close

SimulationCraft 540-5

for World of Warcraft 5.4.0 Live (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3
4 adds,count=3,first=45,cooldown=45,duration=10

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 6.89 - 5.15 - - - 6.19 - 4.49 5.44 4.25 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 6.82 - 5.14 - - - 6.24 - 4.57 3.93 4.09 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 6.75 - 5.11 - - - 6.19 - 4.39 3.69 4.02 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 7.10 - 5.40 - - - 6.43 - 4.73 5.19 4.53 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 6.93 - 5.23 - - - 6.45 - 4.67 3.31 4.39 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 6.99 - 5.29 - - - 6.48 - 4.61 2.81 4.35 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 7.06 - 5.22 - - - 6.85 - 4.46 6.25 4.68 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 6.95 - 5.35 - - - 6.99 - 4.56 3.64 4.78 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 7.22 - 5.50 - - - 7.56 - 4.68 5.95 4.69 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 276712 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
276711.9 276711.9 116.69 / 0.04% 15386 / 5.6% 49.6 5405.8 5043.3 Mana 0.82% 52.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.89 5.15 6.19 4.49 5.44 4.25
Normalized 1.00 0.75 0.90 0.65 0.79 0.62
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.17 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > Hit > Haste > SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=6.89, SpellDamage=5.15, HitRating=6.19, CritRating=4.49, HasteRating=5.44, MasteryRating=4.25 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=6.89, SpellDamage=5.15, HitRating=0.00, CritRating=4.49, HasteRating=5.44, MasteryRating=4.25 )

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:815829|377591|311307|245084|232022|205419|181667|110493|61946&chds=0,1631659&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++815829++devouring_plague,9482C9,0,0,15|t++377591++shadow_word_pain,9482C9,1,0,15|t++311307++vampiric_touch,9482C9,2,0,15|t++245084++shadow_word_death,9482C9,3,0,15|t++232022++halo,9482C9,4,0,15|t++205419++mind_blast,9482C9,5,0,15|t++181667++mind_spike,4A79D3,6,0,15|t++110493++mind_flay,9482C9,7,0,15|t++61946++mind_sear,9482C9,8,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,9,9,8,8,8,7,6,4,4,4,4,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|mind_blast|mind_spike|vampiric_touch|essence_of_yulon|mind_flay|shadowy_apparition|devouring_plague_tick|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|multistrike_spell|mind_flay_mastery|shadow_word_death|devouring_plague_mastery|shadowfiend: melee|halo_damage|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.89,6.19,5.44,5.15,4.49,4.25|6.73,6.02,5.27,4.99,4.33,4.08|7.05,6.36,5.60,5.32,4.66,4.41&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.89++Int,FFFFFF,0,0,15,0.1,e|t++++6.19++Hit,FFFFFF,0,1,15,0.1,e|t++++5.44++Haste,FFFFFF,0,2,15,0.1,e|t++++5.15++SP,FFFFFF,0,3,15,0.1,e|t++++4.49++Crit,FFFFFF,0,4,15,0.1,e|t++++4.25++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.277& http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:afiloqtvy02465686630yvtsqpoonmmmmmlkkjiiiijjklmmmmlkjihgggfffeddcbaZZYZZZZabbbbbbbabbccddeffgggggggggggffeeeddbZYXWVWWWWXXYYYYYZZZbdfhjlmnooooonnnnnnmmlkjiggfedddddddddddcbaaabcdefghijkkkkkkllmlllkjihgfecbbbaaaabbbbbaaaaabcdeffgghfedccbbbbbbbbbaZZYYYZabcdefggggfffghiijkllmmmmmlllllllkjiihhfedcbbbbbbbbcccbbbbbcdefghiiiiiiihhhhihihhggfeedddcccccdddddcaZYYYaacdefgikkklllnoprrsrqppoomljjjjiijjjjjjjjjijjklmnnnoonmmmmmmmmmllkjihhhgfghhgghgggghgghhiijjkkllmmmnnnnnnnnmmmllkigfeeccccccccdddddeegiklnppqrstttttttttttssrqqqpoonnmmmnmmmmlkkjjjklmmmmmoomkigedcaZX&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5591,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=276712|max=494933&chxp=1,1,56,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,6,10,18,36,55,93,153,233,289,447,595,721,965,1116,1307,1440,1553,1561,1668,1626,1493,1504,1412,1127,1133,954,770,645,490,446,314,227,171,124,89,66,42,31,24,14,5,4,4,4,1,1,0,1&chds=0,1668&chbh=5&chxt=x&chxl=0:|min=243581|avg=276712|max=321076&chxp=0,1,43,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:28.2,17.3,13.2,13.0,10.9,4.6,3.8,2.6,0.7,0.0,0.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 127.3s|shadow_word_pain 78.1s|mind_blast 59.6s|mind_spike 58.5s|vampiric_touch 49.3s|devouring_plague 20.9s|shadow_word_death 17.3s|halo 11.8s|shadowfiend 3.3s|mind_sear 0.1s|waiting 3.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 276712
devouring_plague 11507 (37831) 4.2% (13.7%) 19.4 22.74sec 879928 815829 182857 395329 267614 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.40 19.40 0.00 0.00 1.0786 0.0000 5190569.40 5190569.40 0.00 815829.41 815829.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.61 59.87% 182857.43 161639 293162 182869.78 161639 231328 2123446 2123446 0.00
crit 7.76 40.00% 395329.32 336788 732992 395588.29 0 705448 3067123 3067123 0.00
miss 0.03 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8653 3.1% 77.5 5.48sec 50354 0 30648 79894 50421 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.54 77.44 0.00 0.00 0.0000 0.0000 3904394.40 3904394.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.18 59.64% 30648.41 26940 48861 30655.82 27511 36738 1415428 1415428 0.00
crit 31.15 40.23% 79894.07 67809 151489 79877.85 68662 104379 2488966 2488966 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17671 6.4% 19.4 22.74sec 411020 0 0 0 0 0.0% 0.0% 0.0% 0.0% 177.4 30678 66101 44939 40.3% 0.0% 25.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.40 19.40 177.41 177.41 0.0000 0.6492 7972187.40 7972187.40 0.00 69216.83 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.0 59.74% 30678.00 26940 104296 30686.26 27221 74142 3251263 3251263 0.00
crit 71.4 40.26% 66100.87 56133 233767 66073.30 57503 151338 4720924 4720924 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 21259 7.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 171.0 24224 52933 35781 40.3% 0.1% 30.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.81 171.00 267.88 0.0000 0.7906 9584728.44 9584728.44 0.00 70899.78 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.6 59.59% 24223.79 21101 38949 24233.76 22037 28349 3866993 3866993 0.00
crit 108.0 40.32% 52933.24 43965 97385 52934.11 46233 62893 5717735 5717735 0.00
miss 0.2 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6099) 0.0% (2.2%) 11.0 42.47sec 249318 232022 0 0 0 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.02 0.00 0.00 1.0746 0.0000 0.00 0.00 0.00 232021.57 232021.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.62 60.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.39 39.84% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6099 2.2% 11.0 42.47sec 249318 0 169890 365378 247627 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.10 0.00 0.00 0.0000 0.0000 2748527.46 2748527.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.66 59.99% 169890.06 153853 262625 169855.47 0 249727 1131341 1131341 0.00
crit 4.43 39.88% 365378.38 320566 656640 363411.12 0 624392 1617187 1617187 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27143 9.8% 53.1 8.45sec 230543 205419 157387 341036 230542 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.09 53.09 0.00 0.00 1.1223 0.0000 12239069.60 12239069.60 0.00 205419.00 205419.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.81 59.93% 157387.48 129332 377298 157339.71 132791 186882 5007001 5007001 0.00
crit 21.21 39.95% 341035.55 269474 943358 340987.50 276802 453367 7232068 7232068 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 20948 (31222) 7.6% (11.3%) 86.8 5.07sec 162027 110493 0 0 0 0.0% 0.1% 0.0% 0.0% 160.1 39606 87152 58950 40.7% 0.0% 22.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.80 86.80 160.07 160.07 1.4664 0.6299 9436050.86 9436050.86 0.00 110492.93 110492.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.69 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.9 59.31% 39606.19 34279 62168 39628.16 35718 44319 3760316 3760316 0.00
crit 65.1 40.69% 87152.41 71424 155439 87196.83 76617 102707 5675735 5675735 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 10274 3.7% 69.9 6.24sec 66176 0 39507 105389 66210 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.93 69.89 0.00 0.00 0.0000 0.0000 4627710.02 4627710.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.42 59.26% 39506.63 34279 62168 39528.24 35404 46887 1636289 1636289 0.00
crit 28.38 40.61% 105388.86 86282 192747 105436.25 89058 141884 2991421 2991421 0.00
miss 0.09 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 9 0.0% 0.0 143.78sec 95548 61946 0 0 0 0.0% 0.2% 0.0% 0.0% 0.1 22115 46863 31651 38.7% 0.1% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.04 0.04 0.09 0.14 1.5520 0.6506 4274.30 4274.30 0.00 61946.32 61946.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.04 99.82% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.18% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.1 61.19% 22114.51 20175 34924 865.60 0 34924 1827 1827 0.00
crit 0.1 38.67% 46863.41 42035 72766 1474.62 0 72766 2447 2447 0.00
miss 0.0 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 5 0.0% 0.1 10.58sec 36472 0 22161 56691 36472 41.6% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.06 0.06 0.00 0.00 0.0000 0.0000 2190.46 2190.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.03 58.23% 22161.17 20175 34924 517.02 0 34924 775 775 0.00
crit 0.02 41.57% 56690.87 50780 87903 1072.37 0 87903 1415 1415 0.00
miss 0.00 0.20% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (5) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 23572 8.5% 54.3 8.00sec 195457 181667 133094 288295 195457 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.34 54.34 0.00 0.00 1.0759 0.0000 10621729.44 10621729.44 0.00 181667.40 181667.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.38 59.58% 133093.66 105187 307948 133202.43 112917 163515 4309087 4309087 0.00
crit 21.90 40.29% 288294.89 219166 769962 288464.59 220535 377159 6312643 6312643 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 10620 3.8% 228.0 2.02sec 20996 0 20997 0 20997 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 228.04 228.04 0.00 0.00 0.0000 0.0000 4788062.55 4788062.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 228.04 100.00% 20996.71 7034 354274 21011.49 15675 28075 4788063 4788063 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:30202.52
  • base_dd_max:30202.52
shadow_word_death 9390 3.4% 16.0 4.68sec 265123 245084 180840 390255 265125 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.96 15.96 0.00 0.00 1.0818 0.0000 4230152.49 4230152.49 0.00 245084.15 245084.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.50 59.52% 180839.81 145361 425078 181190.93 145361 267174 1717420 1717420 0.00
crit 6.44 40.36% 390254.94 302873 1062821 391137.32 0 838941 2512732 2512732 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 29955 (65356) 10.8% (23.6%) 72.4 6.20sec 407020 377591 0 0 0 0.0% 0.1% 0.0% 0.0% 383.3 24050 52017 35255 40.1% 0.0% 134.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.44 72.44 383.34 383.34 1.0779 1.5786 13514525.62 13514525.62 0.00 43155.78 377591.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.39 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 229.8 59.93% 24049.67 21342 38694 24055.05 22274 26860 5525428 5525428 0.00
crit 153.6 40.07% 52017.12 44467 96746 52018.07 47437 57992 7989097 7989097 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 14793 5.4% 167.5 2.67sec 39850 0 24142 63427 39882 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 167.46 167.33 0.00 0.00 0.0000 0.0000 6673358.34 6673358.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.94 59.73% 24142.18 21342 38694 24146.61 22377 26687 2412750 2412750 0.00
crit 67.17 40.15% 63426.90 53717 119967 63436.50 56817 72690 4260608 4260608 0.00
miss 0.21 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0977 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 20609 7.5% 220.8 2.03sec 42119 0 28862 62710 42521 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.75 218.67 0.00 0.00 0.0000 0.0000 9297829.33 9297829.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.43 59.65% 28861.98 25217 46134 28863.60 26638 32453 3764504 3764504 0.00
crit 88.24 40.35% 62710.27 52542 115348 62708.25 56865 70800 5533326 5533326 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1796 0.6% 4.6 69.04sec 174483 0 105304 263042 174486 43.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.57 4.57 0.00 0.00 0.0000 0.0000 797726.52 797726.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.56 55.91% 105304.05 79124 146057 98294.56 0 146057 269199 269199 0.00
crit 2.01 43.95% 263042.12 164861 365186 229271.53 0 365186 528528 528528 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:110260.80
  • base_dd_max:110260.80
vampiric_touch 22898 (34068) 8.3% (12.3%) 45.5 9.82sec 337590 311307 0 0 0 0.0% 0.1% 0.0% 0.0% 221.7 31578 68632 46555 40.4% 0.0% 93.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.49 45.49 221.72 221.72 1.0844 1.9100 10322309.17 10322309.17 0.00 32480.51 311307.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.45 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.1 59.58% 31578.38 27457 50605 31591.79 28929 35244 4171689 4171689 0.00
crit 89.6 40.42% 68632.30 57209 126527 68653.49 61325 79395 6150620 6150620 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11170 4.0% 96.9 4.56sec 51967 0 31422 82660 52009 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.90 96.82 0.00 0.00 0.0000 0.0000 5035419.74 5035419.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.72 59.62% 31422.14 27457 50605 31430.18 28841 34826 1813794 1813794 0.00
crit 38.97 40.26% 82659.51 69110 156896 82695.33 72279 98028 3221626 3221626 0.00
miss 0.12 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 104805 / 8342
melee 104430 3.0% 33.5 11.73sec 110534 118827 72631 173686 110534 41.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.51 33.51 0.00 0.00 0.9302 0.0000 3703950.62 3703950.62 0.00 118826.81 118826.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.50 34.31% 72631.26 54848 114390 72818.08 58962 106930 835057 835057 0.00
crit 13.93 41.57% 173686.11 124648 274537 173299.43 131993 241637 2419595 2419595 0.00
glance 8.04 23.98% 55901.58 41136 85793 55920.41 0 85793 449299 449299 0.00
dodge 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0819 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 376 0.0% 1.4 1.74sec 9413 0 5558 13728 9413 47.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.41 0.00 0.00 0.0000 0.0000 13233.66 13233.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.58% 5558.40 4169 6741 3001.25 0 6741 4109 4109 0.00
crit 0.66 47.28% 13727.52 10006 16178 6856.36 0 16178 9125 9125 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.99%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 25.0 2.5 17.2sec 15.6sec 8.28% 43.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.28%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.4 0.0 22.7sec 22.7sec 12.10% 15.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:12.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.2sec 124.2sec 17.64% 17.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.64%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.7 36.5sec 23.4sec 41.69% 41.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.69%

    Trigger Attempt Success

    • trigger_pct:99.44%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.8sec 9.8sec 15.11% 49.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.11%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 7.87%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 41.1 22.7 10.7sec 6.9sec 36.94% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:26.93%
  • surge_of_darkness_2:10.01%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.6sec 39.6sec 22.97% 53.09%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.97%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.6sec 55.4sec 17.52% 17.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.52%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.3sec 74.3sec 83.38% 73.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.88% 68.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 19.4 58.1 3.0 3.0 293560.7
halo Mana 11.0 446475.2 40500.0 40499.7 6.2
mind_blast Mana 53.1 240997.7 4539.6 4539.6 50.8
mind_flay Mana 86.8 260398.2 3000.0 3000.0 54.0
mind_sear Mana 0.0 402.5 9000.0 8997.1 10.6
shadow_word_death Mana 16.0 124458.4 7800.0 7800.4 34.0
shadow_word_pain Mana 72.4 956226.5 13200.0 13199.7 30.8
vampiric_touch Mana 45.5 409425.5 9000.0 8999.9 37.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.47 257068.33 (11.30%) 7681.62 44120.27 14.65%
Shadow Orbs from Mind Blast Shadow Orb 53.02 51.56 (86.52%) 0.97 1.46 2.75%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.04 8.04 (13.48%) 1.00 0.00 0.00%
Devouring Plague Health Health 254.84 0.00 (0.00%) 0.00 5419011.21 100.00%
Vampiric Touch Mana Mana 318.54 1505639.18 (66.19%) 4726.69 115149.10 7.10%
halo_heal Health 11.02 0.00 (0.00%) 0.00 3692534.59 100.00%
external_healing Health 86.30 0.00 (0.00%) 0.00 29524702.26 100.00%
mp5_regen Mana 1803.77 512151.77 (22.51%) 283.93 28978.86 5.36%
pet - shadowfiend
external_healing Health 14.64 0.00 (0.00%) 0.00 5067336.96 100.00%
Resource RPS-Gain RPS-Loss
Mana 5043.28 5405.81
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 136398.69 -97800.00 293700.00
Shadow Orb 1.46 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.5%
shadowfiend-Mana Cap 5.5%
mindbender-Mana Cap 5.5%

Procs

Count Interval
Shadowy Recall Extra Tick 411.5 1.1sec
Shadowy Apparition Procced 220.8 2.0sec
Divine Insight Mind Blast CD Reset 46.7 15.6sec
FDCL Mind Spike proc 63.7 6.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 276711.88
Minimum 243581.49
Maximum 321075.64
Spread ( max - min ) 77494.14
Range [ ( max - min ) / 2 * 100% ] 14.00%
Standard Deviation 9412.1544
5th Percentile 261937.28
95th Percentile 292709.25
( 95th Percentile - 5th Percentile ) 30771.98
Mean Distribution
Standard Deviation 59.5372
95.00% Confidence Intervall ( 276595.19 - 276828.57 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4444
0.1 Scale Factor Error with Delta=300 756243
0.05 Scale Factor Error with Delta=300 3024974
0.01 Scale Factor Error with Delta=300 75624367
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 276711.88
Minimum 243581.49
Maximum 321075.64
Spread ( max - min ) 77494.14
Range [ ( max - min ) / 2 * 100% ] 14.00%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 120990815.54
Minimum 88394753.30
Maximum 160201347.66
Spread ( max - min ) 71806594.37
Range [ ( max - min ) / 2 * 100% ] 29.67%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.92 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 4.13 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.04 mind_blast,if=active_enemies<=5&cooldown_react
I 8.04 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 38.00 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 35.40 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 11.35 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 13.70 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.26 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 11.66 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 11.02 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.26 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 20.13 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 42.68 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.04 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 86.80 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 23.09 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ALHSMZZZZHXZZZZNOHQZZZXZZcXccHMZZXZXWHXLLLMMHMLMQRSWHXXccOZWHZZZZZZHQOXNXHZHXZLLLccHMMGHSZZZZHZZNMRXZHQLXcMZHZZZZXLLHLMMMMNRHQSXcccccHMXZZXZXHZWWWWWHXORNXZHQZXALLHLMMMNRSWHXZZXOWHQXXWWWWWWWWWWHNXccccOHXZZXXZLHLLMMMMGHLRRRLSXHMZZXXZWHXZXNOXXHQXZZXLLLcHMMHMXWWHQSXZZOHNZZZZWcccHMZZZZWHLHLLMMGHLMRSXXccHcZZOZHQZZXZZHNOZXHZALLHLLMMGHSZHZIFQNOWHZXVIFXcHQccWWWWVHIFMRXZHLIFHLHLLMGHIF8RSXHGIFMNZZHVIFQXZOZHIFHN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 271489 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
271488.7 271488.7 114.26 / 0.04% 15224 / 5.6% 47.2 5571.2 5259.1 Mana 0.50% 51.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.82 5.14 6.24 4.57 3.93 4.09
Normalized 1.00 0.75 0.91 0.67 0.58 0.60
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.16 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit > Mastery ~= Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=6.82, SpellDamage=5.14, HitRating=6.24, CritRating=4.57, HasteRating=3.93, MasteryRating=4.09 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=6.82, SpellDamage=5.14, HitRating=0.00, CritRating=4.57, HasteRating=3.93, MasteryRating=4.09 )

