7% 0.1% 24.0% 0.0% 11.07sec 4089940 35.56sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.14sec 0 35.56sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 13775 387 2.36 5829 14385 1.4 1.4 47.0% 0.1% 0.0% 0.0% 1.75sec 13775 35.56sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 4999754 11096 2.26 202282 432467 17.0 17.0 39.9% 0.1% 0.0% 0.0% 26.08sec 4999754 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3858673 8563 9.29 33883 87528 69.9 69.8 40.0% 0.1% 0.0% 0.0% 6.07sec 3858673 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 7826246 17392 21.33 33650 71885 17.0 160.0 40.0% 0.0% 0.0% 0.0% 26.08sec 7826246 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 11627283 25838 22.77 26574 57816 0.0 170.8 40.3% 0.1% 0.0% 0.0% 0.00sec 11627283 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 1.37 0 0 10.3 10.3 40.4% 0.1% 0.0% 0.0% 45.54sec 0 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 8256032 18322 4.10 182105 395311 10.3 30.8 40.2% 0.0% 0.0% 0.0% 45.54sec 8256032 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 0 0 15.78 0 0 10.3 118.5 43.7% 0.0% 0.0% 0.0% 45.54sec 43153843 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 12435472 27597 6.00 189044 407024 45.1 45.1 40.0% 0.1% 0.0% 0.0% 10.08sec 12435472 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 5647346 12550 11.78 42886 94636 51.8 88.3 40.7% 0.0% 0.0% 0.0% 8.25sec 5647346 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 2802519 6219 5.14 43161 115643 38.6 38.6 40.7% 0.1% 0.0% 0.0% 10.84sec 2802519 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 6110614 13579 6.58 85115 181609 33.8 49.4 40.0% 0.0% 0.0% 0.0% 12.61sec 6110614 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 2930400 6503 2.87 83381 214907 21.6 21.6 40.0% 0.1% 0.0% 0.0% 19.38sec 2930400 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear ticks -48045 10687 24 0.01 24356 52112 0.6 0.1 40.9% 0.0% 0.0% 0.0% 177.56sec 10687 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_mastery 124469 5088 11 0.02 24338 63170 0.1 0.1 39.0% 0.1% 0.0% 0.0% 4.13sec 5088 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 5046065 11198 30.86 21772 0 231.8 231.8 0.0% 0.0% 0.0% 0.0% 2.01sec 5046065 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 5099662 11317 2.07 223390 480839 15.6 15.6 40.5% 0.1% 0.0% 0.0% 4.71sec 5099662 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 18809260 41798 65.37 26129 56603 160.8 490.3 40.1% 0.0% 0.0% 0.0% 2.79sec 18809260 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 9395494 20851 28.50 26571 69771 214.2 214.0 40.2% 0.1% 0.0% 0.0% 2.08sec 9395494 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 13134965 29149 37.30 31790 69117 282.8 280.1 40.4% 0.0% 0.0% 0.0% 1.58sec 13134965 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 534418 1186 0.38 113334 281611 2.9 2.9 43.6% 0.1% 0.0% 0.0% 91.43sec 534418 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 9779222 21732 25.76 34302 74657 37.7 193.2 40.4% 0.0% 0.0% 0.0% 11.80sec 9779222 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 4796281 10644 11.23 34282 90398 84.4 84.4 40.3% 0.1% 0.0% 0.0% 5.20sec 4796281 450.61sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 4077033 114657 60.02 76289 178546 35.6 35.6 41.7% 0.1% 24.0% 0.0% 11.06sec 4077033 35.56sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.13sec 0 35.56sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 13829 389 2.38 5823 14330 1.4 1.4 47.1% 0.1% 0.0% 0.0% 1.73sec 13829 35.56sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.84% 7.84%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.41% 8.41%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.60% 10.60%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.93% 10.93%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.33% 11.33%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.56% 10.56%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.87% 11.87%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.73% 10.73%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.44% 6.44%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2431924.68
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 25332
death count pct 101.33
avg death time 450.62
min death time 346.37
max death time 555.04
dmg taken 1096282172.71

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 450.61
Minimum 346.37
Maximum 555.04
Spread ( max - min ) 208.67
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 2435522.59
Minimum 2326708.24
Maximum 2571066.12
Spread ( max - min ) 244357.87
Range [ ( max - min ) / 2 * 100% ] 5.02%
Standard Deviation 34219.8782
5th Percentile 2381701.49
95th Percentile 2493849.57
( 95th Percentile - 5th Percentile ) 112148.07
Mean Distribution
Standard Deviation 216.4601
95.00% Confidence Intervall ( 2435098.33 - 2435946.84 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 758
0.1 Scale Factor Error with Delta=300 9996330
0.05 Scale Factor Error with Delta=300 39985320
0.01 Scale Factor Error with Delta=300 999633006
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 876418846 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
492415.6 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100 http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.2s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 492415.59
Combat End Resource Mean Min Max
Health 1092413318.01 871665840.48 1312922391.88

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 94.18
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.55%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 492973.71
Minimum 384741.62
Maximum 619977.10
Spread ( max - min ) 235235.48
Range [ ( max - min ) / 2 * 100% ] 23.86%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add2 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
459031.6 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add2 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100 http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add2 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.2s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 459031.64
Combat End Resource Mean Min Max
Health 1092469718.75 871855500.03 1313151990.76

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 24992
Mean 94.18
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.55%
DPS
Sample Data Add2 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add2 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 24992
Mean 459358.13
Minimum 360180.53
Maximum 573258.63
Spread ( max - min ) 213078.09
Range [ ( max - min ) / 2 * 100% ] 23.19%
HPS
Sample Data Add2 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add2 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add3 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
462243.4 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add3 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100 http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add3 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.2s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 462243.41
Combat End Resource Mean Min Max
Health 1092446408.26 872185106.67 1312832250.22

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 24992
Mean 94.18
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.55%
DPS
Sample Data Add3 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add3 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 24992
Mean 462779.53
Minimum 357377.35
Maximum 576117.78
Spread ( max - min ) 218740.43
Range [ ( max - min ) / 2 * 100% ] 23.63%
HPS
Sample Data Add3 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add3 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.