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:827742|383250|328012|246939|239204|183126|177939|119970|89790&chds=0,1655484&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9&chm=t++827742++devouring_plague,9482C9,0,0,15|t++383250++shadow_word_pain,9482C9,1,0,15|t++328012++vampiric_touch,9482C9,2,0,15|t++246939++shadow_word_death,9482C9,3,0,15|t++239204++halo,9482C9,4,0,15|t++183126++mind_spike,4A79D3,5,0,15|t++177939++mind_blast,9482C9,6,0,15|t++119970++mind_flay,9482C9,7,0,15|t++89790++mind_sear,9482C9,8,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:12,10,10,9,8,8,7,6,5,5,5,4,4,3,3,2,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_flay|shadowy_apparition|essence_of_yulon|mind_blast|shadow_word_pain_mastery|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|multistrike_spell|shadow_word_death|devouring_plague|shadowfiend: melee|devouring_plague_mastery|halo_damage|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.82,6.24,5.14,4.57,4.09,3.93|6.66,6.07,4.98,4.41,3.93,3.77|6.98,6.40,5.30,4.73,4.25,4.09&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.82++Int,FFFFFF,0,0,15,0.1,e|t++++6.24++Hit,FFFFFF,0,1,15,0.1,e|t++++5.14++SP,FFFFFF,0,2,15,0.1,e|t++++4.57++Crit,FFFFFF,0,3,15,0.1,e|t++++4.09++Mastery,FFFFFF,0,4,15,0.1,e|t++++3.93++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.195& http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bfjmpsuxz23566877641yvtrpnnmlkkkkkihgfecccccdeeeeedcbaZYZZZZZaZZYWWWVVVWWVWYYXXXXWWWWXYYZZaabbbaaaaaaaaZZaZYYYXWVUTTTTUVVWXYYXXXXYZbdfjlmmmmmlkkjjjjkjkjihdbaaaZZZZZZaZZZZYXWWWXYZZabcdffeeeeeefffffedccbaZXXWWWWWXXXYXWWWVVVVVWYZaabbaZYXXXXXYZaabbZZYYYYZabbdfffffedddeefgggghiihhhggggggfeedccbbZZYXXXXXXXYYZYXXXWWXXYYaccccccccbbbcccddddcbaZZZYYYYYYZZZZZYXWVVVXYZabdfhijjkkkmnoqqrqpoonmkihggggfffgffeeeddddefghhhhihghhhhhhhhhhggeddccbcdcbccccccccccddeffggghihhiiiiiiiihihggfeccbaZZZZZZabccccdddfijloqqrrsttsssrsrrrqppomlkkkjihhhhihghhgfffeffghiijjlljigedcbZYX&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.4979,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=271489|max=545230&chxp=1,1,50,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,0,3,5,21,32,56,106,170,284,399,534,705,915,1137,1352,1572,1715,1816,1806,1786,1680,1570,1479,1177,1031,850,666,538,418,336,233,176,121,96,63,53,23,26,14,11,3,7,2,0,1,0,0,1&chds=0,1816&chbh=5&chxt=x&chxl=0:|min=236568|avg=271489|max=319042&chxp=0,1,42,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:30.2,18.2,13.9,11.6,9.9,3.8,3.3,2.6,0.7,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 136.3s|shadow_word_pain 82.3s|mind_spike 62.9s|vampiric_touch 52.5s|mind_blast 44.6s|shadow_word_death 17.3s|devouring_plague 14.9s|halo 11.8s|shadowfiend 3.3s|mind_sear 0.0s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 271489
devouring_plague 8278 (27385) 3.1% (10.1%) 13.9 32.00sec 888065 827742 183347 396154 268367 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.92 13.92 0.00 0.00 1.0729 0.0000 3734583.67 3734583.67 0.00 827741.98 827741.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.33 59.82% 183347.50 161639 307820 183309.72 161639 250358 1526377 1526377 0.00
crit 5.57 40.06% 396153.90 336788 769642 395948.65 0 625930 2208206 2208206 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6300 2.3% 56.0 7.53sec 50730 0 30862 80557 50821 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.05 55.95 0.00 0.00 0.0000 0.0000 2843423.68 2843423.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.36 59.63% 30862.46 26940 51304 30870.09 27053 37356 1029566 1029566 0.00
crit 22.52 40.24% 80556.62 67809 159064 80516.64 68324 105393 1813858 1813858 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12807 4.7% 13.9 32.00sec 415367 0 0 0 0 0.0% 0.0% 0.0% 0.0% 128.5 30733 66205 44989 40.2% 0.0% 18.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.92 13.92 128.48 128.48 0.0000 0.6340 5780180.46 5780180.46 0.00 70958.16 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.8 59.81% 30732.53 26940 156409 30741.92 27198 93598 2361644 2361644 0.00
crit 51.6 40.19% 66205.33 56133 359279 66156.56 56622 206219 3418536 3418536 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20199 7.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 171.6 24486 53873 36311 40.3% 0.1% 30.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.84 171.60 250.96 0.0000 0.7912 9112361.30 9112361.30 0.00 67117.15 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.6 59.60% 24485.91 21101 40897 24492.77 22172 27877 3662123 3662123 0.00
crit 101.2 40.31% 53873.48 43965 102254 53871.97 47661 64649 5450239 5450239 0.00
miss 0.2 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6245) 0.0% (2.3%) 11.1 42.28sec 254313 239204 0 0 0 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 11.07 0.00 0.00 1.0633 0.0000 0.00 0.00 0.00 239203.58 239203.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.64 60.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.41 39.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6245 2.3% 11.1 42.28sec 254313 0 173059 372800 252421 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 11.15 0.00 0.00 0.0000 0.0000 2813990.93 2813990.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.69 60.02% 173058.63 153853 275756 173063.41 0 256624 1157977 1157977 0.00
crit 4.44 39.85% 372800.21 320566 689472 371231.26 0 675502 1656014 1656014 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 17603 6.5% 35.9 12.58sec 221115 177939 151142 327077 221117 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.89 35.89 0.00 0.00 1.2427 0.0000 7936058.81 7936058.81 0.00 177938.54 177938.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.53 59.98% 151142.03 129332 396163 151094.13 131237 184444 3253729 3253729 0.00
crit 14.32 39.89% 327077.46 269474 990526 327135.01 269474 432443 4682330 4682330 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 24355 (36306) 9.0% (13.4%) 93.2 4.72sec 175426 119970 0 0 0 0.0% 0.1% 0.0% 0.0% 181.6 40435 89384 60398 40.8% 0.0% 24.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.21 93.21 181.61 181.61 1.4622 0.6018 10969133.26 10969133.26 0.00 119970.32 119970.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.08 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.5 59.22% 40434.85 34279 65277 40462.92 36703 45199 4348427 4348427 0.00
crit 74.1 40.78% 89384.15 71424 163211 89435.46 77470 110368 6620706 6620706 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 11951 4.4% 79.3 5.49sec 67844 0 40344 108153 67878 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.32 79.28 0.00 0.00 0.0000 0.0000 5381501.81 5381501.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.92 59.19% 40344.10 34279 65277 40373.13 35789 46745 1893133 1893133 0.00
crit 32.25 40.68% 108153.14 86282 202384 108233.73 90033 141012 3488369 3488369 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 8 0.0% 0.0 148.37sec 136756 89790 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 21938 46506 31800 40.2% 0.1% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.03 0.03 0.06 0.12 1.5392 0.6447 3950.78 3950.78 0.00 89790.47 89790.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.03 99.86% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.1 59.68% 21938.35 20175 34924 593.57 0 34924 1627 1627 0.00
crit 0.0 40.23% 46506.13 42035 72766 1070.87 0 72766 2324 2324 0.00
miss 0.0 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 4 0.0% 0.1 0.61sec 35528 0 21950 55748 35528 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.05 0.05 0.00 0.00 0.0000 0.0000 1926.21 1926.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.03 59.70% 21949.70 20175 34924 404.01 0 34924 711 711 0.00
crit 0.02 40.22% 55747.62 50780 87903 801.78 0 87903 1216 1216 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (4) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 25562 9.4% 58.7 7.44sec 196302 183126 133232 289711 196302 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.68 58.68 0.00 0.00 1.0719 0.0000 11518107.14 11518107.14 0.00 183126.49 183126.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.89 59.46% 133232.20 105187 323346 133349.01 109692 164452 4648353 4648353 0.00
crit 23.71 40.41% 289710.97 219166 808460 289958.82 227600 382746 6869754 6869754 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 10165 3.7% 224.8 2.04sec 20388 0 20388 0 20388 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.75 224.75 0.00 0.00 0.0000 0.0000 4582257.88 4582257.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 224.75 100.00% 20387.63 7034 371987 20405.10 15563 27316 4582258 4582258 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:30202.52
  • base_dd_max:30202.52
power_infusion 0 0.0% 4.3 120.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9456 3.5% 16.1 4.66sec 265062 246939 180198 390168 265060 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.07 16.07 0.00 0.00 1.0734 0.0000 4260437.18 4260437.18 0.00 246938.92 246938.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.53 59.32% 180197.52 145361 446332 180534.20 145361 261690 1718193 1718193 0.00
crit 6.52 40.54% 390168.08 302873 1115962 391017.13 0 859420 2542244 2542244 0.00
miss 0.02 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32066 (69885) 11.8% (25.8%) 76.9 5.83sec 409837 383250 0 0 0 0.0% 0.1% 0.0% 0.0% 404.7 24361 52746 35742 40.1% 0.0% 135.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.92 76.92 404.69 404.69 1.0694 1.5105 14464122.85 14464122.85 0.00 45455.08 383249.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.86 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 242.4 59.91% 24361.38 21342 40629 24369.93 22633 27031 5906031 5906031 0.00
crit 162.3 40.09% 52745.67 44467 101583 52753.85 47570 59298 8558092 8558092 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15791 5.8% 176.8 2.53sec 40302 0 24403 64207 40334 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.75 176.61 0.00 0.00 0.0000 0.0000 7123340.63 7123340.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.55 59.77% 24403.02 21342 40629 24407.19 22468 27127 2575741 2575741 0.00
crit 70.83 40.10% 64206.55 53717 125965 64222.01 57409 73970 4547600 4547600 0.00
miss 0.23 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0976 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 22028 8.1% 233.1 1.92sec 42636 0 29178 63516 43048 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 233.07 230.84 0.00 0.00 0.0000 0.0000 9937135.90 9937135.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.60 59.61% 29178.48 25217 48441 29181.02 26978 32393 4015067 4015067 0.00
crit 93.24 40.39% 63515.50 52542 121116 63515.77 57486 71732 5922069 5922069 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2062 0.7% 5.0 63.56sec 184168 0 110105 277703 184169 44.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.98 4.98 0.00 0.00 0.0000 0.0000 916242.11 916242.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.77 55.60% 110104.78 79124 153360 104309.78 0 153360 304593 304593 0.00
crit 2.20 44.27% 277703.36 164861 383445 248209.51 0 383445 611649 611649 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 25754 (38234) 9.5% (14.1%) 48.8 9.17sec 353376 328012 0 0 0 0.0% 0.1% 0.0% 0.0% 243.7 32212 70262 47636 40.5% 0.0% 98.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.77 48.77 243.71 243.71 1.0773 1.8167 11609176.33 11609176.33 0.00 34797.36 328012.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.73 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.9 59.46% 32211.61 27457 53135 32226.88 29484 35944 4667957 4667957 0.00
crit 98.8 40.54% 70262.48 57209 132854 70277.08 62466 81063 6941219 6941219 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12480 4.6% 106.4 4.15sec 52861 0 31839 84163 52902 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.42 106.34 0.00 0.00 0.0000 0.0000 5625574.01 5625574.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.32 59.54% 31838.60 27457 53135 31849.12 29092 35664 2015872 2015872 0.00
crit 42.89 40.33% 84162.51 69110 164741 84191.18 72491 100466 3609702 3609702 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 105245 / 8375
melee 104875 3.0% 33.5 11.72sec 111021 119354 72783 174441 111022 41.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.51 33.51 0.00 0.00 0.9302 0.0000 3719779.25 3719779.25 0.00 119353.76 119353.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.47 34.23% 72782.84 54848 114390 72952.86 57966 114390 834686 834686 0.00
crit 13.95 41.64% 174440.81 124648 274537 174056.87 132458 244860 2433897 2433897 0.00
glance 8.04 24.00% 56117.55 41136 85793 56130.93 0 85793 451197 451197 0.00
dodge 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0749 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 370 0.0% 1.4 1.73sec 9356 0 5575 13689 9355 46.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 13044.65 13044.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 53.23% 5574.65 4169 6741 3044.63 0 6741 4138 4138 0.00
crit 0.65 46.66% 13689.25 10006 16178 6761.14 0 16178 8907 8907 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6741.11
  • base_dd_max:6741.11

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.15%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.9 0.0 32.0sec 32.0sec 9.69% 12.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:9.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.6sec 124.6sec 17.61% 17.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.61%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.5sec 41.64% 41.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.64%

    Trigger Attempt Success

    • trigger_pct:99.42%
power_infusion 4.3 0.0 120.8sec 120.8sec 18.63% 18.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.1 0.0 9.8sec 9.8sec 15.22% 49.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 8.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 43.8 26.2 10.1sec 6.3sec 36.38% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:26.39%
  • surge_of_darkness_2:9.99%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 22.97% 43.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.97%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.9 0.0 56.4sec 56.2sec 17.31% 17.31%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.31%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.3sec 74.3sec 83.38% 73.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.15% 69.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 13.9 41.7 3.0 3.0 296266.5
halo Mana 11.1 418547.7 37826.3 37826.1 6.7
mind_blast Mana 35.9 311605.6 8682.0 8682.0 25.5
mind_flay Mana 93.2 266803.7 2862.6 2862.5 61.3
mind_sear Mana 0.0 259.8 8995.0 8992.1 15.2
shadow_word_death Mana 16.1 120697.3 7508.9 7509.2 35.3
shadow_word_pain Mana 76.9 974491.3 12669.1 12668.9 32.3
vampiric_touch Mana 48.8 420575.2 8623.3 8623.3 41.0
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.46 235735.01 (9.94%) 7044.99 65417.23 21.72%
Shadow Orbs from Mind Blast Shadow Orb 35.84 34.97 (81.20%) 0.98 0.87 2.44%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.10 8.10 (18.80%) 1.00 0.00 0.00%
Devouring Plague Health Health 184.43 0.00 (0.00%) 0.00 3921813.55 100.00%
Vampiric Touch Mana Mana 350.04 1629168.82 (68.68%) 4654.20 152070.14 8.54%
halo_heal Health 11.06 0.00 (0.00%) 0.00 3714451.69 100.00%
external_healing Health 86.26 0.00 (0.00%) 0.00 29507202.56 100.00%
mp5_regen Mana 1803.77 507304.03 (21.39%) 281.25 33826.60 6.25%
pet - shadowfiend
external_healing Health 14.68 0.00 (0.00%) 0.00 5076647.45 100.00%
Resource RPS-Gain RPS-Loss
Mana 5259.10 5571.19
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 159746.52 -108120.00 300000.00
Shadow Orb 1.38 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.3%
shadowfiend-Mana Cap 6.3%
mindbender-Mana Cap 6.3%

Procs

Count Interval
Shadowy Recall Extra Tick 418.2 1.1sec
Shadowy Apparition Procced 233.1 1.9sec
FDCL Mind Spike proc 70.0 6.3sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 271488.73
Minimum 236568.43
Maximum 319042.09
Spread ( max - min ) 82473.65
Range [ ( max - min ) / 2 * 100% ] 15.19%
Standard Deviation 9215.7526
5th Percentile 256866.46
95th Percentile 287315.42
( 95th Percentile - 5th Percentile ) 30448.96
Mean Distribution
Standard Deviation 58.2949
95.00% Confidence Intervall ( 271374.48 - 271602.99 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4426
0.1 Scale Factor Error with Delta=300 725012
0.05 Scale Factor Error with Delta=300 2900048
0.01 Scale Factor Error with Delta=300 72501215
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 271488.73
Minimum 236568.43
Maximum 319042.09
Spread ( max - min ) 82473.65
Range [ ( max - min ) / 2 * 100% ] 15.19%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 118613504.92
Minimum 84617691.98
Maximum 154745872.28
Spread ( max - min ) 70128180.29
Range [ ( max - min ) / 2 * 100% ] 29.56%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.98 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.58 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 8.10 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 36.89 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 38.30 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 12.16 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 14.21 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.33 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 12.19 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 11.06 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.21 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 7.05 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 46.49 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.03 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 93.20 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 27.87 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABLScHMZZZXZWHZZRXOXNHQRXZZZXcccHMZZZZZHLLLMMMMLHSXZZcccHMQZZZZWHZZZOXZHLZZZLLLcXHMMMRSRXZHQZZONXWHZZXZBLccHMZZZZXWHLLLMMMONHQRSXXZccccHOZXZZXHZZZONWHXZZZZALLHLMMNQRSWHZZXZZHMXZXNZccccHZOZZZWHLLLMMMNHMQSXXZLBccHMZZZZZHZZXXONHZZXZLLLRXHMMMNQRSRHXZZZOXWHXZNZccXHOQXZXZWHLLLMMMNHMRSXZcccccHZOZZXZHQXZZZNHMZZLABLHLLMMSZXWHZZIFNQWHOXZVIFXcccccHGIFMZZWLHLIFLMMMLHGIF8SccHMIFQZZWHXVIFZORNHXIFQX

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 271045 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
271044.6 271044.6 109.95 / 0.04% 14667 / 5.4% 45.1 5822.4 5253.7 Mana 0.50% 50.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.75 5.11 6.19 4.39 3.69 4.02
Normalized 1.00 0.76 0.92 0.65 0.55 0.60
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.15 0.15 0.16 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=6.75, SpellDamage=5.11, HitRating=6.19, CritRating=4.39, HasteRating=3.69, MasteryRating=4.02 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=6.75, SpellDamage=5.11, HitRating=0.00, CritRating=4.39, HasteRating=3.69, MasteryRating=4.02 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:860271|376875|312326|278279|242458|187889|183678|129051|116067&chds=0,1720542&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9&chm=t++860271++devouring_plague,9482C9,0,0,15|t++376875++shadow_word_pain,9482C9,1,0,15|t++312326++vampiric_touch,9482C9,2,0,15|t++278279++shadow_word_death,9482C9,3,0,15|t++242458++halo,9482C9,4,0,15|t++187889++mind_spike,4A79D3,5,0,15|t++183678++mind_blast,9482C9,6,0,15|t++129051++mind_sear,9482C9,7,0,15|t++116067++mind_flay,9482C9,8,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:12,10,9,9,8,8,7,6,5,5,4,4,4,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|mind_spike|vampiric_touch|mind_flay|shadowy_apparition|essence_of_yulon|mind_blast|shadow_word_pain_mastery|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|multistrike_spell|devouring_plague|shadowfiend: melee|devouring_plague_mastery|halo_damage|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.75,6.19,5.11,4.39,4.02,3.69|6.60,6.04,4.95,4.24,3.87,3.54|6.91,6.35,5.26,4.55,4.18,3.85&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.75++Int,FFFFFF,0,0,15,0.1,e|t++++6.19++Hit,FFFFFF,0,1,15,0.1,e|t++++5.11++SP,FFFFFF,0,2,15,0.1,e|t++++4.39++Crit,FFFFFF,0,3,15,0.1,e|t++++4.02++Mastery,FFFFFF,0,4,15,0.1,e|t++++3.69++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.112& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cgjmqsvxz1346568553zxusqonmmmmmnnonmlkjiihiiklllkjigfddccdddddddbZZZYYZZZZabbbbbbaaabbcddeeffgfeeeeeeeeddedcccaZYXWWWWWWXXYZYXXXXXYZbdgjkllmmllkkkklllmmlkigfeeddcccdeddddccababdeefghikkjjjjjjjkjkkihhgfedbbaaaaabbbcbaaZZYYYZacdefffedcbaaaaabccccaZYYYXYZabceefggffefghijjkllmnmlmllllllkkljjiihffedddddeeeefeddccccdeehijjkkkkjjjjjkkllllljhhggggffffhhhhhfedbccdeghhjlnoopppprtuvvxvvuutsrponnnnnnooponnnnnnnoprsstuutssttsttttsssroonmlllmlllmlllmmmmmnnopqrrrsttttuuuuuutttsrrqomlkjihhhgghhiihhhihjmnortuvwxyzzzzyzzz00zzzxwxwvuutssstssssrqqpppqrrstuuwvtqomjihfdb&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5763,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=271045|max=470321&chxp=1,1,58,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,7,6,24,24,51,76,155,214,308,429,571,685,892,1120,1269,1428,1522,1728,1697,1660,1610,1495,1371,1197,1044,913,792,611,481,417,322,243,172,144,111,61,52,31,14,16,9,7,5,2,1,1,1,0,1&chds=0,1728&chbh=5&chxt=x&chxl=0:|min=240991|avg=271045|max=314499&chxp=0,1,41,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:30.5,18.4,13.3,11.6,10.0,3.8,3.3,2.6,0.7,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 137.4s|shadow_word_pain 82.9s|mind_spike 60.0s|vampiric_touch 52.4s|mind_blast 45.3s|shadow_word_death 17.3s|devouring_plague 15.1s|halo 11.9s|shadowfiend 3.3s|mind_sear 0.0s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 271045
devouring_plague 8802 (28688) 3.3% (10.6%) 14.0 31.67sec 927528 860271 194441 419665 284493 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.96 0.00 0.00 1.0782 0.0000 3971639.01 3971639.01 0.00 860270.83 860270.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.34 59.77% 194441.02 161639 337137 194443.49 161639 256298 1622448 1622448 0.00
crit 5.60 40.10% 419665.25 336788 842941 419586.50 0 824440 2349192 2349192 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6571 2.4% 55.4 7.54sec 53509 0 32612 84912 53599 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.44 55.35 0.00 0.00 0.0000 0.0000 2966497.36 2966497.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.03 59.67% 32612.41 26940 56190 32625.16 28092 39144 1077071 1077071 0.00
crit 22.25 40.20% 84911.96 67809 174213 84891.84 70405 115821 1889426 1889426 0.00
miss 0.07 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13314 4.9% 14.0 31.67sec 430546 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.9 32424 69706 47369 40.1% 0.0% 18.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.96 126.89 126.89 0.0000 0.6492 6010660.19 6010660.19 0.00 72959.96 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.0 59.91% 32423.89 26940 137259 32434.26 28460 72736 2464937 2464937 0.00
crit 50.9 40.09% 69705.66 56133 285990 69668.97 59552 154615 3545723 3545723 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20453 7.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 166.5 25407 55714 37597 40.3% 0.1% 29.2%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.73 166.51 245.19 0.0000 0.7914 9218611.73 9218611.73 0.00 69957.21 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.2 59.62% 25407.42 21101 44792 25413.00 22909 29451 3713987 3713987 0.00
crit 98.8 40.30% 55714.07 43965 111993 55706.62 48253 66966 5504625 5504625 0.00
miss 0.2 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6377) 0.0% (2.4%) 11.0 42.41sec 260504 242458 0 0 0 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.03 0.00 0.00 1.0745 0.0000 0.00 0.00 0.00 242457.89 242457.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.60 59.81% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.42 40.08% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6377 2.4% 11.0 42.41sec 260504 0 177813 383664 259179 39.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.09 0.00 0.00 0.0000 0.0000 2874095.83 2874095.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.68 60.24% 177812.87 153853 302019 177787.35 0 249956 1187743 1187743 0.00
crit 4.40 39.64% 383664.32 320566 755136 382021.79 0 718051 1686353 1686353 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 18447 6.8% 36.1 12.52sec 230404 183678 157786 340709 230403 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.10 36.10 0.00 0.00 1.2544 0.0000 8317857.88 8317857.88 0.00 183677.99 183677.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.69 60.07% 157785.51 129332 433893 157714.85 133869 201322 3421981 3421981 0.00
crit 14.37 39.80% 340708.76 269474 1084861 340785.82 269474 487986 4895877 4895877 0.00
miss 0.04 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 23756 (35401) 8.8% (13.1%) 93.1 4.72sec 171211 116067 0 0 0 0.0% 0.1% 0.0% 0.0% 175.3 41067 90190 61036 40.7% 0.0% 24.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.13 93.13 175.31 175.31 1.4751 0.6306 10700358.06 10700358.06 0.00 116066.83 116066.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.02 99.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.0 59.35% 41066.92 34279 71493 41089.95 37676 46146 4272868 4272868 0.00
crit 71.3 40.65% 90189.97 71424 178754 90236.32 80045 104858 6427490 6427490 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 11645 4.3% 76.6 5.71sec 68497 0 40976 109087 68528 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.57 76.53 0.00 0.00 0.0000 0.0000 5244786.67 5244786.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.42 59.34% 40976.21 34279 71493 40997.36 36999 49558 1860975 1860975 0.00
crit 31.02 40.53% 109086.90 86282 221659 109147.80 89702 139883 3383811 3383811 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 7 0.0% 0.0 92.12sec 188794 129051 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 23346 49552 33321 38.1% 0.1% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.02 0.02 0.03 0.09 1.5018 0.6273 3097.21 3097.21 0.00 129050.55 129050.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.1 61.77% 23346.47 20175 40162 358.56 0 35370 1341 1341 0.00
crit 0.0 38.14% 49552.34 42035 83681 654.28 0 77025 1757 1757 0.00
miss 0.0 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 3 0.0% 0.0 3.57sec 38087 0 23442 59624 38087 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.04 0.04 0.00 0.00 0.0000 0.0000 1600.16 1600.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.03 59.52% 23441.66 20175 40162 287.12 0 34924 586 586 0.00
crit 0.02 40.48% 59624.19 50780 85842 593.98 0 85842 1014 1014 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (3) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 24996 9.2% 55.7 7.80sec 202161 187889 137782 298223 202162 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.72 55.72 0.00 0.00 1.0760 0.0000 11264864.44 11264864.44 0.00 187888.66 187888.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.23 59.64% 137782.46 105187 354141 137903.64 112180 165813 4578677 4578677 0.00
crit 22.42 40.24% 298223.37 219166 885456 298446.47 239955 389815 6686188 6686188 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 10195 3.8% 217.0 2.11sec 21187 0 21187 0 21187 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 216.96 216.96 0.00 0.00 0.0000 0.0000 4596647.79 4596647.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 216.96 100.00% 21187.10 7034 407415 21200.98 15789 29634 4596648 4596648 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:95215.69
  • base_dd_max:95215.69
shadow_word_death 10714 4.0% 16.0 4.67sec 301020 278279 205546 443070 301012 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.03 16.03 0.00 0.00 1.0817 0.0000 4826743.70 4826743.70 0.00 278278.68 278278.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.55 59.58% 205545.82 167166 488840 205875.01 167166 319620 1963503 1963503 0.00
crit 6.46 40.30% 443069.56 348304 1222245 444216.04 0 1195166 2863241 2863241 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31769 (69224) 11.7% (25.6%) 76.9 5.84sec 406186 376875 0 0 0 0.0% 0.1% 0.0% 0.0% 389.9 25083 54251 36761 40.0% 0.0% 135.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.88 76.88 389.90 389.90 1.0778 1.5626 14332796.55 14332796.55 0.00 45120.96 376874.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.82 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 233.8 59.96% 25082.72 21342 44498 25088.48 23229 27699 5864228 5864228 0.00
crit 156.1 40.04% 54250.92 44467 111258 54252.33 49293 60803 8468568 8468568 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15665 5.8% 170.3 2.63sec 41481 0 25162 66087 41516 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 170.34 170.20 0.00 0.00 0.0000 0.0000 7065981.24 7065981.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.84 59.83% 25161.96 21342 44498 25166.27 23325 27626 2562427 2562427 0.00
crit 68.15 40.04% 66087.17 53717 137962 66099.48 59784 75070 4503554 4503554 0.00
miss 0.22 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0976 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 21789 8.0% 224.2 2.00sec 43835 0 30056 65289 44255 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.24 222.11 0.00 0.00 0.0000 0.0000 9829435.33 9829435.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.60 59.70% 30055.84 25217 53054 30057.07 27500 32890 3985414 3985414 0.00
crit 89.51 40.30% 65289.48 52542 132651 65288.95 58442 73572 5844021 5844021 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1875 0.7% 4.7 69.83sec 178738 0 108437 268666 178740 43.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 831655.26 831655.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.60 55.94% 108436.66 79124 158839 101611.09 0 158839 282240 282240 0.00
crit 2.04 43.95% 268666.18 164861 365186 235106.47 0 365186 549415 549415 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:114922.80
  • base_dd_max:114922.80
vampiric_touch 24376 (36323) 9.0% (13.4%) 48.3 9.24sec 338733 312326 0 0 0 0.0% 0.1% 0.0% 0.0% 227.9 32767 71113 48235 40.3% 0.0% 96.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.35 48.35 227.85 227.85 1.0846 1.9114 10990545.92 10990545.92 0.00 33560.67 312325.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.31 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.9 59.66% 32767.42 27457 58196 32778.09 30047 36711 4454551 4454551 0.00
crit 91.9 40.34% 71113.05 57209 145506 71123.57 62900 81159 6535995 6535995 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11946 4.4% 99.6 4.42sec 54082 0 32726 85955 54127 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.58 99.50 0.00 0.00 0.0000 0.0000 5385617.76 5385617.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.29 59.59% 32725.55 27457 58196 32733.19 29682 36543 1940273 1940273 0.00
crit 40.08 40.28% 85955.47 69110 180431 85978.62 75622 101991 3445345 3445345 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 104846 / 8343
melee 104472 3.0% 33.5 11.73sec 110572 118869 72531 173740 110573 41.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.50 33.50 0.00 0.00 0.9302 0.0000 3704670.82 3704670.82 0.00 118868.99 118868.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.49 34.29% 72530.51 54848 114390 72710.73 58153 103428 833185 833185 0.00
crit 13.94 41.61% 173739.62 124648 274537 173382.94 131588 274537 2422274 2422274 0.00
glance 8.04 23.98% 55907.44 41136 85793 55929.05 0 85793 449212 449212 0.00
dodge 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0819 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 374 0.0% 1.4 1.70sec 9362 0 5570 13714 9362 46.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.41 0.00 0.00 0.0000 0.0000 13177.22 13177.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.75 53.22% 5570.29 4169 6741 3043.97 0 6741 4173 4173 0.00
crit 0.66 46.65% 13714.39 10006 16178 6817.36 0 16178 9005 9005 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 15.09%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.0 0.0 31.6sec 31.6sec 10.34% 12.39%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:10.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 125.2sec 125.2sec 17.49% 17.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.49%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.4sec 41.65% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.65%

    Trigger Attempt Success

    • trigger_pct:99.44%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.1 0.0 9.8sec 9.8sec 15.19% 49.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.19%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 8.09%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 42.4 23.1 10.3sec 6.7sec 35.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:25.76%
  • surge_of_darkness_2:9.25%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.7sec 39.7sec 22.94% 53.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.94%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 56.6sec 56.4sec 17.25% 17.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.25%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 306.0 0.0sec 0.5sec 32.34% 32.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.3sec 74.3sec 83.38% 73.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.18% 69.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 14.0 41.8 3.0 3.0 309449.3
halo Mana 11.0 446826.8 40500.0 40499.8 6.4
mind_blast Mana 36.1 324910.4 9000.0 9000.0 25.6
mind_flay Mana 93.1 279397.1 3000.0 3000.0 57.1
mind_sear Mana 0.0 147.6 9000.0 8997.1 21.0
shadow_word_death Mana 16.0 125075.5 7800.0 7800.3 38.6
shadow_word_pain Mana 76.9 1014818.1 13200.0 13199.8 30.8
vampiric_touch Mana 48.3 435107.2 9000.0 9000.0 37.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.46 265897.20 (11.22%) 7945.58 35286.00 11.72%
Shadow Orbs from Mind Blast Shadow Orb 36.06 35.15 (81.31%) 0.97 0.91 2.53%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.08 8.08 (18.69%) 1.00 0.00 0.00%
Devouring Plague Health Health 182.24 0.00 (0.00%) 0.00 3875180.03 100.00%
Vampiric Touch Mana Mana 327.35 1582789.79 (66.79%) 4835.09 82839.49 4.97%
halo_heal Health 11.03 0.00 (0.00%) 0.00 3873165.27 100.00%
external_healing Health 86.29 0.00 (0.00%) 0.00 29364792.60 100.00%
mp5_regen Mana 1803.77 521077.90 (21.99%) 288.88 20052.73 3.71%
pet - shadowfiend
external_healing Health 14.68 0.00 (0.00%) 0.00 5080345.36 100.00%
Resource RPS-Gain RPS-Loss
Mana 5253.68 5822.37
Shadow Orb 0.10 0.09
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 45153.36 -227100.00 257700.00
Shadow Orb 1.39 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.8%
shadowfiend-Mana Cap 3.8%
mindbender-Mana Cap 3.8%

Procs

Count Interval
Shadowy Recall Extra Tick 401.6 1.1sec
Shadowy Apparition Procced 224.2 2.0sec
FDCL Mind Spike proc 65.5 6.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 271044.64
Minimum 240991.04
Maximum 314499.46
Spread ( max - min ) 73508.41
Range [ ( max - min ) / 2 * 100% ] 13.56%
Standard Deviation 8868.1367
5th Percentile 257011.91
95th Percentile 286346.52
( 95th Percentile - 5th Percentile ) 29334.61
Mean Distribution
Standard Deviation 56.0960
95.00% Confidence Intervall ( 270934.69 - 271154.59 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4112
0.1 Scale Factor Error with Delta=300 671349
0.05 Scale Factor Error with Delta=300 2685396
0.01 Scale Factor Error with Delta=300 67134912
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 271044.64
Minimum 240991.04
Maximum 314499.46
Spread ( max - min ) 73508.41
Range [ ( max - min ) / 2 * 100% ] 13.56%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 118433492.08
Minimum 86773883.66
Maximum 155734837.38
Spread ( max - min ) 68960953.72
Range [ ( max - min ) / 2 * 100% ] 29.11%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.96 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.62 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 8.08 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 37.27 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 39.29 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 11.69 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 13.01 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.34 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 11.15 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 11.03 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.24 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 6.86 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 44.57 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.02 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 93.13 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 27.92 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ALScHMZZXZXWHXZXZOZNHQZZZXXXcRXHMXZZZZSHLLLMLMMMHQRRXXccHOZXZZZHZXZOZNHQSZXLLLRXHMMMZNZWWHZZZOXXHQZXZLccHMSZZZXHLLLMMMMHNRXZZcccccHOQXZZZHXXSZOXNHZZZALLHLMMQRNXWHZZZOZHZZZSNRXcHOZZZZXWHLLLMMMNMHQRXZLccHMZZSXZZHZROXZNWHQZZXLLLcHMMMMXZZHZXZONSZHQZZZcccHMZZZXZWHLLLMMMMHNXZXZZXcScHOQZZZZHZZOZLHXZZXZLALHLLMMZXSHZXIFNQOHZZIFZccccHGIFMRXZHLLIFLMMHLMGIF8RSXcHVIFOQXZZHIFRXZZHLIFMQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 280142 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
280141.7 280141.7 116.83 / 0.04% 15557 / 5.6% 44.9 5757.2 5518.0 Mana 0.73% 50.2 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.10 5.40 6.43 4.73 5.19 4.53
Normalized 1.00 0.76 0.91 0.67 0.73 0.64
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.17 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.10, SpellDamage=5.40, HitRating=6.43, CritRating=4.73, HasteRating=5.19, MasteryRating=4.53 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.10, SpellDamage=5.40, HitRating=0.00, CritRating=4.73, HasteRating=5.19, MasteryRating=4.53 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:816353|360008|309260|253674|234947|221456|109708|58407&chds=0,1632705&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++816353++devouring_plague,9482C9,0,0,15|t++360008++shadow_word_pain,9482C9,1,0,15|t++309260++vampiric_touch,9482C9,2,0,15|t++253674++shadow_word_death,9482C9,3,0,15|t++234947++halo,9482C9,4,0,15|t++221456++mind_blast,9482C9,5,0,15|t++109708++mind_flay,9482C9,6,0,15|t++58407++mind_sear,9482C9,7,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:12,11,11,9,8,8,8,7,6,5,4,4,4,4,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|mind_blast|mind_flay|vampiric_touch|mindbender: melee|essence_of_yulon|shadowy_apparition|devouring_plague_tick|shadow_word_pain_mastery|mind_flay_mastery|devouring_plague|vampiric_touch_mastery|multistrike_spell|shadow_word_death|devouring_plague_mastery|halo_damage|stormlash|mindbender: stormlash|mind_sear|mind_sear_mastery&
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.10,6.43,5.40,5.19,4.73,4.53|6.93,6.26,5.23,5.02,4.56,4.36|7.26,6.60,5.56,5.35,4.89,4.69&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.10++Int,FFFFFF,0,0,15,0.1,e|t++++6.43++Hit,FFFFFF,0,1,15,0.1,e|t++++5.40++SP,FFFFFF,0,2,15,0.1,e|t++++5.19++Haste,FFFFFF,0,3,15,0.1,e|t++++4.73++Crit,FFFFFF,0,4,15,0.1,e|t++++4.53++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.524& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:aeinrsuxz13466686630yvspnnmllllllmlllkkjkllmnnoonnmljiihhhhhhhhggfffeeeefffffffedcccbccddeffggggfffffffffeddccaZXWWWWXYYZabcddeffgikmpqsssssrrqponnmmllkjihffeedddddddddddcbbaabcdefghijkkllmmmnnnnnlkjihgfedcbaaaaaabbaaaaaabcdffggghgedccbbcccdddddddeeefghijkkkkkjiihhiiiijkklmmmmlllllllkkjihgfedcbbbbbccdeeffgghhjklmoopppoonmlkkkjihhggfeddddcccccccccddbaZYYYYZaccdfhijklmmoqrssttsrrqpomlkjjiihhiiiiiiiijklmoooppqpoooonnnnnnnmmllllllmnnnnnnnnnmmmlllllmmmmmnnnooooooonnnmllkigfedccbcccdeffghhijmprtuvwyyzzyyxwvvuutsrqppooonnmmmmmnmmmmllkkkklllmmmooomkigedcaYW&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5821,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=280142|max=481299&chxp=1,1,58,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,2,1,5,13,23,27,60,100,167,250,342,426,567,791,1012,1222,1314,1475,1623,1734,1794,1696,1653,1490,1337,1165,1020,839,706,497,449,328,255,200,122,98,63,46,33,17,10,5,6,3,1,0,1,3&chds=0,1794&chbh=5&chxt=x&chxl=0:|min=242990|avg=280142|max=324001&chxp=0,1,46,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.5,18.5,13.2,11.0,4.6,3.8,2.6,1.9,0.1,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 173.5s|shadow_word_pain 83.2s|mind_blast 59.5s|vampiric_touch 49.5s|devouring_plague 21.0s|shadow_word_death 17.1s|halo 11.9s|mindbender 8.6s|mind_sear 0.5s|waiting 3.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 280142
devouring_plague 11541 (37909) 4.1% (13.5%) 19.4 22.58sec 880449 816353 183084 395700 268017 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.43 19.43 0.00 0.00 1.0786 0.0000 5206469.85 5206469.85 0.00 816352.68 816352.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.62 59.80% 183083.82 161639 293162 183060.84 161639 225112 2126779 2126779 0.00
crit 7.78 40.06% 395699.79 336788 732992 395928.42 0 608175 3079691 3079691 0.00
miss 0.03 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8671 3.1% 77.5 5.47sec 50493 0 30711 80105 50563 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.49 77.39 0.00 0.00 0.0000 0.0000 3912865.06 3912865.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.12 59.60% 30710.90 26940 48861 30718.17 27445 36140 1416440 1416440 0.00
crit 31.16 40.27% 80105.18 67809 151489 80093.59 68441 101019 2496425 2496425 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17697 6.3% 19.4 22.58sec 411004 0 0 0 0 0.0% 0.0% 0.0% 0.0% 177.4 30722 66201 45003 40.3% 0.0% 25.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.43 19.43 177.41 177.41 0.0000 0.6494 7984070.18 7984070.18 0.00 69301.95 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.0 59.75% 30722.44 26940 123641 30731.42 27333 79854 3256551 3256551 0.00
crit 71.4 40.25% 66200.75 56133 278055 66182.15 57573 161536 4727519 4727519 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20957 7.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 163.0 24192 52715 35675 40.3% 0.1% 28.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 33.81 163.01 264.99 0.0000 0.7926 9453464.36 9453464.36 0.00 73165.83 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.9 59.59% 24192.40 21101 38949 24198.67 22006 28010 3820242 3820242 0.00
crit 106.9 40.33% 52714.71 43965 97385 52709.73 46584 61932 5633222 5633222 0.00
miss 0.2 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6186) 0.0% (2.2%) 11.0 42.37sec 252446 234947 0 0 0 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.05 11.05 0.00 0.00 1.0745 0.0000 0.00 0.00 0.00 234947.23 234947.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.63 60.00% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.40 39.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6186 2.2% 11.0 42.37sec 252446 0 170235 365842 247908 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.05 11.25 0.00 0.00 0.0000 0.0000 2788588.69 2788588.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.75 60.04% 170235.08 153853 262625 170222.91 153853 249727 1149593 1149593 0.00
crit 4.48 39.83% 365841.95 320566 656640 363712.51 0 643335 1638996 1638996 0.00
miss 0.02 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 29235 10.4% 53.1 8.44sec 248172 221456 169824 366478 248173 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.13 53.13 0.00 0.00 1.1206 0.0000 13185732.56 13185732.56 0.00 221456.35 221456.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.84 59.93% 169824.35 129332 377298 169772.42 142104 203135 5407444 5407444 0.00
crit 21.22 39.95% 366478.28 269474 943358 366460.39 289647 462934 7778288 7778288 0.00
miss 0.07 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 28353 (42273) 10.1% (15.1%) 118.4 3.72sec 160680 109708 0 0 0 0.0% 0.1% 0.0% 0.0% 217.7 39490 86647 58630 40.6% 0.0% 30.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.43 118.43 217.69 217.69 1.4646 0.6311 12763187.63 12763187.63 0.00 109708.19 109708.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.28 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.3 59.41% 39490.11 34279 62168 39510.93 36448 43641 5107493 5107493 0.00
crit 88.4 40.59% 86647.48 71424 155439 86692.52 77794 99452 7655694 7655694 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 13920 5.0% 95.2 4.59sec 65832 0 39420 104792 65866 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.18 95.13 0.00 0.00 0.0000 0.0000 6265807.43 6265807.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.45 59.34% 39419.63 34279 62168 39438.95 35432 45831 2225270 2225270 0.00
crit 38.56 40.53% 104791.86 86282 192747 104842.48 90777 126746 4040538 4040538 0.00
miss 0.12 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 58 0.0% 0.3 136.57sec 89798 58407 0 0 0 0.0% 0.1% 0.0% 0.0% 0.6 22307 47490 32220 39.4% 0.1% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.29 0.29 0.58 0.82 1.5390 0.6441 26283.31 26283.31 0.00 58407.36 58407.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.29 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.5 60.49% 22306.65 20175 34924 5061.63 0 34924 11007 11007 0.00
crit 0.3 39.43% 47490.37 42035 72766 8704.75 0 72766 15276 15276 0.00
miss 0.0 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 28 0.0% 0.4 28.93sec 36076 0 22301 57250 36076 39.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.35 0.35 0.00 0.00 0.0000 0.0000 12798.00 12798.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.21 60.37% 22301.33 20175 34924 3230.96 0 34924 4776 4776 0.00
crit 0.14 39.50% 57250.42 50780 87903 5954.52 0 87903 8022 8022 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (28) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 7.92 0.00 0.00 1.0877 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 9849 3.5% 229.0 2.01sec 19390 0 19390 0 19390 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.02 229.02 0.00 0.00 0.0000 0.0000 4440746.87 4440746.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 229.02 100.00% 19390.16 7034 354274 19402.73 14222 27072 4440747 4440747 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:43964.78
  • base_dd_max:43964.78
shadow_word_death 9648 3.4% 15.8 4.72sec 274411 253674 187524 403852 274412 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 0.00 0.00 1.0818 0.0000 4346960.17 4346960.17 0.00 253674.15 253674.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.44 59.58% 187523.66 145361 425078 187810.70 145361 297160 1769813 1769813 0.00
crit 6.38 40.28% 403851.93 302873 1062821 404252.95 0 866062 2577148 2577148 0.00
miss 0.02 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 30418 (66409) 10.9% (23.7%) 77.2 5.82sec 387942 360008 0 0 0 0.0% 0.1% 0.0% 0.0% 390.6 23988 51855 35142 40.0% 0.0% 135.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.24 77.24 390.55 390.55 1.0776 1.5623 13724675.34 13724675.34 0.00 43211.92 360007.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.17 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 234.2 59.97% 23987.98 21342 38694 23993.76 22353 26402 5618747 5618747 0.00
crit 156.3 40.03% 51855.29 44467 96746 51856.51 47808 57594 8105928 8105928 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15046 5.4% 170.6 2.62sec 39789 0 24131 63336 39823 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 170.61 170.47 0.00 0.00 0.0000 0.0000 6788478.40 6788478.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.88 59.77% 24131.06 21342 38694 24134.89 22370 26280 2458565 2458565 0.00
crit 68.36 40.10% 63335.61 53717 119967 63349.20 57736 73463 4329914 4329914 0.00
miss 0.22 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 20945 7.5% 224.7 1.99sec 42059 0 28838 62627 42471 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.67 222.50 0.00 0.00 0.0000 0.0000 9449562.24 9449562.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.73 59.65% 28838.27 25217 46134 28840.72 26881 32055 3827690 3827690 0.00
crit 89.77 40.35% 62627.32 52542 115348 62625.34 56881 71649 5621872 5621872 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1837 0.6% 4.6 68.13sec 175492 0 106042 264946 175491 43.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 815422.49 815422.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.61 56.07% 106041.59 79124 146057 99757.48 0 146057 276250 276250 0.00
crit 2.04 43.80% 264946.02 164861 365186 231522.34 0 365186 539172 539172 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22838 (33967) 8.2% (12.1%) 45.7 9.78sec 335477 309260 0 0 0 0.0% 0.1% 0.0% 0.0% 221.5 31543 68517 46489 40.4% 0.0% 93.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.65 45.65 221.50 221.50 1.0848 1.9109 10297469.59 10297469.59 0.00 32394.03 309260.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.61 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.0 59.58% 31542.85 27457 50605 31554.94 28881 35099 4162398 4162398 0.00
crit 89.5 40.42% 68517.24 57209 126527 68534.18 61068 79134 6135072 6135072 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11129 4.0% 96.7 4.56sec 51878 0 31402 82492 51918 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.73 96.65 0.00 0.00 0.0000 0.0000 5018037.82 5018037.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.64 59.64% 31401.67 27457 50605 31410.51 28491 35212 1809974 1809974 0.00
crit 38.89 40.24% 82492.14 69110 156896 82526.30 72219 97757 3208064 3208064 0.00
miss 0.12 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 84066 / 21786
melee 83815 7.7% 110.9 3.95sec 88134 90228 61801 135166 88134 40.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.91 110.91 0.00 0.00 0.9768 0.0000 9774839.05 9774839.05 0.00 90227.90 90227.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.02 35.19% 61801.49 48266 100664 61913.73 53911 77227 2411721 2411721 0.00
crit 45.16 40.72% 135165.60 96532 241592 135136.25 111137 170941 6104651 6104651 0.00
glance 26.58 23.96% 47351.17 36200 75498 47377.08 39664 61323 1258467 1258467 0.00
dodge 0.07 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.41 23.41 0.00 0.00 1.0794 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 251 0.0% 3.7 70.57sec 7744 0 4820 11502 7744 43.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.0000 0.0000 28922.42 28922.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.09 56.03% 4819.60 3652 6741 4235.06 0 6741 10085 10085 0.00
crit 1.64 43.85% 11502.33 7304 16178 9376.53 0 16178 18838 18838 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3651.90
  • base_dd_max:3651.90

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.15%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 25.5 2.6 16.9sec 15.3sec 8.44% 44.38%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.44%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.4 0.0 22.6sec 22.6sec 24.32% 26.45%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.6sec 125.6sec 17.37% 17.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.37%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.62% 41.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.62%

    Trigger Attempt Success

    • trigger_pct:99.44%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.9sec 9.9sec 15.00% 49.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.00%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 7.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.3 2.1 49.6sec 39.7sec 22.94% 52.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.94%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 56.7sec 56.5sec 17.18% 17.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.18%

    Trigger Attempt Success

    • trigger_pct:99.89%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.38% 75.27%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.4 0.0 180.0sec 180.0sec 19.35% 24.77%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:19.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.8 0.0 300.0sec 300.0sec 14.34% 14.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:14.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 19.4 58.2 3.0 3.0 293749.0
halo Mana 11.0 447372.7 40500.0 40499.8 6.2
mind_blast Mana 53.1 237669.8 4473.3 4473.3 55.5
mind_flay Mana 118.4 355282.0 3000.0 3000.0 53.6
mind_sear Mana 0.3 2634.1 9000.0 8999.6 10.0
shadow_word_death Mana 15.8 123566.4 7800.0 7800.4 35.2
shadow_word_pain Mana 77.2 1019495.7 13200.0 13199.9 29.4
vampiric_touch Mana 45.7 410874.8 9000.0 9000.0 37.3
Resource Gains Type Count Total Average Overflow
mindbender Mana 110.77 504849.52 (20.28%) 4557.80 75353.34 12.99%
Shadow Orbs from Mind Blast Shadow Orb 53.07 51.70 (86.63%) 0.97 1.37 2.58%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.98 7.98 (13.37%) 1.00 0.00 0.00%
Devouring Plague Health Health 254.80 0.00 (0.00%) 0.00 5418055.17 100.00%
Vampiric Touch Mana Mana 318.15 1479489.76 (59.44%) 4650.26 139465.40 8.61%
halo_heal Health 11.05 0.00 (0.00%) 0.00 3714350.41 100.00%
external_healing Health 86.28 0.00 (0.00%) 0.00 29522588.32 100.00%
mp5_regen Mana 1803.77 504668.28 (20.28%) 279.79 36462.34 6.74%
pet - mindbender
external_healing Health 31.49 0.00 (0.00%) 0.00 10974361.40 100.00%
Resource RPS-Gain RPS-Loss
Mana 5518.04 5757.22
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 192739.45 48347.62 300000.00
Shadow Orb 1.44 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.9%
shadowfiend-Mana Cap 6.9%
mindbender-Mana Cap 6.9%

Procs

Count Interval
Shadowy Recall Extra Tick 440.0 1.0sec
Shadowy Apparition Procced 224.7 2.0sec
Divine Insight Mind Blast CD Reset 47.6 15.3sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 280141.66
Minimum 242989.59
Maximum 324000.99
Spread ( max - min ) 81011.41
Range [ ( max - min ) / 2 * 100% ] 14.46%
Standard Deviation 9423.4107
5th Percentile 265057.88
95th Percentile 296171.61
( 95th Percentile - 5th Percentile ) 31113.73
Mean Distribution
Standard Deviation 59.6084
95.00% Confidence Intervall ( 280024.83 - 280258.49 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4346
0.1 Scale Factor Error with Delta=300 758053
0.05 Scale Factor Error with Delta=300 3032214
0.01 Scale Factor Error with Delta=300 75805358
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 280141.66
Minimum 242989.59
Maximum 324000.99
Spread ( max - min ) 81011.41
Range [ ( max - min ) / 2 * 100% ] 14.46%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 116480620.01
Minimum 82933296.19
Maximum 154426528.15
Spread ( max - min ) 71493231.95
Range [ ( max - min ) / 2 * 100% ] 30.69%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.92 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.86 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 4.25 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 56.90 mind_blast,if=active_enemies<=5&cooldown_react
I 7.98 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 37.91 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 35.79 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 10.71 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 13.43 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.18 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 11.05 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.17 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 19.04 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.29 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 118.43 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 28.61 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9LScHMZZZZZHZZZOZZHLZZZcccccHMQZZZZSHLLLMMMLHMZZZ9ccHMZZZZWHZZZOZHLQSZZLLLcHMMMMZZWHZZZOZHLZZZZL9cHMQSZZZZHLLLMMMMHLZZZcHcccMZZHQZZZZHOSNZWWHZZZL9HLLMMMNGHZZZZZZHMZZZZNcScccHOQZZZZHLLLMMMMHLZZZLH9MQZZWHSZZZONHZZZZWHQLLLcMHMHMZZZZWHQOZWWWWWWWWWHNSZZZccc9HMZZZHQLLLMMMHMNZZZccHcSOZHQZZZZHZZONZZHZZLLLH9LMMGHZSZIFWHNOQZZIFcccccHOIFQZZZHLIFLLHMHLGIFM8ScHMI9FQZHZZIFOZHLQHIFZZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 275108 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
275108.0 275108.0 115.57 / 0.04% 15292 / 5.6% 42.1 6004.1 5763.7 Mana 0.51% 49.3 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.93 5.23 6.45 4.67 3.31 4.39
Normalized 1.00 0.75 0.93 0.67 0.48 0.63
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.17 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=6.93, SpellDamage=5.23, HitRating=6.45, CritRating=4.67, HasteRating=3.31, MasteryRating=4.39 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=6.93, SpellDamage=5.23, HitRating=0.00, CritRating=4.67, HasteRating=3.31, MasteryRating=4.39 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:837979|360942|323588|256166|244117|199682|118369|60842&chds=0,1675958&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++837979++devouring_plague,9482C9,0,0,15|t++360942++shadow_word_pain,9482C9,1,0,15|t++323588++vampiric_touch,9482C9,2,0,15|t++256166++shadow_word_death,9482C9,3,0,15|t++244117++halo,9482C9,4,0,15|t++199682++mind_blast,9482C9,5,0,15|t++118369++mind_flay,9482C9,6,0,15|t++60842++mind_sear,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,13,10,9,9,8,8,6,6,5,5,4,4,3,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=mind_flay|shadow_word_pain|vampiric_touch|shadowy_apparition|mindbender: melee|mind_blast|essence_of_yulon|shadow_word_pain_mastery|mind_flay_mastery|devouring_plague_tick|vampiric_touch_mastery|shadow_word_death|multistrike_spell|devouring_plague|devouring_plague_mastery|halo_damage|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.93,6.45,5.23,4.67,4.39,3.31|6.77,6.28,5.07,4.51,4.23,3.15|7.09,6.62,5.39,4.83,4.56,3.47&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.93++Int,FFFFFF,0,0,15,0.1,e|t++++6.45++Hit,FFFFFF,0,1,15,0.1,e|t++++5.23++SP,FFFFFF,0,2,15,0.1,e|t++++4.67++Crit,FFFFFF,0,3,15,0.1,e|t++++4.39++Mastery,FFFFFF,0,4,15,0.1,e|t++++3.31++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.327& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:aeimqsuxz23565877752zwtqnmmkjiihhhffedbaaaabcdcdddccbaZZZaabbcccbabaaZZZaZaaZYYXXWVUUUUVWWXYZaaZaaaaaaaZaaYYXXVUTRRRRSTUWXZabbcdddegiknoooonmljihggfgfgfedaYYXXXXWXXXYXYXYXWVVVVXYZZabcdedeefefffffgedccbaZYXWVVUUVVVVVUUUUTTTUVXYYZZZYXXWWVVWXYabbcbbcccdefgghjjiihgfedccddddddeffeeeddddddddcbbaZYXWVVUVWWXYZaaaabbcddefghhhhhggfedddccbbbbaZZZYYXXXXXXYXXXXWVUUUTUVXYZaceggiijklnopqrqponmlkigffeddcccccbbbbbccdefgggghggggggggggggggffffffghhghhhhhhgggffffgggggghhghhhhhhhgghgfeecbaZZYYXYYZabccddefgjmopsttvvvvvutsrsrqpomlkihhhhggffffgffffeeeeeefffgghijihfdcaZYXVU&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.4937,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=275108|max=557259&chxp=1,1,49,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,6,6,20,35,63,104,131,257,370,435,664,876,1015,1272,1487,1573,1647,1781,1719,1646,1649,1452,1326,1169,945,749,632,501,402,318,223,131,136,71,60,45,25,19,12,7,3,4,2,0,0,1,0,0,1&chds=0,1781&chbh=5&chxt=x&chxl=0:|min=243196|avg=275108|max=324371&chxp=0,1,39,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:41.0,19.6,11.7,10.1,3.8,3.5,2.6,1.9,0.2,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 184.7s|shadow_word_pain 88.4s|vampiric_touch 52.7s|mind_blast 45.4s|shadow_word_death 17.1s|devouring_plague 15.6s|halo 11.8s|mindbender 8.5s|mind_sear 0.8s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 275108
devouring_plague 8709 (28958) 3.2% (10.5%) 14.5 30.87sec 898474 837979 184277 398458 270113 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.54 14.54 0.00 0.00 1.0722 0.0000 3927009.04 3927009.04 0.00 837979.11 837979.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.68 59.67% 184277.29 161639 307820 184289.96 161639 252656 1598633 1598633 0.00
crit 5.84 40.19% 398457.51 336788 769642 398518.18 0 625930 2328376 2328376 0.00
miss 0.02 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6679 2.4% 59.0 7.22sec 51067 0 31015 81074 51153 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.02 58.92 0.00 0.00 0.0000 0.0000 3013819.99 3013819.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.09 59.56% 31015.39 26940 51304 31026.11 27262 37932 1088414 1088414 0.00
crit 23.75 40.31% 81074.23 67809 159064 81064.40 68763 109714 1925406 1925406 0.00
miss 0.08 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13570 4.9% 14.5 30.87sec 421062 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.0 30911 66766 45342 40.2% 0.0% 18.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.54 14.54 135.01 135.01 0.0000 0.6324 6121589.32 6121589.32 0.00 71694.81 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.7 59.75% 30911.49 26940 159542 30927.91 27423 91350 2493791 2493791 0.00
crit 54.3 40.25% 66766.00 56133 374049 66745.66 57318 199084 3627799 3627799 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19300 7.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 159.4 24369 53514 36082 40.3% 0.1% 28.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.74 159.35 241.40 0.0000 0.7946 8710072.69 8710072.69 0.00 68791.79 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.0 59.66% 24369.36 21101 40897 24374.51 22282 27749 3509366 3509366 0.00
crit 97.2 40.26% 53513.62 43965 102254 53513.51 47247 64223 5200706 5200706 0.00
miss 0.2 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6381) 0.0% (2.3%) 11.1 42.24sec 259529 244117 0 0 0 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.09 0.00 0.00 1.0631 0.0000 0.00 0.00 0.00 244117.28 244117.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.65 59.96% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.42 39.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6381 2.3% 11.1 42.24sec 259529 0 173039 372432 252466 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.40 0.00 0.00 0.0000 0.0000 2876922.20 2876922.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.83 59.92% 173039.10 153853 275756 173070.75 0 256624 1181449 1181449 0.00
crit 4.55 39.95% 372432.00 320566 689472 371131.12 0 655612 1695473 1695473 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 20118 7.3% 37.7 11.96sec 240334 199682 164512 355892 240336 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.73 37.73 0.00 0.00 1.2036 0.0000 9068570.62 9068570.62 0.00 199682.28 199682.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.69 60.14% 164511.83 129332 396163 164401.98 132833 204516 3733004 3733004 0.00
crit 14.99 39.73% 355892.23 269474 990526 355852.98 273852 500520 5335567 5335567 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 32568 (48580) 11.8% (17.6%) 126.1 3.50sec 173327 118369 0 0 0 0.0% 0.1% 0.0% 0.0% 244.3 40260 88709 59991 40.7% 0.0% 32.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.15 126.15 244.35 244.35 1.4643 0.6051 14658757.88 14658757.88 0.00 118368.89 118368.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.99 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.16 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.8 59.27% 40260.14 34279 65277 40287.64 37187 44993 5831149 5831149 0.00
crit 99.5 40.73% 88708.86 71424 163211 88763.50 79135 101600 8827609 8827609 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 16012 5.8% 106.7 4.10sec 67526 0 40215 107545 67565 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.72 106.66 0.00 0.00 0.0000 0.0000 7206225.99 7206225.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.11 59.17% 40214.83 34279 65277 40241.82 36252 45248 2537983 2537983 0.00
crit 43.41 40.70% 107545.06 86282 202384 107607.36 93018 138392 4668243 4668243 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 104 0.0% 0.5 145.30sec 94617 60842 0 0 0 0.0% 0.2% 0.0% 0.0% 1.0 23355 49993 34190 40.8% 0.1% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.50 0.50 1.00 1.39 1.5562 0.6536 47395.58 47395.58 0.00 60841.57 60841.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.50 99.82% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.18% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 59.13% 23354.84 20175 36908 8668.76 0 35810 19145 19145 0.00
crit 0.6 40.76% 49992.53 42035 74613 15876.98 0 74613 28251 28251 0.00
miss 0.0 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 50 0.0% 0.6 43.81sec 38187 0 23368 60415 38185 40.1% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.60 0.60 0.00 0.00 0.0000 0.0000 22968.32 22968.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.36 59.76% 23368.19 20175 35810 5472.64 0 35810 8400 8400 0.00
crit 0.24 40.09% 60415.08 50780 90134 10945.85 0 90134 14568 14568 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (50) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.91 7.91 0.00 0.00 1.0722 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 9379 3.4% 226.3 2.02sec 18679 0 18680 0 18680 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.34 226.34 0.00 0.00 0.0000 0.0000 4227905.21 4227905.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 226.34 100.00% 18679.77 7034 371987 18694.59 14165 25370 4227905 4227905 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:31335.47
  • base_dd_max:31335.47
power_infusion 0 0.0% 4.3 120.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9750 3.5% 16.0 4.68sec 275046 256166 187809 405222 275048 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.97 15.97 0.00 0.00 1.0738 0.0000 4392729.94 4392729.94 0.00 256165.73 256165.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.52 59.62% 187808.76 145361 446332 188065.12 145361 283842 1788411 1788411 0.00
crit 6.43 40.24% 405222.27 302873 1115962 405897.94 0 893572 2604318 2604318 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32430 (70693) 11.8% (25.7%) 82.5 5.44sec 386347 360942 0 0 0 0.0% 0.1% 0.0% 0.0% 411.6 24252 52468 35545 40.0% 0.0% 136.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.55 82.55 411.59 411.59 1.0704 1.4967 14630020.48 14630020.48 0.00 45274.29 360942.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.47 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 246.9 59.98% 24251.84 21342 40629 24259.79 22540 26630 5986754 5986754 0.00
crit 164.7 40.02% 52468.05 44467 101583 52474.70 47955 59137 8643266 8643266 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15996 5.8% 179.8 2.49sec 40136 0 24322 63936 40169 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.79 179.64 0.00 0.00 0.0000 0.0000 7215896.12 7215896.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.41 59.79% 24322.08 21342 40629 24326.83 22561 26664 2612342 2612342 0.00
crit 72.00 40.08% 63936.26 53717 125965 63951.89 57366 73358 4603554 4603554 0.00
miss 0.23 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 22267 8.1% 236.7 1.89sec 42433 0 29071 63230 42851 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 236.73 234.42 0.00 0.00 0.0000 0.0000 10045156.14 10045156.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.85 59.66% 29071.19 25217 48441 29073.34 26852 32172 4065609 4065609 0.00
crit 94.57 40.34% 63230.32 52542 121116 63230.84 57340 72301 5979547 5979547 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2119 0.8% 5.0 62.15sec 186387 0 111680 280962 186383 44.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.05 5.05 0.00 0.00 0.0000 0.0000 940421.60 940421.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.81 55.67% 111679.97 79124 153360 106187.24 0 153360 313691 313691 0.00
crit 2.23 44.21% 280962.10 164861 383445 252483.49 0 383445 626731 626731 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 25464 (37813) 9.3% (13.7%) 48.9 9.14sec 348637 323588 0 0 0 0.0% 0.1% 0.0% 0.0% 241.9 32099 70030 47451 40.5% 0.0% 97.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.89 48.89 241.93 241.93 1.0774 1.8215 11479968.87 11479968.87 0.00 34552.75 323587.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.85 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.0 59.52% 32098.69 27457 53135 32112.94 29453 36185 4622495 4622495 0.00
crit 97.9 40.48% 70029.68 57209 132854 70046.55 62277 80476 6857474 6857474 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12349 4.5% 105.7 4.17sec 52684 0 31764 83811 52727 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.66 105.57 0.00 0.00 0.0000 0.0000 5566629.82 5566629.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.83 59.52% 31763.51 27457 53135 31773.16 28670 35963 1995817 1995817 0.00
crit 42.61 40.36% 83810.60 69110 164741 83844.84 73641 104767 3570813 3570813 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 84417 / 21864
melee 84169 7.9% 110.8 3.95sec 88509 90614 62091 135504 88509 40.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.85 110.85 0.00 0.00 0.9768 0.0000 9810994.20 9810994.20 0.00 90614.33 90614.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.81 35.02% 62091.32 48266 100664 62214.15 54017 78470 2409987 2409987 0.00
crit 45.27 40.84% 135504.04 96532 241592 135458.11 111205 169787 6134571 6134571 0.00
glance 26.62 24.02% 47574.42 36200 75498 47594.58 39790 60827 1266435 1266435 0.00
dodge 0.07 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.40 23.40 0.00 0.00 1.0622 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 249 0.0% 3.7 67.45sec 7761 0 4848 11562 7761 43.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 3.69 0.00 0.00 0.0000 0.0000 28602.51 28602.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.08 56.40% 4847.81 3652 6741 4250.75 0 6741 10076 10076 0.00
crit 1.60 43.48% 11561.69 7304 16178 9262.34 0 16178 18526 18526 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3651.90
  • base_dd_max:3651.90

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.5 0.0 30.8sec 30.8sec 25.74% 21.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 126.5sec 126.5sec 17.31% 17.31%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.31%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.57% 41.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.57%

    Trigger Attempt Success

    • trigger_pct:99.44%
power_infusion 4.3 0.0 120.9sec 120.9sec 18.61% 18.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.8sec 9.8sec 15.13% 49.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.13%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 8.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.3 2.1 49.6sec 39.6sec 22.95% 43.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.95%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.7 0.0 58.1sec 58.0sec 16.85% 16.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.85%

    Trigger Attempt Success

    • trigger_pct:99.90%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.38% 75.28%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.2 0.0 180.0sec 180.0sec 17.98% 23.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:17.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.7 0.0 300.0sec 300.0sec 14.05% 14.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:14.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 14.5 43.6 3.0 3.0 299775.2
halo Mana 11.1 419207.7 37817.2 37816.9 6.9
mind_blast Mana 37.7 326906.9 8663.6 8663.6 27.7
mind_flay Mana 126.1 362646.0 2874.8 2874.8 60.3
mind_sear Mana 0.5 4507.7 8998.1 8998.8 10.5
shadow_word_death Mana 16.0 120014.5 7514.2 7514.6 36.6
shadow_word_pain Mana 82.5 1052479.7 12750.5 12750.4 30.3
vampiric_touch Mana 48.9 422483.3 8640.6 8640.6 40.3
Resource Gains Type Count Total Average Overflow
mindbender Mana 110.71 504124.35 (19.39%) 4553.71 75766.31 13.07%
Shadow Orbs from Mind Blast Shadow Orb 37.68 36.88 (82.09%) 0.98 0.80 2.12%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.05 8.05 (17.91%) 1.00 0.00 0.00%
Devouring Plague Health Health 193.94 0.00 (0.00%) 0.00 4123947.17 100.00%
Vampiric Touch Mana Mana 347.51 1592825.85 (61.27%) 4583.58 175490.31 9.92%
halo_heal Health 11.09 0.00 (0.00%) 0.00 3725467.89 100.00%
external_healing Health 86.24 0.00 (0.00%) 0.00 29492906.33 100.00%
mp5_regen Mana 1803.77 502884.95 (19.34%) 278.80 38245.68 7.07%
pet - mindbender
external_healing Health 31.56 0.00 (0.00%) 0.00 11003198.82 100.00%
Resource RPS-Gain RPS-Loss
Mana 5763.74 6004.08
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 193105.34 14420.95 300000.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 7.1%
shadowfiend-Mana Cap 7.1%
mindbender-Mana Cap 7.1%

Procs

Count Interval
Shadowy Recall Extra Tick 451.4 1.0sec
Shadowy Apparition Procced 236.7 1.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 275108.03
Minimum 243195.76
Maximum 324370.93
Spread ( max - min ) 81175.18
Range [ ( max - min ) / 2 * 100% ] 14.75%
Standard Deviation 9321.9291
5th Percentile 260449.30
95th Percentile 291033.72
( 95th Percentile - 5th Percentile ) 30584.42
Mean Distribution
Standard Deviation 58.9665
95.00% Confidence Intervall ( 274992.46 - 275223.60 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4410
0.1 Scale Factor Error with Delta=300 741814
0.05 Scale Factor Error with Delta=300 2967257
0.01 Scale Factor Error with Delta=300 74181439
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 275108.03
Minimum 243195.76
Maximum 324370.93
Spread ( max - min ) 81175.18
Range [ ( max - min ) / 2 * 100% ] 14.75%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 114152059.82
Minimum 83242698.14
Maximum 161017213.90
Spread ( max - min ) 77774515.76
Range [ ( max - min ) / 2 * 100% ] 34.07%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.91 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 4.30 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.92 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.66 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 8.05 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 36.55 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 38.54 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 11.74 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 13.97 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.88 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 11.09 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.12 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 8.00 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.50 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 126.15 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 34.26 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9BLScHMZZZZZHZZZZOZHLQZZZZccccHMZZZZZSHLLLMMMLMHQZZ9ccHMZZZZWHZZZOZHLSZZLLLccHMMMMQZZHZZOZNZHZZZBL9cHMQSZZZZHLLLMMMMLHZZZcccccHOQZZZZWHZZSOZNHZZZZLL9HLMMMNZZHQZZOZZHZZSNcccHOZZZZWHLLLMMMONHQZZZLBcc9HMZSZZZWHZZZZNOWHQZZZLLLccHMMMZZZZHZZZSONZHQZZZccc9HMZZZZLHLLMMMMLWHQZZSccccHOZZZZWWHZZZOZNHQZZZLLBLH9LMMZSZHZZIFLZOHQZIFZccccHVIFOQZZWHLIFLLMMMHLIFMQ8SccH9IFZOZWHZIFQZZHLOIFZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 273924 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
273924.0 273924.0 108.78 / 0.04% 14391 / 5.3% 40.4 6232.1 5836.4 Mana 0.46% 48.3 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.99 5.29 6.48 4.61 2.81 4.35
Normalized 1.00 0.76 0.93 0.66 0.40 0.62
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.15 0.15 0.16 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=6.99, SpellDamage=5.29, HitRating=6.48, CritRating=4.61, HasteRating=2.81, MasteryRating=4.35 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=6.99, SpellDamage=5.29, HitRating=0.00, CritRating=4.61, HasteRating=2.81, MasteryRating=4.35 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:860591|357246|308887|289527|247357|203164|115316|73903&chds=0,1721181&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++860591++devouring_plague,9482C9,0,0,15|t++357246++shadow_word_pain,9482C9,1,0,15|t++308887++vampiric_touch,9482C9,2,0,15|t++289527++shadow_word_death,9482C9,3,0,15|t++247357++halo,9482C9,4,0,15|t++203164++mind_blast,9482C9,5,0,15|t++115316++mind_flay,9482C9,6,0,15|t++73903++mind_sear,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,12,10,9,9,8,8,6,6,5,5,4,4,4,3,3,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|mind_flay|vampiric_touch|shadowy_apparition|mindbender: melee|mind_blast|essence_of_yulon|shadow_word_pain_mastery|mind_flay_mastery|devouring_plague_tick|vampiric_touch_mastery|shadow_word_death|multistrike_spell|devouring_plague|devouring_plague_mastery|halo_damage|stormlash|mindbender: stormlash|mind_sear|mind_sear_mastery&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.99,6.48,5.29,4.61,4.35,2.81|6.84,6.32,5.13,4.46,4.20,2.66|7.14,6.63,5.44,4.77,4.51,2.97&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.99++Int,FFFFFF,0,0,15,0.1,e|t++++6.48++Hit,FFFFFF,0,1,15,0.1,e|t++++5.29++SP,FFFFFF,0,2,15,0.1,e|t++++4.61++Crit,FFFFFF,0,3,15,0.1,e|t++++4.35++Mastery,FFFFFF,0,4,15,0.1,e|t++++2.81++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.397& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cglqtvxz13457677541xvrokhihiiiklmonnonnmnnoorrrqpolkhffeeeegghhhffgfffffgfghhggfedccbccddefgghhgfffeeeeeeedccbaYXVVVVXYZacdfffgghhijlnqssrrrqpnmlkkjjkkkjigeedcccccddfeeeeddcbbcefghhijlllmmmmnnnnoomlkjjigfdccbbbbbccbaaZZYYYZadeefffedcbbabbcdefggfefggghijkkmmmmmlkjiiijjjkllmnnmnmmmmmmmlnlkjjhgfeddcdeefghjjijkklmnoprtttttsrrqpopnnmmmmljjiihhhgggghhhhhgeedccdefhhjlnooqrssuwxxz0zzyxxwusqppponnnoponnnnoopqruvvvwwwvvvvuvvvvvvvvtstttsuvvuvwvvvvuuuttttuuvvvvwwvwwwwwwwvvwuttspnmlkjiihiijklllnnopsvxy0235677776533210zzyyxwxwvutssssuttuttssrrrsssttvwxxuspmkjhfdb&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6185,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=273924|max=442880&chxp=1,1,62,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,3,2,5,26,44,71,104,145,224,331,443,584,761,906,1061,1275,1384,1530,1629,1606,1553,1531,1472,1379,1198,1115,954,777,698,550,404,323,267,163,135,95,66,63,39,24,24,8,8,4,2,2,0,1&chds=0,1629&chbh=5&chxt=x&chxl=0:|min=242010|avg=273924|max=313022&chxp=0,1,45,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:40.7,19.7,11.6,10.2,3.8,3.4,2.6,1.9,0.1,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 183.5s|shadow_word_pain 89.0s|vampiric_touch 52.5s|mind_blast 45.9s|shadow_word_death 17.2s|devouring_plague 15.5s|halo 11.9s|mindbender 8.6s|mind_sear 0.3s|waiting 2.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 273924
devouring_plague 9061 (29586) 3.3% (10.8%) 14.4 30.27sec 927949 860591 194269 419558 284139 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 14.39 0.00 0.00 1.0783 0.0000 4088694.39 4088694.39 0.00 860590.72 860590.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.62 59.87% 194269.15 161639 337137 194253.29 161639 258781 1673664 1673664 0.00
crit 5.76 40.00% 419557.81 336788 842941 419505.77 0 702451 2415031 2415031 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6809 2.5% 57.1 7.23sec 53792 0 32750 85335 53882 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.13 57.04 0.00 0.00 0.0000 0.0000 3073245.04 3073245.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.00 59.60% 32750.20 26940 56190 32769.57 28023 39273 1113410 1113410 0.00
crit 22.97 40.27% 85334.62 67809 174213 85331.86 70063 108412 1959835 1959835 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13715 5.0% 14.4 30.27sec 430237 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.8 32383 69647 47328 40.1% 0.0% 18.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 14.39 130.81 130.81 0.0000 0.6494 6190986.18 6190986.18 0.00 72878.86 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.3 59.89% 32383.37 26940 124290 32396.40 28516 63898 2537188 2537188 0.00
crit 52.5 40.11% 69646.74 56133 284525 69623.39 58988 141079 3653798 3653798 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19495 7.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 152.8 25353 55418 37425 40.2% 0.1% 26.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.38 152.79 234.95 0.0000 0.7946 8793047.80 8793047.80 0.00 72428.59 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.3 59.69% 25353.06 21101 44792 25357.33 22640 29760 3555796 3555796 0.00
crit 94.5 40.22% 55418.19 43965 111993 55402.53 49111 66794 5237252 5237252 0.00
miss 0.2 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6536) 0.0% (2.4%) 11.1 42.25sec 265730 247357 0 0 0 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.09 0.00 0.00 1.0743 0.0000 0.00 0.00 0.00 247357.45 247357.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.66 60.04% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.42 39.83% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6536 2.4% 11.1 42.25sec 265730 0 178295 383920 260392 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.31 0.00 0.00 0.0000 0.0000 2946274.57 2946274.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.77 59.84% 178295.19 153853 302019 178248.50 153853 235121 1207161 1207161 0.00
crit 4.53 40.04% 383919.55 320566 755136 382145.22 0 739835 1739114 1739114 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 20659 7.5% 37.4 12.06sec 249189 203164 170964 368619 249192 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.40 37.40 0.00 0.00 1.2266 0.0000 9319555.05 9319555.05 0.00 203164.35 203164.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.51 60.18% 170963.70 129332 433893 170817.98 141214 212127 3847963 3847963 0.00
crit 14.84 39.69% 368618.90 269474 1084861 368452.08 277558 529681 5471592 5471592 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 31533 (47003) 11.5% (17.1%) 124.4 3.54sec 170038 115316 0 0 0 0.0% 0.1% 0.0% 0.0% 233.9 40935 89629 60693 40.6% 0.0% 32.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.44 124.44 233.90 233.90 1.4745 0.6312 14196106.55 14196106.55 0.00 115316.05 115316.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.29 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.16 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.0 59.42% 40934.91 34279 71493 40956.30 37835 45946 5689722 5689722 0.00
crit 94.9 40.58% 89628.83 71424 178754 89672.26 79185 101212 8506385 8506385 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 15470 5.6% 102.1 4.28sec 68178 0 40896 108483 68213 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.14 102.09 0.00 0.00 0.0000 0.0000 6963927.06 6963927.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.62 59.38% 40896.33 34279 71493 40915.92 36851 46637 2479060 2479060 0.00
crit 41.34 40.50% 108482.70 86282 221659 108532.31 94253 131066 4484867 4484867 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 55 0.0% 0.2 135.96sec 111571 73903 0 0 0 0.0% 0.1% 0.0% 0.0% 0.5 23163 48968 33311 39.4% 0.1% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.23 0.23 0.45 0.76 1.5127 0.6318 25200.80 25200.80 0.00 73902.63 73902.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.23 99.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.5 60.53% 23162.75 20175 40162 4224.94 0 40162 10607 10607 0.00
crit 0.3 39.40% 48967.98 42035 83681 7351.27 0 83681 14594 14594 0.00
miss 0.0 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 27 0.0% 0.3 21.52sec 37272 0 23110 59284 37272 39.3% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.33 0.33 0.00 0.00 0.0000 0.0000 12293.23 12293.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.20 60.57% 23110.28 20175 40162 2771.50 0 40162 4617 4617 0.00
crit 0.13 39.26% 59283.88 50780 101089 5374.24 0 101089 7676 7676 0.00
miss 0.00 0.17% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (27) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.91 7.91 0.00 0.00 1.0876 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 9392 3.4% 217.9 2.10sec 19436 0 19436 0 19436 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 217.85 217.85 0.00 0.00 0.0000 0.0000 4234155.19 4234155.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 217.85 100.00% 19435.98 7034 407415 19449.29 14767 26962 4234155 4234155 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:32215.34
  • base_dd_max:32215.34
shadow_word_death 11080 4.0% 15.9 4.69sec 313214 289527 213893 460615 313208 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.94 15.94 0.00 0.00 1.0818 0.0000 4992021.07 4992021.07 0.00 289526.80 289526.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.48 59.49% 213893.13 167166 488840 214168.77 167166 339941 2028137 2028137 0.00
crit 6.43 40.37% 460614.68 348304 1222245 461167.66 0 995972 2963884 2963884 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32340 (70454) 11.8% (25.7%) 82.6 5.43sec 384925 357246 0 0 0 0.0% 0.1% 0.0% 0.0% 397.9 25037 54128 36675 40.0% 0.0% 136.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.58 82.58 397.88 397.88 1.0775 1.5430 14592221.22 14592221.22 0.00 45224.73 357246.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.51 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 238.7 59.99% 25037.42 21342 44498 25042.20 23288 27817 5976624 5976624 0.00
crit 159.2 40.01% 54127.65 44467 111258 54128.67 49033 61281 8615597 8615597 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15955 5.8% 173.8 2.57sec 41406 0 25148 65947 41440 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.85 173.71 0.00 0.00 0.0000 0.0000 7198430.74 7198430.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.99 59.86% 25147.88 21342 44498 25151.83 23155 27893 2615102 2615102 0.00
crit 69.50 40.01% 65946.89 53717 137962 65960.58 59636 75320 4583329 4583329 0.00
miss 0.22 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 22159 8.1% 228.7 1.95sec 43724 0 30024 65145 44151 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 228.66 226.46 0.00 0.00 0.0000 0.0000 9998169.47 9998169.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.37 59.78% 30023.94 25217 53054 30025.82 27827 33070 4064372 4064372 0.00
crit 91.09 40.22% 65145.39 52542 132651 65145.80 59001 74005 5933798 5933798 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1886 0.7% 4.6 68.04sec 179963 0 109346 270538 179975 43.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.64 4.64 0.00 0.00 0.0000 0.0000 835784.54 835784.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.60 55.97% 109345.91 79124 158839 102727.97 0 158839 284232 284232 0.00
crit 2.04 43.90% 270537.97 164861 365186 238195.38 0 365186 551553 551553 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:110260.80
  • base_dd_max:110260.80
vampiric_touch 24125 (35974) 8.8% (13.1%) 48.4 9.22sec 335084 308887 0 0 0 0.0% 0.1% 0.0% 0.0% 227.0 32606 70678 47935 40.3% 0.0% 96.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.41 48.41 226.95 226.95 1.0848 1.9122 10878761.27 10878761.27 0.00 33341.39 308887.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.37 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.6 59.74% 32606.41 27457 58196 32614.79 29881 36044 4420618 4420618 0.00
crit 91.4 40.26% 70677.60 57209 145506 70682.85 63043 81120 6458143 6458143 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11850 4.3% 99.2 4.45sec 53863 0 32665 85661 53905 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.17 99.09 0.00 0.00 0.0000 0.0000 5341527.04 5341527.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.17 59.72% 32665.05 27457 58196 32673.20 29722 36472 1932942 1932942 0.00
crit 39.79 40.16% 85661.32 69110 180431 85686.39 74818 100280 3408585 3408585 0.00
miss 0.12 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 84129 / 21777
melee 83897 7.9% 110.8 3.96sec 88229 90329 61930 135067 88229 40.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.79 110.79 0.00 0.00 0.9768 0.0000 9775261.64 9775261.64 0.00 90328.52 90328.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.85 35.06% 61929.91 48266 100664 62045.78 53256 77319 2405920 2405920 0.00
crit 45.22 40.82% 135067.23 96532 241592 135021.27 111793 170631 6108189 6108189 0.00
glance 26.58 23.99% 47448.15 36200 75498 47474.85 39362 59324 1261152 1261152 0.00
dodge 0.07 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 1.0794 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 232 0.0% 3.4 60.83sec 7962 0 4923 11811 7962 44.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.35 3.35 0.00 0.00 0.0000 0.0000 26680.79 26680.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.87 55.66% 4922.59 3652 6741 4146.70 0 6741 9181 9181 0.00
crit 1.48 44.21% 11811.41 7304 16178 9164.83 0 16178 17500 17500 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3803.10
  • base_dd_max:3803.10

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.4 0.0 30.3sec 30.3sec 24.86% 21.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 126.7sec 126.7sec 17.17% 17.17%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.17%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.5sec 41.64% 41.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.64%

    Trigger Attempt Success

    • trigger_pct:99.45%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.8sec 9.8sec 15.10% 49.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.10%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 8.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.3 2.1 49.5sec 39.7sec 22.96% 52.99%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.96%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.6 0.0 58.5sec 58.4sec 16.67% 16.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.67%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 315.0 0.0sec 0.5sec 32.34% 32.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.38% 75.28%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.2 0.0 180.0sec 180.0sec 17.72% 23.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:17.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.6 0.0 300.0sec 300.0sec 12.74% 12.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:12.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 14.4 43.1 3.0 3.0 309578.5
halo Mana 11.1 449036.5 40500.0 40499.5 6.6
mind_blast Mana 37.4 336593.9 9000.0 8999.9 27.7
mind_flay Mana 124.4 373329.4 3000.0 3000.0 56.7
mind_sear Mana 0.2 2032.9 9000.0 9000.3 12.4
shadow_word_death Mana 15.9 124323.3 7800.0 7800.4 40.2
shadow_word_pain Mana 82.6 1090101.4 13200.0 13199.8 29.2
vampiric_touch Mana 48.4 435659.0 9000.0 9000.0 37.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 110.65 536631.88 (20.38%) 4849.67 42980.33 7.42%
Shadow Orbs from Mind Blast Shadow Orb 37.35 36.49 (81.96%) 0.98 0.86 2.32%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.03 8.03 (18.04%) 1.00 0.00 0.00%
Devouring Plague Health Health 187.85 0.00 (0.00%) 0.00 3994506.09 100.00%
Vampiric Touch Mana Mana 326.04 1575837.44 (59.86%) 4833.22 83146.72 5.01%
halo_heal Health 11.09 0.00 (0.00%) 0.00 3905921.27 100.00%
external_healing Health 86.24 0.00 (0.00%) 0.00 29323363.09 100.00%
mp5_regen Mana 1803.77 520157.14 (19.76%) 288.37 20973.49 3.88%
pet - mindbender
external_healing Health 31.63 0.00 (0.00%) 0.00 11032756.08 100.00%
Resource RPS-Gain RPS-Loss
Mana 5836.44 6232.05
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 122244.00 -91166.67 300000.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.0%
shadowfiend-Mana Cap 4.0%
mindbender-Mana Cap 4.0%

Procs

Count Interval
Shadowy Recall Extra Tick 432.3 1.0sec
Shadowy Apparition Procced 228.7 2.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 273923.99
Minimum 242010.06
Maximum 313022.04
Spread ( max - min ) 71011.98
Range [ ( max - min ) / 2 * 100% ] 12.96%
Standard Deviation 8774.2936
5th Percentile 259983.73
95th Percentile 288766.36
( 95th Percentile - 5th Percentile ) 28782.63
Mean Distribution
Standard Deviation 55.5024
95.00% Confidence Intervall ( 273815.21 - 274032.77 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3941
0.1 Scale Factor Error with Delta=300 657215
0.05 Scale Factor Error with Delta=300 2628863
0.01 Scale Factor Error with Delta=300 65721580
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 273923.99
Minimum 242010.06
Maximum 313022.04
Spread ( max - min ) 71011.98
Range [ ( max - min ) / 2 * 100% ] 12.96%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 113680401.20
Minimum 83245841.63
Maximum 148787461.83
Spread ( max - min ) 65541620.19
Range [ ( max - min ) / 2 * 100% ] 28.83%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.91 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.91 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.80 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.13 mind_blast,if=active_enemies<=5&cooldown_react
I 8.03 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 37.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 39.17 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 10.93 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 13.20 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.59 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 11.09 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.16 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 6.67 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.23 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 124.44 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 34.33 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9LScHMZZZZZHZZZOZZHLZZZZcccccHMQZZZSWHLLLMMMMHLZZZ9ccHOZZZZWHZZZOZHLQSZZLLLcHMMMMZZZHZZZZOZHLZZZL9cHMQSZZZHLLLMMMMNHZZZccccHOQZZZZHZZSONZHZZZZLL9HLMMMNZZHQZZZZOWHZZZNSccccHOZZZZWLHLLMMMNGMHZZLcc9HMZZSZZHQZZOZNHZZZLLLcHMMMMZZZHZZZOZNHQSZZcccH9MZZZZHLLLMMMMLHQZZZccccHOSZZZZWHZZZZOZHNZZZLLLHL9MMQZZHZSIFNOWHZZZIFQccccHOIFZZZHLIFLLMLHMGIFS8ZcccHI9FMQZZHZIFZZNHMGIFZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 281282 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
281282.0 281282.0 123.80 / 0.04% 16335 / 5.8% 48.5 5627.0 4905.1 Mana 0.50% 48.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.06 5.22 6.85 4.46 6.25 4.68
Normalized 1.00 0.74 0.97 0.63 0.89 0.66
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Int > Hit > Haste > SP > Mastery > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.06, SpellDamage=5.22, HitRating=6.85, CritRating=4.46, HasteRating=6.25, MasteryRating=4.68 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.06, SpellDamage=5.22, HitRating=0.00, CritRating=4.46, HasteRating=6.25, MasteryRating=4.68 )

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:815372|348039|314029|253082|250203|221018|202780|114108|79198&chds=0,1630744&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++815372++devouring_plague,9482C9,0,0,15|t++348039++shadow_word_pain,9482C9,1,0,15|t++314029++vampiric_touch,9482C9,2,0,15|t++253082++shadow_word_death,9482C9,3,0,15|t++250203++halo,9482C9,4,0,15|t++221018++mind_blast,9482C9,5,0,15|t++202780++mind_flay_insanity,9482C9,6,0,15|t++114108++mind_flay,9482C9,7,0,15|t++79198++mind_sear,9482C9,8,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,11,9,8,8,7,7,6,5,4,4,4,4,3,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|mind_flay_insanity|vampiric_touch|essence_of_yulon|shadowy_apparition|mind_flay|devouring_plague_tick|shadow_word_pain_mastery|devouring_plague|mind_flay_insanity_mastery|multistrike_spell|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|devouring_plague_mastery|shadowfiend: melee|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.06,6.85,6.25,5.22,4.68,4.46|6.88,6.67,6.08,5.04,4.50,4.29|7.23,7.02,6.42,5.39,4.85,4.63&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.06++Int,FFFFFF,0,0,15,0.1,e|t++++6.85++Hit,FFFFFF,0,1,15,0.1,e|t++++6.25++Haste,FFFFFF,0,2,15,0.1,e|t++++5.22++SP,FFFFFF,0,3,15,0.1,e|t++++4.68++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.46++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.477& http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bgjmpqtvy02466676530xusrpqppooooopoonnmmmnopqqqqqqonmkjihhgggffedcbbaaabbbcdcdddccccdefgghiijjjjjjjjjjkjiihggfdcaZYXXXXXYYZZZZaaabdfhjloopqrrrqppppooonnmlkihhgfeeeffgffffedcccdefgijklmnmnnnnnoppponmkjihfdccccbccccccbcccccdefhiiijjigfeedddcddcccbaaaZZacddegghhhhggghijklmnnoopppppoppppoommlkihgfedddddddeeedddddeghijkkklllkkjjiiiiiiihhgfffeeeeeffgggggfdcbabcdefghikmmmnnnprsttuttsrqpomkkkkjkkkkllkkllllmnoqqqrrrqppoooonnnmmmlkjjjiijkkkklkllllkkkkllmmnnooppppppppppppppooomkihggffffffggggggghilnoprrsttttsssssssssrrrrqqqqqqqqqqrrrrrpoonmnoopppppqqomkigfecaZ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5936,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=281282|max=473860&chxp=1,1,59,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,4,6,13,28,47,70,108,169,244,336,469,651,813,1047,1124,1341,1473,1559,1641,1589,1704,1614,1388,1373,1140,1015,868,715,597,447,383,276,195,168,120,79,54,44,14,17,16,6,11,5,2,1,2,0,2&chds=0,1704&chbh=5&chxt=x&chxl=0:|min=246658|avg=281282|max=328992&chxp=0,1,42,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:24.2,18.2,17.5,13.0,10.0,4.6,3.8,2.5,0.7,0.1,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 109.2s|shadow_word_pain 82.3s|mind_flay_insanity 79.0s|mind_blast 58.5s|vampiric_touch 45.1s|devouring_plague 20.5s|shadow_word_death 16.9s|halo 11.1s|shadowfiend 3.3s|mind_sear 0.5s|waiting 2.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 281282
devouring_plague 11319 (37121) 4.0% (13.2%) 19.0 23.03sec 879336 815372 182879 395386 268050 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.05 19.05 0.00 0.00 1.0785 0.0000 5105187.99 5105187.99 0.00 815371.86 815371.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.37 59.70% 182878.67 161639 293162 182879.52 161639 227062 2079454 2079454 0.00
crit 7.65 40.18% 395386.26 336788 732992 395590.07 0 578333 3025734 3025734 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8506 3.0% 76.1 5.55sec 50410 0 30673 79993 50482 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.14 76.03 0.00 0.00 0.0000 0.0000 3838040.92 3838040.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.35 59.65% 30673.34 26940 48861 30682.11 27446 35216 1391003 1391003 0.00
crit 30.59 40.24% 79992.56 67809 151489 79974.89 68426 97091 2447038 2447038 0.00
miss 0.09 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17297 6.2% 19.0 23.03sec 409774 0 0 0 0 0.0% 0.0% 0.0% 0.0% 174.2 30595 65911 44805 40.2% 0.0% 25.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.05 19.05 174.19 174.19 0.0000 0.6492 7804509.07 7804509.07 0.00 69018.20 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.1 59.76% 30594.61 26940 104036 30608.75 27280 72159 3185004 3185004 0.00
crit 70.1 40.24% 65910.95 56133 216766 65897.19 57884 152532 4619505 4619505 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20978 7.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 162.8 24187 52734 35680 40.3% 0.1% 28.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 33.74 162.79 265.09 0.0000 0.7927 9458456.86 9458456.86 0.00 73293.53 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 158.0 59.60% 24186.77 21101 38949 24195.23 22043 27511 3821538 3821538 0.00
crit 106.9 40.32% 52733.73 43965 97385 52731.60 46772 61550 5636919 5636919 0.00
miss 0.2 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6142) 0.0% (2.2%) 10.3 45.47sec 268846 250203 0 0 0 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 0.00 0.00 1.0746 0.0000 0.00 0.00 0.00 250202.79 250202.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.17 59.94% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.11 39.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6142 2.2% 10.3 45.47sec 268846 0 169588 363263 246529 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 11.23 0.00 0.00 0.0000 0.0000 2767493.06 2767493.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.74 60.04% 169587.93 153853 262625 169621.48 0 228217 1143096 1143096 0.00
crit 4.47 39.83% 363262.63 320566 656640 361591.59 0 611081 1624397 1624397 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 28658 10.2% 52.1 8.61sec 248276 221018 169693 366626 248278 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.05 52.05 0.00 0.00 1.1233 0.0000 12924005.82 12924005.82 0.00 221017.63 221017.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.16 59.87% 169693.17 129332 377298 169648.55 136392 204034 5288148 5288148 0.00
crit 20.83 40.01% 366626.18 269474 943358 366641.57 274486 489677 7635858 7635858 0.00
miss 0.06 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18574 (27706) 6.6% (9.8%) 73.9 5.79sec 168653 114108 0 0 0 0.0% 0.1% 0.0% 0.0% 140.6 39729 88104 59434 40.7% 0.0% 19.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.90 73.90 140.58 140.58 1.4780 0.6222 8355175.94 8355175.94 0.00 114107.91 114107.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.81 99.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.09 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.3 59.27% 39729.06 34279 62168 39762.53 35659 45453 3310073 3310073 0.00
crit 57.3 40.73% 88103.92 71424 155439 88155.48 75576 106723 5045103 5045103 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 24536 (35489) 8.7% (12.6%) 52.1 8.12sec 307344 202780 0 0 0 0.0% 0.1% 0.0% 0.0% 97.0 77970 167639 114103 40.3% 0.0% 14.0%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.10 52.10 97.04 97.04 1.5157 0.6496 11072686.26 11072686.26 0.00 202780.46 202780.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.04 99.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.9 59.70% 77969.51 68559 124336 77991.33 69534 90738 4517330 4517330 0.00
crit 39.1 40.30% 167639.46 142848 310877 167570.86 146240 200329 6555356 6555356 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 10952 3.9% 42.4 9.87sec 116482 0 70959 184831 116617 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.42 42.37 0.00 0.00 0.0000 0.0000 4941089.70 4941089.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.30 59.72% 70959.18 34279 124336 71049.79 50854 96742 1795494 1795494 0.00
crit 17.02 40.17% 184830.72 86282 385494 184917.26 122811 259709 3145595 3145595 0.00
miss 0.05 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 9132 3.2% 61.4 6.83sec 66925 0 39683 106794 66941 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.38 61.37 0.00 0.00 0.0000 0.0000 4107918.11 4107918.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.32 59.19% 39683.10 34279 62168 39716.53 34958 47649 1441354 1441354 0.00
crit 24.97 40.69% 106793.53 86282 192747 106852.28 87312 145665 2666564 2666564 0.00
miss 0.07 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 88 0.0% 0.3 113.47sec 122761 79198 0 0 0 0.0% 0.1% 0.0% 0.0% 0.6 22089 46905 31776 39.1% 0.0% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.32 0.32 0.65 1.25 1.5511 0.6515 39836.38 39836.38 0.00 79197.57 79197.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.32 99.85% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 60.88% 22088.57 20175 34924 5715.67 0 34924 16860 16860 0.00
crit 0.5 39.07% 46905.21 42035 72766 10305.92 0 72766 22977 22977 0.00
miss 0.0 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 43 0.0% 0.5 21.13sec 35745 0 22084 56899 35746 39.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.55 0.55 0.00 0.00 0.0000 0.0000 19591.51 19591.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.33 60.58% 22083.78 20175 34924 4034.36 0 34924 7332 7332 0.00
crit 0.22 39.31% 56899.36 50780 87903 8061.58 0 87903 12260 12260 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (43) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 10426 3.7% 226.1 2.03sec 20789 0 20789 0 20789 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.11 226.11 0.00 0.00 0.0000 0.0000 4700537.53 4700537.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 226.11 100.00% 20789.10 7034 354274 20801.92 15097 27759 4700538 4700538 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:29403.80
  • base_dd_max:29403.80
shadow_word_death 9519 3.4% 15.7 4.77sec 273736 253082 187011 402655 273737 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 0.00 0.00 1.0816 0.0000 4288720.31 4288720.31 0.00 253081.57 253081.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.34 59.60% 187010.57 145361 425078 187236.48 145361 285985 1746351 1746351 0.00
crit 6.31 40.30% 402654.69 302873 1062821 403144.32 0 845412 2542370 2542370 0.00
miss 0.02 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 29059 (63469) 10.3% (22.6%) 76.3 5.87sec 375063 348039 0 0 0 0.0% 0.1% 0.0% 0.0% 373.3 23967 51826 35117 40.0% 0.0% 128.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.33 373.27 373.27 1.0777 1.5482 13108210.11 13108210.11 0.00 43366.76 348038.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.27 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 223.9 59.98% 23967.32 21342 38694 23974.29 22290 26816 5365843 5365843 0.00
crit 149.4 40.02% 51826.41 44467 96746 51828.82 47139 58124 7742367 7742367 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 14380 5.1% 163.1 2.74sec 39776 0 24120 63328 39806 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.07 162.95 0.00 0.00 0.0000 0.0000 6486364.31 6486364.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.44 59.80% 24119.67 21342 38694 24125.30 22291 26445 2350226 2350226 0.00
crit 65.31 40.08% 63327.91 53717 119967 63347.69 57316 72779 4136139 4136139 0.00
miss 0.19 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0977 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 20030 7.1% 214.7 2.08sec 42082 0 28830 62622 42462 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.70 212.77 0.00 0.00 0.0000 0.0000 9034728.66 9034728.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.94 59.66% 28830.49 25217 46134 28834.64 26710 31795 3659831 3659831 0.00
crit 85.83 40.34% 62622.38 52542 115348 62627.21 56900 72087 5374897 5374897 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1886 0.7% 4.8 67.07sec 173383 0 105091 261847 173377 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.83 4.83 0.00 0.00 0.0000 0.0000 837937.18 837937.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.72 56.21% 105090.67 79124 146057 99348.15 0 146057 285466 285466 0.00
crit 2.11 43.66% 261847.30 164861 365186 231885.30 0 365186 552471 552471 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 21115 (31425) 7.5% (11.2%) 41.3 10.79sec 342727 314029 0 0 0 0.0% 0.1% 0.0% 0.0% 204.8 31511 68506 46459 40.4% 0.0% 86.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.32 41.32 204.79 204.79 1.0914 1.9052 9514312.14 9514312.14 0.00 32531.68 314029.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.28 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.0 59.60% 31511.45 27457 50605 31526.39 28718 35235 3845813 3845813 0.00
crit 82.7 40.40% 68505.60 57209 126527 68530.77 60401 79734 5668499 5668499 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10309 3.7% 89.4 4.92sec 51939 0 31394 82642 51978 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.44 89.38 0.00 0.00 0.0000 0.0000 4645591.25 4645591.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.31 59.64% 31394.22 27457 50605 31405.01 28364 35218 1673486 1673486 0.00
crit 35.96 40.24% 82642.40 69110 156896 82687.34 71511 99449 2972105 2972105 0.00
miss 0.11 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 104668 / 8331
melee 104297 2.9% 33.5 11.72sec 110389 118671 72504 173370 110391 41.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.51 33.51 0.00 0.00 0.9302 0.0000 3698978.19 3698978.19 0.00 118671.10 118671.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.50 34.33% 72503.66 54848 114390 72681.70 58139 105439 834080 834080 0.00
crit 13.94 41.59% 173369.82 124648 274537 173087.32 133401 244827 2416318 2416318 0.00
glance 8.03 23.95% 55891.31 41136 85793 55902.41 0 85793 448580 448580 0.00
dodge 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0820 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 371 0.0% 1.4 1.76sec 9355 0 5549 13668 9355 47.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.40 0.00 0.00 0.0000 0.0000 13087.69 13087.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.90% 5548.55 4169 6741 3034.40 0 6741 4106 4106 0.00
crit 0.66 46.97% 13668.09 10006 16178 6759.08 0 16178 8981 8981 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 24.3 2.4 17.7sec 16.0sec 8.33% 43.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.33%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 19.0 0.0 23.1sec 23.1sec 24.82% 26.44%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.9sec 125.9sec 17.33% 17.33%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.33%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.4sec 41.68% 41.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.68%

    Trigger Attempt Success

    • trigger_pct:99.45%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.0sec 10.0sec 14.83% 49.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.83%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 7.86%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.3 2.1 49.6sec 39.7sec 22.95% 53.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.95%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.8 0.0 57.0sec 56.9sec 17.11% 17.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.11%

    Trigger Attempt Success

    • trigger_pct:99.91%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.3sec 74.3sec 83.38% 73.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.00% 69.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 19.0 57.1 3.0 3.0 293338.5
halo Mana 10.3 416910.2 40500.0 40500.4 6.6
mind_blast Mana 52.1 238690.4 4585.3 4585.4 54.1
mind_flay Mana 73.9 221689.3 3000.0 2999.9 56.2
mind_flay_insanity Mana 52.1 156315.2 3000.0 3000.1 102.4
mind_sear Mana 0.3 2920.7 9000.0 9000.4 13.6
shadow_word_death Mana 15.7 122211.3 7800.0 7800.4 35.1
shadow_word_pain Mana 76.3 1007570.8 13200.0 13199.8 28.4
vampiric_touch Mana 41.3 371836.8 9000.0 9000.0 38.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.47 262810.10 (11.88%) 7852.72 38396.50 12.75%
Shadow Orbs from Mind Blast Shadow Orb 51.99 50.63 (86.52%) 0.97 1.36 2.61%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.89 7.89 (13.48%) 1.00 0.00 0.00%
Devouring Plague Health Health 250.23 0.00 (0.00%) 0.00 5320914.61 100.00%
Vampiric Touch Mana Mana 294.17 1425931.32 (64.45%) 4847.35 70943.52 4.74%
halo_heal Health 10.29 0.00 (0.00%) 0.00 3456270.25 100.00%
external_healing Health 87.03 0.00 (0.00%) 0.00 29764427.46 100.00%
mp5_regen Mana 1803.77 523791.30 (23.67%) 290.39 17339.33 3.20%
pet - shadowfiend
external_healing Health 14.66 0.00 (0.00%) 0.00 5067384.77 100.00%
Resource RPS-Gain RPS-Loss
Mana 4905.10 5626.97
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -23539.92 -357600.00 216600.00
Shadow Orb 1.41 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.3%
shadowfiend-Mana Cap 3.3%
mindbender-Mana Cap 3.3%

Procs

Count Interval
Shadowy Recall Extra Tick 432.6 1.0sec
Shadowy Apparition Procced 214.7 2.1sec
Divine Insight Mind Blast CD Reset 45.3 16.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 281282.01
Minimum 246657.75
Maximum 328992.27
Spread ( max - min ) 82334.53
Range [ ( max - min ) / 2 * 100% ] 14.64%
Standard Deviation 9985.2919
5th Percentile 265574.45
95th Percentile 298244.20
( 95th Percentile - 5th Percentile ) 32669.74
Mean Distribution
Standard Deviation 63.1626
95.00% Confidence Intervall ( 281158.21 - 281405.80 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4840
0.1 Scale Factor Error with Delta=300 851148
0.05 Scale Factor Error with Delta=300 3404592
0.01 Scale Factor Error with Delta=300 85114823
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 281282.01
Minimum 246657.75
Maximum 328992.27
Spread ( max - min ) 82334.53
Range [ ( max - min ) / 2 * 100% ] 14.64%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 123050393.12
Minimum 87979579.15
Maximum 163550795.30
Spread ( max - min ) 75571216.15
Range [ ( max - min ) / 2 * 100% ] 30.71%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.78 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 4.14 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 56.04 mind_blast,if=active_enemies<=5&cooldown_react
I 7.89 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 4.85 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 47.26 mind_flay_insanity,interrupt=1,chain=1
L 39.05 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 34.38 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 7.79 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 10.36 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 14.90 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.29 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.54 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 12.93 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.32 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 73.90 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 29.49 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ALScHMZZZZZHZZZOZZHLZZZWWWHQcccKJHMZZZSLLHLHMLMMQKHKcccZHOZZHQKKKJHNMSZZZLHLLcMMMMHQKKKJHZONZZZWHZLccMSWHQKKKKZLHLLMMMMLWHZZcccccHMQKKKKWHZSZOZNHZZZZALLHHLGHHKKLMWWWWWWWWWWHQKKKJHOSccHcHMQKHKJLLHLMHMGHKKKLLccHMZZZSZZHQKKKJHLHMWHQLLLccMHMMOHZZZZZHQKKKJHLScMZHZZZZLLHLMMMMNZHQKHcHccMZZWHQKKKJOHSNZZZZWLAHLLLMHQKKKJHIFNMZZZHGIFScKZOHVIFQKKKHIFLLLMZWWHG8IFcZHOZVIFQKKHKSHIFLMQKH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 276847 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
276847.2 276847.2 121.80 / 0.04% 16159 / 5.8% 44.8 5985.7 5324.7 Mana 0.36% 48.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 6.95 5.35 6.99 4.56 3.64 4.78
Normalized 1.00 0.77 1.00 0.66 0.52 0.69
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Hit ~= Int > SP > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=6.95, SpellDamage=5.35, HitRating=6.99, CritRating=4.56, HasteRating=3.64, MasteryRating=4.78 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=6.95, SpellDamage=5.35, HitRating=0.00, CritRating=4.56, HasteRating=3.64, MasteryRating=4.78 )

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:844569|351053|324166|262186|256042|215733|198800|121647|88356&chds=0,1689138&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++844569++devouring_plague,9482C9,0,0,15|t++351053++shadow_word_pain,9482C9,1,0,15|t++324166++vampiric_touch,9482C9,2,0,15|t++262186++halo,9482C9,3,0,15|t++256042++shadow_word_death,9482C9,4,0,15|t++215733++mind_flay_insanity,9482C9,5,0,15|t++198800++mind_blast,9482C9,6,0,15|t++121647++mind_flay,9482C9,7,0,15|t++88356++mind_sear,9482C9,8,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:12,9,9,8,8,7,7,6,5,4,4,4,4,4,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|vampiric_touch|mind_flay|shadowy_apparition|mind_flay_insanity|mind_blast|essence_of_yulon|shadow_word_pain_mastery|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|multistrike_spell|shadow_word_death|mind_flay_insanity_mastery|devouring_plague|shadowfiend: melee|devouring_plague_mastery|halo_damage|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:6.99,6.95,5.35,4.78,4.56,3.64|6.81,6.78,5.18,4.61,4.39,3.47|7.16,7.12,5.52,4.95,4.73,3.81&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++6.99++Hit,FFFFFF,0,0,15,0.1,e|t++++6.95++Int,FFFFFF,0,1,15,0.1,e|t++++5.35++SP,FFFFFF,0,2,15,0.1,e|t++++4.78++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.56++Crit,FFFFFF,0,4,15,0.1,e|t++++3.64++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.395& http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bfjmprtwz124557687641yvurqqonmmmmmkjhfdbbbbcdedeeeedcbaZZZZaababZYYXXWWWWWXYXXXXWVUUUVWWXXZZacccddddddddddcbbaYXVUTSRSSUWYabcccccdeghjmooopnmkigffffffgffdbZZYYYYYYYZaZaaaZZYXXYabbcdefhhggggffgggggedcbaZXWVVVVVWWXYZYYYYYXYYZabcccdcbZYXXWWXXZabccbbbaaabcddfggggedcaaaabccdeeffffgfffggggggfeedcbbaZYYYYYYZZZZYYYYXYYZaceddeeddccbbcccddeddcbbaaZZZZaabaaaaZXWVVVXYZacdfikkmmnnoqqsstrrqpomkhfeeddddeeedddddddeefhiiijjjiihhhhhhhhhhhfeeedddeeddfeeffffeeeefgghhhiijijjjjjjjjjjjiiigfedcbbbabbcdeeeffggiklnprrrrssrqqpooonnmmlkjjjjjjjiiiijiijjjiihhhiijjjklmmkigecbaYXW&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5087,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=276847|max=544220&chxp=1,1,51,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,1,7,13,22,48,70,139,208,313,490,630,796,997,1243,1452,1517,1711,1752,1727,1699,1587,1444,1292,1161,956,853,672,527,443,339,248,191,134,95,65,51,37,16,15,9,8,1,5,2,1,1,0,1&chds=0,1752&chbh=5&chxt=x&chxl=0:|min=241355|avg=276847|max=326171&chxp=0,1,42,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:28.5,19.9,14.0,11.3,10.1,3.8,3.4,2.5,0.7,0.1,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 128.5s|shadow_word_pain 89.8s|mind_flay_insanity 63.1s|vampiric_touch 51.2s|mind_blast 45.6s|shadow_word_death 17.0s|devouring_plague 15.5s|halo 11.1s|shadowfiend 3.3s|mind_sear 0.5s|waiting 1.6s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 276847
devouring_plague 8681 (29102) 3.1% (10.5%) 14.5 30.91sec 904033 844569 184218 398301 269561 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 14.52 0.00 0.00 1.0704 0.0000 3914975.39 3914975.39 0.00 844568.93 844568.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.70 59.92% 184218.14 161639 307820 184193.91 161639 253755 1603066 1603066 0.00
crit 5.80 39.97% 398300.92 336788 769642 398018.33 0 711800 2311909 2311909 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 6751 2.4% 59.6 7.13sec 51111 0 31026 81138 51198 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.61 59.51 0.00 0.00 0.0000 0.0000 3046750.75 3046750.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.44 59.55% 31026.34 26940 51304 31033.37 27340 36625 1099542 1099542 0.00
crit 24.00 40.33% 81137.77 67809 159064 81084.44 68581 104444 1947209 1947209 0.00
miss 0.07 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 13670 4.9% 14.5 30.91sec 424689 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.5 30833 66577 45196 40.2% 0.0% 19.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 14.52 136.47 136.47 0.0000 0.6280 6167942.46 6167942.46 0.00 71970.48 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.6 59.82% 30833.05 26940 108795 30847.12 27397 47268 2517004 2517004 0.00
crit 54.8 40.18% 66576.59 56133 272019 66525.09 57196 93271 3650939 3650939 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19202 6.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.3 24362 53522 36078 40.2% 0.1% 27.9%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.61 158.32 240.04 0.0000 0.7941 8660242.09 8660242.09 0.00 68887.35 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.2 59.67% 24361.97 21101 40897 24368.00 22278 27831 3489737 3489737 0.00
crit 96.6 40.24% 53521.92 43965 102254 53518.03 47850 63484 5170505 5170505 0.00
miss 0.2 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6452) 0.0% (2.3%) 10.4 45.16sec 279565 262186 0 0 0 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 10.41 0.00 0.00 1.0663 0.0000 0.00 0.00 0.00 262186.21 262186.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.22 59.80% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.17 40.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6452 2.3% 10.4 45.16sec 279565 0 171902 368838 250458 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 11.61 0.00 0.00 0.0000 0.0000 2908955.97 2908955.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.96 59.90% 171902.25 153853 275756 172091.20 0 244404 1195979 1195979 0.00
crit 4.64 39.99% 368838.43 320566 689472 367751.29 0 556643 1712977 1712977 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 20135 7.3% 37.8 11.95sec 239905 198800 164312 355276 239903 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.82 37.82 0.00 0.00 1.2068 0.0000 9072433.77 9072433.77 0.00 198799.93 198799.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.76 60.19% 164311.74 129332 396163 164206.99 136185 204303 3739938 3739938 0.00
crit 15.01 39.69% 355275.55 269474 990526 355241.32 269474 530321 5332495 5332495 0.00
miss 0.05 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 23242 (34708) 8.4% (12.5%) 87.0 4.96sec 179661 121647 0 0 0 0.0% 0.1% 0.0% 0.0% 172.5 40454 89954 60650 40.8% 0.0% 22.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.97 86.97 172.53 172.53 1.4769 0.5981 10464255.77 10464255.77 0.00 121646.71 121646.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.86 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.1 59.20% 40453.75 34279 65277 40490.88 36578 46826 4131935 4131935 0.00
crit 70.4 40.80% 89954.48 71424 163211 90037.84 77658 107616 6332321 6332321 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 20751 (30177) 7.5% (10.9%) 43.2 9.91sec 315209 215733 0 0 0 0.0% 0.1% 0.0% 0.0% 80.5 79246 170802 116173 40.3% 0.0% 11.1%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.17 43.17 80.54 80.54 1.4611 0.6222 9356562.64 9356562.64 0.00 215733.32 215733.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.12 99.88% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.1 59.67% 79246.09 68559 130553 79290.82 69912 95269 3808194 3808194 0.00
crit 32.5 40.33% 170802.34 142848 326421 170695.97 145724 210825 5548369 5548369 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 9426 3.4% 35.2 12.02sec 120812 0 73630 191789 120974 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.18 35.13 0.00 0.00 0.0000 0.0000 4250385.05 4250385.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.99 59.74% 73629.53 34279 130553 73721.28 54132 95349 1545330 1545330 0.00
crit 14.10 40.14% 191788.87 86282 404768 191809.11 126857 286863 2705055 2705055 0.00
miss 0.04 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 11466 4.1% 75.4 5.63sec 68455 0 40475 109253 68474 40.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.40 75.38 0.00 0.00 0.0000 0.0000 5161507.51 5161507.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.54 59.09% 40475.18 34279 65277 40516.38 35706 49111 1802726 1802726 0.00
crit 30.74 40.78% 109253.37 86282 202384 109354.47 89382 144111 3358781 3358781 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 90 0.0% 0.3 126.81sec 137033 88356 0 0 0 0.0% 0.2% 0.0% 0.0% 0.6 22185 47094 32055 39.7% 0.1% 0.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.30 0.30 0.61 1.30 1.5514 0.6513 41704.18 41704.18 0.00 88356.31 88356.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.30 99.82% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.18% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 60.26% 22184.95 20175 34924 5502.74 0 34924 17394 17394 0.00
crit 0.5 39.68% 47093.88 42035 72766 10347.06 0 72766 24311 24311 0.00
miss 0.0 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 44 0.0% 0.6 24.51sec 35848 0 22152 56917 35849 39.5% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.57 0.57 0.00 0.00 0.0000 0.0000 20270.42 20270.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.34 60.35% 22151.52 20175 34924 3915.63 0 34924 7560 7560 0.00
crit 0.22 39.49% 56917.37 50780 87903 8158.61 0 87903 12711 12711 0.00
miss 0.00 0.16% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (44) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 9960 3.6% 225.9 2.03sec 19869 0 19869 0 19869 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.92 225.92 0.00 0.00 0.0000 0.0000 4488842.47 4488842.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 225.92 100.00% 19869.23 7034 371987 19884.38 14945 26654 4488842 4488842 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:21341.52
  • base_dd_max:21341.52
power_infusion 0 0.0% 4.3 120.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9660 3.5% 15.8 4.72sec 274877 256042 187448 404462 274879 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 0.00 0.00 1.0736 0.0000 4352709.76 4352709.76 0.00 256041.75 256041.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.43 59.53% 187447.71 145361 446332 187686.40 145361 336356 1766867 1766867 0.00
crit 6.39 40.37% 404462.07 302873 1115962 404883.29 0 722724 2585842 2585842 0.00
miss 0.02 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 32078 (69938) 11.6% (25.3%) 84.0 5.34sec 375450 351053 0 0 0 0.0% 0.1% 0.0% 0.0% 407.3 24242 52441 35521 40.0% 0.0% 133.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.00 84.00 407.26 407.26 1.0695 1.4812 14466028.23 14466028.23 0.00 45506.09 351052.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.93 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 244.4 60.00% 24241.71 21342 40629 24250.67 22594 26779 5923715 5923715 0.00
crit 162.9 40.00% 52440.69 44467 101583 52449.44 48165 59104 8542313 8542313 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15827 5.7% 177.9 2.52sec 40109 0 24315 63904 40139 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 177.95 177.81 0.00 0.00 0.0000 0.0000 7137269.53 7137269.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.39 59.83% 24314.95 21342 40629 24321.58 22654 26665 2586793 2586793 0.00
crit 71.21 40.05% 63903.81 53717 125965 63922.34 57432 72499 4550477 4550477 0.00
miss 0.22 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0976 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 22033 8.0% 234.1 1.91sec 42441 0 29059 63212 42826 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 234.10 231.99 0.00 0.00 0.0000 0.0000 9935287.03 9935287.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.47 59.69% 29058.89 25217 48441 29063.28 26903 32094 4023777 4023777 0.00
crit 93.52 40.31% 63211.73 52542 121116 63216.52 56763 72131 5911510 5911510 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2171 0.8% 5.3 60.86sec 183655 0 110393 276423 183654 44.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 0.0000 0.0000 964414.21 964414.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.92 55.65% 110392.65 79124 153360 105630.26 0 153360 322574 322574 0.00
crit 2.32 44.22% 276423.34 164861 383445 251182.02 0 383445 641841 641841 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:106984.80
  • base_dd_max:106984.80
vampiric_touch 24796 (36806) 9.0% (13.3%) 47.4 9.41sec 349696 324166 0 0 0 0.0% 0.1% 0.0% 0.0% 235.4 32103 70074 47464 40.5% 0.0% 94.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.42 47.42 235.38 235.38 1.0788 1.8161 11172248.37 11172248.37 0.00 34647.33 324166.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.39 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.2 59.54% 32103.25 27457 53135 32119.16 29462 36412 4499526 4499526 0.00
crit 95.2 40.46% 70073.71 57209 132854 70094.44 62427 83802 6672722 6672722 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 12009 4.3% 102.8 4.29sec 52646 0 31731 83858 52685 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.78 102.70 0.00 0.00 0.0000 0.0000 5410796.39 5410796.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.21 59.60% 31731.46 27457 53135 31743.01 28638 35946 1942330 1942330 0.00
crit 41.36 40.27% 83857.71 69110 164741 83894.26 72226 101281 3468467 3468467 0.00
miss 0.13 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 105629 / 8403
melee 105261 3.0% 33.5 11.72sec 111420 119783 72884 174923 111419 41.8% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.50 33.50 0.00 0.00 0.9302 0.0000 3732207.24 3732207.24 0.00 119783.27 119783.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.44 34.16% 72884.32 54848 114390 73093.39 57614 107271 833912 833912 0.00
crit 13.99 41.78% 174922.87 124648 274537 174510.04 132743 265585 2447960 2447960 0.00
glance 8.02 23.94% 56162.57 41136 85793 56178.26 0 85793 450335 450335 0.00
dodge 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0748 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 368 0.0% 1.4 1.73sec 9346 0 5539 13668 9346 46.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 12979.83 12979.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.93% 5538.55 4169 6741 2989.25 0 6741 4071 4071 0.00
crit 0.65 46.93% 13668.06 10006 16178 6756.34 0 16178 8909 8909 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.33%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.5 0.0 30.9sec 30.9sec 25.56% 21.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 127.0sec 127.0sec 17.25% 17.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.25%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.7 6.6 36.5sec 23.5sec 41.65% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.65%

    Trigger Attempt Success

    • trigger_pct:99.44%
power_infusion 4.3 0.0 120.8sec 120.8sec 18.63% 18.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.9sec 9.9sec 15.00% 49.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.00%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 8.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.3 2.1 49.6sec 39.7sec 22.93% 43.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.93%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.7 0.0 58.1sec 58.0sec 16.86% 16.86%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.86%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.19% 14.19%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.4sec 74.4sec 83.38% 73.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.53% 70.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 14.5 43.5 3.0 3.0 301600.4
halo Mana 10.4 400200.6 38461.2 38461.3 7.3
mind_blast Mana 37.8 328487.2 8686.4 8686.3 27.6
mind_flay Mana 87.0 249497.0 2868.6 2868.7 62.6
mind_flay_insanity Mana 43.2 124539.9 2885.0 2885.0 109.3
mind_sear Mana 0.3 2738.8 8999.8 8999.2 15.2
shadow_word_death Mana 15.8 118918.9 7509.5 7509.8 36.6
shadow_word_pain Mana 84.0 1066482.7 12696.1 12695.9 29.6
vampiric_touch Mana 47.4 409104.2 8627.1 8627.0 40.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.45 250598.38 (10.43%) 7490.75 50490.86 16.77%
Shadow Orbs from Mind Blast Shadow Orb 37.77 36.87 (82.22%) 0.98 0.90 2.37%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.98 7.98 (17.78%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.98 0.00 (0.00%) 0.00 4167343.42 100.00%
Vampiric Touch Mana Mana 338.08 1628345.30 (67.80%) 4816.39 92055.58 5.35%
halo_heal Health 10.41 0.00 (0.00%) 0.00 3504664.23 100.00%
external_healing Health 86.92 0.00 (0.00%) 0.00 29713183.27 100.00%
mp5_regen Mana 1803.77 522848.81 (21.77%) 289.86 18281.82 3.38%
pet - shadowfiend
external_healing Health 14.74 0.00 (0.00%) 0.00 5094440.18 100.00%
Resource RPS-Gain RPS-Loss
Mana 5324.69 5985.73
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana 3694.38 -318000.00 256980.00
Shadow Orb 1.33 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.4%
shadowfiend-Mana Cap 3.4%
mindbender-Mana Cap 3.4%

Procs

Count Interval
Shadowy Recall Extra Tick 451.1 1.0sec
Shadowy Apparition Procced 234.1 1.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 276847.17
Minimum 241354.65
Maximum 326171.26
Spread ( max - min ) 84816.62
Range [ ( max - min ) / 2 * 100% ] 15.32%
Standard Deviation 9823.9136
5th Percentile 261513.62
95th Percentile 293831.37
( 95th Percentile - 5th Percentile ) 32317.75
Mean Distribution
Standard Deviation 62.1418
95.00% Confidence Intervall ( 276725.38 - 276968.97 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4837
0.1 Scale Factor Error with Delta=300 823858
0.05 Scale Factor Error with Delta=300 3295434
0.01 Scale Factor Error with Delta=300 82385871
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 276847.17
Minimum 241354.65
Maximum 326171.26
Spread ( max - min ) 84816.62
Range [ ( max - min ) / 2 * 100% ] 15.32%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 120993581.99
Minimum 87368453.97
Maximum 159500956.21
Spread ( max - min ) 72132502.24
Range [ ( max - min ) / 2 * 100% ] 29.81%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.86 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.41 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.12 mind_blast,if=active_enemies<=5&cooldown_react
I 7.98 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 3.73 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 39.44 mind_flay_insanity,interrupt=1,chain=1
L 37.13 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 38.57 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 10.59 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.49 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 13.11 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.41 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.60 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 5.55 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.30 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 86.97 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 36.28 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABLScHMZZZZZWHZZZOZNHQKKKKcccccHMZZZZSWHLLLMMMMHLZZZcccHOQKKKJHZZOZNZHSZZZLLLcHMMMMQKKHKZZOZNHZZZBLccHMSZZZZWHLLLMMMONHQKKKcccccHOZZZZWHZSZOZHNZZZALLHLMMMQKKHKLZZOZHZZScccccHOQKKKKZHLLLMMMMNHZZZLBccHMQKKKKSHZZZZONWHZZZZLLLccHMMMQKKKHZZZOZNHSZcccHOQKKKJHLLLMMMMNHZZZcccccHOQKKKSHZZZNMZHZZZLABLHLLMMQKKHKZIFNZHMSZIFQcccHKIFMZZHLLIFLMMMHLGIFK8cccHIFMQKKKHIFSZZNHMIFQK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 279112 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
279111.6 279111.6 117.05 / 0.04% 15601 / 5.6% 43.4 6228.9 5211.8 Mana 0.30% 47.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.22 5.50 7.56 4.68 5.95 4.69
Normalized 1.00 0.76 1.05 0.65 0.82 0.65
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.16 0.16 0.17 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Hit > Int > Haste > SP > Mastery ~= Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.22, SpellDamage=5.50, HitRating=7.56, CritRating=4.68, HasteRating=5.95, MasteryRating=4.69 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.22, SpellDamage=5.50, HitRating=0.00, CritRating=4.68, HasteRating=5.95, MasteryRating=4.69 )

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:864505|346552|307481|289241|271226|216713|212282|117457|103389&chds=0,1729010&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++864505++devouring_plague,9482C9,0,0,15|t++346552++shadow_word_pain,9482C9,1,0,15|t++307481++vampiric_touch,9482C9,2,0,15|t++289241++shadow_word_death,9482C9,3,0,15|t++271226++halo,9482C9,4,0,15|t++216713++mind_flay_insanity,9482C9,5,0,15|t++212282++mind_blast,9482C9,6,0,15|t++117457++mind_flay,9482C9,7,0,15|t++103389++mind_sear,9482C9,8,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:12,9,8,8,8,8,7,6,5,4,4,4,4,4,3,3,3,2,1,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay_insanity|shadowy_apparition|mind_blast|mind_flay|essence_of_yulon|shadow_word_pain_mastery|devouring_plague_tick|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|multistrike_spell|mind_flay_insanity_mastery|devouring_plague|shadowfiend: melee|devouring_plague_mastery|halo_damage|stormlash|mind_sear|shadowfiend: stormlash|mind_sear_mastery&
http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.56,7.22,5.95,5.50,4.69,4.68|7.40,7.05,5.79,5.34,4.53,4.51|7.73,7.38,6.12,5.66,4.86,4.84&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.56++Hit,FFFFFF,0,0,15,0.1,e|t++++7.22++Int,FFFFFF,0,1,15,0.1,e|t++++5.95++Haste,FFFFFF,0,2,15,0.1,e|t++++5.50++SP,FFFFFF,0,3,15,0.1,e|t++++4.69++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.68++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.088& http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:ejnqtuxz14567678541wtqnljjjkkloqsuuvvvuuuuvwyyyxwurolhgeeedeffffdcdccccdddefgfggfedefghiijkllnnmmmllllljiihgggecbZYXXXXYZbceedffffhikmorssttsrponnmmmnopppomlkkiiiiijkjjjigfdccdeghiklnprqrssrssssssponmkjgecbbaabcdeffefffeffghjllllmkigfeddddefghhfefeedefgghjijjjihgffghijkmnpqsrtuttttttttrrqpnmkigfeeefhijllklkkklmnoqsrrssrqonmmmnmooppqpnonnmmmmmnoononljhfffghjklnpsuuwxxxz1244532210zwurqqpqqrstuuttuuuuvwx0101110yyyxxxxxxxxxwvuutsrsutttvuuuuuuttttuvwxxyyz0z00000110010zzzwusrpoonnmmnoppoooooqtuvy001233332211100001110211110zzz0011210zyxxyyyzyy0231xuronlihf&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6616,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=279112|max=421889&chxp=1,1,66,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,6,13,21,43,62,131,196,265,394,541,660,846,1029,1196,1413,1577,1625,1694,1733,1654,1540,1420,1266,1119,940,763,663,505,451,348,241,182,134,110,71,41,25,25,16,9,7,6,1,1,3,1,0,0,1&chds=0,1733&chbh=5&chxt=x&chxl=0:|min=247943|avg=279112|max=327112&chxp=0,1,39,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:27.3,20.0,14.7,11.4,10.3,3.8,3.6,2.4,0.7,0.1,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 122.9s|shadow_word_pain 90.3s|mind_flay_insanity 66.3s|vampiric_touch 51.5s|mind_blast 46.4s|shadow_word_death 17.1s|devouring_plague 16.0s|halo 11.1s|shadowfiend 3.3s|mind_sear 0.2s|waiting 1.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 279112
devouring_plague 9360 (30686) 3.4% (11.0%) 14.9 29.22sec 932029 864505 193741 420473 284131 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 1.0781 0.0000 4224095.72 4224095.72 0.00 864505.12 864505.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.91 59.95% 193740.81 161639 337137 193712.70 0 248844 1726632 1726632 0.00
crit 5.94 39.95% 420473.38 336788 842941 420404.70 0 779590 2497464 2497464 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 7083 2.5% 59.4 6.95sec 53819 0 32650 85531 53907 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.44 59.34 0.00 0.00 0.0000 0.0000 3198966.20 3198966.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.39 59.63% 32649.91 26940 56190 32667.97 28164 39099 1155334 1155334 0.00
crit 23.89 40.26% 85531.21 67809 174213 85489.31 70939 110235 2043632 2043632 0.00
miss 0.06 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 14243 5.1% 14.9 29.22sec 432724 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.2 32243 69698 47241 40.0% 0.0% 19.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 136.18 136.18 0.0000 0.6496 6433226.16 6433226.16 0.00 72726.34 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.6 59.96% 32243.15 26940 71100 32258.50 28651 38036 2632543 2632543 0.00
crit 54.5 40.04% 69697.76 56133 148142 69661.55 59082 83987 3800683 3800683 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19982 7.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 155.6 25332 55374 37401 40.2% 0.1% 27.4%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.07 155.56 240.89 0.0000 0.7939 9009529.35 9009529.35 0.00 72953.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.8 59.70% 25332.11 21101 44792 25338.06 22757 29561 3642839 3642839 0.00
crit 96.9 40.23% 55374.27 43965 111993 55369.09 48186 66373 5366690 5366690 0.00
miss 0.2 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (6649) 0.0% (2.4%) 10.3 45.64sec 291391 271226 0 0 0 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 0.00 0.00 1.0744 0.0000 0.00 0.00 0.00 271225.96 271225.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.15 59.79% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.13 40.10% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 6649 2.4% 10.3 45.64sec 291391 0 177602 379513 257687 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 11.63 0.00 0.00 0.0000 0.0000 2997318.10 2997318.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.00 60.14% 177602.05 153853 302019 177744.81 153853 265510 1242442 1242442 0.00
crit 4.62 39.75% 379512.89 320566 755136 378262.91 0 598376 1754876 1754876 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 21828 7.8% 38.9 11.59sec 253346 212282 173807 374479 253345 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.87 38.87 0.00 0.00 1.1935 0.0000 9847526.89 9847526.89 0.00 212281.51 212281.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.39 60.16% 173806.75 129332 433893 173616.06 138969 210900 4064527 4064527 0.00
crit 15.44 39.73% 374479.16 269474 1084861 374299.91 288485 551761 5783000 5783000 0.00
miss 0.04 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 21516 (32109) 7.7% (11.5%) 83.3 5.17sec 173294 117457 0 0 0 0.0% 0.1% 0.0% 0.0% 158.7 40906 90217 60979 40.7% 0.0% 22.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.32 83.32 158.69 158.69 1.4754 0.6250 9676838.47 9676838.47 0.00 117456.94 117456.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.23 99.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.09 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.1 59.29% 40905.84 34279 71493 40944.94 36659 46908 3848795 3848795 0.00
crit 64.6 40.71% 90216.61 71424 178754 90281.78 77463 107786 5828043 5828043 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 21834 (31808) 7.8% (11.4%) 45.0 9.18sec 318851 216713 0 0 0 0.0% 0.1% 0.0% 0.0% 82.1 82048 176722 120148 40.2% 0.0% 11.7%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.05 45.05 82.07 82.07 1.4713 0.6454 9860898.35 9860898.35 0.00 216712.94 216712.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.00 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.0 59.76% 82047.56 68559 142987 82095.17 71608 99804 4023848 4023848 0.00
crit 33.0 40.24% 176721.73 142848 357509 176653.92 147372 216617 5837051 5837051 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 9974 3.6% 35.9 11.44sec 125475 0 76286 199235 125621 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.89 35.85 0.00 0.00 0.0000 0.0000 4503051.71 4503051.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.40 59.70% 76285.94 34279 142987 76425.19 56139 104841 1632576 1632576 0.00
crit 14.41 40.19% 199235.23 86282 443318 199315.44 126105 275673 2870475 2870475 0.00
miss 0.04 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 10592 3.8% 69.4 6.13sec 68663 0 40890 109309 68679 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.36 69.34 0.00 0.00 0.0000 0.0000 4762495.21 4762495.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.05 59.20% 40890.17 34279 71493 40929.36 35858 49159 1678547 1678547 0.00
crit 28.21 40.69% 109308.54 86282 221659 109380.98 90225 139930 3083948 3083948 0.00
miss 0.08 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 53 0.0% 0.2 119.20sec 157997 103389 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 23544 50174 34209 40.1% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.16 0.16 0.31 0.73 1.5329 0.6423 24813.40 24813.40 0.00 103389.18 103389.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.16 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.4 59.92% 23544.41 20175 40162 3154.48 0 40162 10232 10232 0.00
crit 0.3 40.07% 50174.04 42035 83681 5920.72 0 83681 14581 14581 0.00
miss 0.0 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 26 0.0% 0.3 15.93sec 38309 0 23609 60267 38304 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.32 0.32 0.00 0.00 0.0000 0.0000 12219.83 12219.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.19 59.70% 23609.39 20175 40162 2336.59 0 40162 4496 4496 0.00
crit 0.13 40.18% 60266.64 50780 101089 4844.81 0 101089 7724 7724 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (26) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 10129 3.6% 219.4 2.09sec 20821 0 20821 0 20821 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 219.40 219.40 0.00 0.00 0.0000 0.0000 4568241.42 4568241.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 219.40 100.00% 20821.14 7034 407415 20827.88 15476 27982 4568241 4568241 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:72368.75
  • base_dd_max:72368.75
shadow_word_death 10984 3.9% 15.8 4.73sec 312886 289241 213367 460088 312898 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 15.81 0.00 0.00 1.0818 0.0000 4947764.72 4947764.72 0.00 289241.48 289241.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.41 59.52% 213367.33 167166 488840 213602.33 167166 306907 2008232 2008232 0.00
crit 6.39 40.40% 460088.16 348304 1222245 460885.85 0 1195166 2939532 2939532 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 31838 (69395) 11.4% (24.9%) 83.8 5.34sec 373444 346552 0 0 0 0.0% 0.1% 0.0% 0.0% 391.9 25025 54099 36649 40.0% 0.0% 133.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.82 83.82 391.90 391.90 1.0776 1.5303 14362533.09 14362533.09 0.00 45364.53 346551.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.76 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.2 60.02% 25025.27 21342 44498 25031.47 23015 27653 5886482 5886482 0.00
crit 156.7 39.98% 54098.77 44467 111258 54098.47 49385 61213 8476051 8476051 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 15712 5.6% 171.1 2.61sec 41415 0 25146 65943 41446 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 171.14 171.01 0.00 0.00 0.0000 0.0000 7087639.77 7087639.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.39 59.87% 25146.11 21342 44498 25151.72 23300 28018 2574716 2574716 0.00
crit 68.44 40.02% 65943.44 53717 137962 65960.50 59218 75932 4512924 4512924 0.00
miss 0.18 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0975 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 21844 7.8% 225.1 1.99sec 43773 0 30030 65166 44167 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.10 223.10 0.00 0.00 0.0000 0.0000 9853484.60 9853484.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 133.33 59.76% 30029.59 25217 53054 30033.77 27826 33509 4003911 4003911 0.00
crit 89.76 40.24% 65165.70 52542 132651 65166.46 58078 74407 5849574 5849574 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1962 0.7% 4.9 65.15sec 177870 0 108399 267346 177873 43.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.89 4.89 0.00 0.00 0.0000 0.0000 869942.25 869942.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.74 56.07% 108399.30 79124 158839 102436.30 0 158839 297242 297242 0.00
crit 2.14 43.80% 267345.55 164861 365186 237477.37 0 365186 572700 572700 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:110260.80
  • base_dd_max:110260.80
vampiric_touch 23562 (35133) 8.4% (12.6%) 47.4 9.39sec 333794 307481 0 0 0 0.0% 0.1% 0.0% 0.0% 221.7 32575 70599 47892 40.3% 0.0% 93.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.43 47.43 221.71 221.71 1.0856 1.9104 10618017.02 10618017.02 0.00 33327.64 307480.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.40 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.4 59.72% 32575.36 27457 58196 32587.57 29799 36455 4312991 4312991 0.00
crit 89.3 40.28% 70598.80 57209 145506 70604.10 63653 80815 6305026 6305026 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11571 4.1% 96.9 4.54sec 53802 0 32625 85620 53842 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.91 96.84 0.00 0.00 0.0000 0.0000 5214177.11 5214177.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.90 59.79% 32624.85 27457 58196 32636.26 29897 36657 1888999 1888999 0.00
crit 38.84 40.10% 85619.90 69110 180431 85648.34 74770 102361 3325178 3325178 0.00
miss 0.11 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 105186 / 8368
melee 104819 3.0% 33.5 11.73sec 110946 119276 72638 174137 110945 41.7% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.50 33.50 0.00 0.00 0.9302 0.0000 3716270.12 3716270.12 0.00 119275.61 119275.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.47 34.24% 72637.90 54848 114390 72816.37 58937 114390 833078 833078 0.00
crit 13.98 41.74% 174137.50 124648 274537 173801.50 133812 243786 2434866 2434866 0.00
glance 8.01 23.91% 55978.48 41136 85793 56004.96 0 85793 448326 448326 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0818 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 367 0.0% 1.4 1.73sec 9326 0 5541 13636 9325 46.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 12946.93 12946.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 53.01% 5541.18 4169 6741 2983.20 0 6741 4078 4078 0.00
crit 0.65 46.85% 13635.73 10006 16178 6702.15 0 16178 8869 8869 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 14.9 0.0 29.2sec 29.2sec 24.41% 23.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:24.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 126.8sec 126.8sec 17.15% 17.15%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.15%

    Trigger Attempt Success

    • trigger_pct:99.91%
jade_serpent_potion 2.0 0.0 420.4sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.60% 41.60%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.60%

    Trigger Attempt Success

    • trigger_pct:99.45%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.12% 17.12%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.9sec 9.9sec 14.98% 49.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.98%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.58% 8.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
tempus_repit 9.3 2.1 49.5sec 39.6sec 23.00% 53.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.00%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.7 0.0 57.6sec 57.5sec 16.91% 16.91%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:16.91%

    Trigger Attempt Success

    • trigger_pct:99.90%
twist_of_fate 1.0 310.6 0.0sec 0.5sec 32.34% 32.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.19% 14.19%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.4sec 74.4sec 83.38% 73.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.54% 70.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.34% 16.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 14.9 44.6 3.0 3.0 310884.9
halo Mana 10.3 416592.7 40500.0 40500.0 7.2
mind_blast Mana 38.9 349827.5 9000.0 9000.0 28.1
mind_flay Mana 83.3 249969.5 3000.0 3000.0 57.8
mind_flay_insanity Mana 45.0 135147.5 3000.0 3000.0 106.3
mind_sear Mana 0.2 1413.4 9000.0 8999.4 17.6
shadow_word_death Mana 15.8 123349.2 7800.0 7800.3 40.1
shadow_word_pain Mana 83.8 1106459.9 13200.0 13199.8 28.3
vampiric_touch Mana 47.4 426876.1 9000.0 8999.9 37.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.46 265632.79 (11.30%) 7938.76 35509.37 11.79%
Shadow Orbs from Mind Blast Shadow Orb 38.83 37.95 (82.66%) 0.98 0.88 2.25%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.96 7.96 (17.34%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.52 0.00 (0.00%) 0.00 4157698.77 100.00%
Vampiric Touch Mana Mana 318.55 1558835.44 (66.31%) 4893.55 61934.24 3.82%
halo_heal Health 10.29 0.00 (0.00%) 0.00 3639519.63 100.00%
external_healing Health 87.04 0.00 (0.00%) 0.00 29573109.70 100.00%
mp5_regen Mana 1803.77 526385.95 (22.39%) 291.83 14744.68 2.72%
pet - shadowfiend
external_healing Health 14.74 0.00 (0.00%) 0.00 5098616.84 100.00%
Resource RPS-Gain RPS-Loss
Mana 5211.76 6228.86
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -157986.20 -508500.00 114300.00
Shadow Orb 1.35 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.8%
shadowfiend-Mana Cap 2.8%
mindbender-Mana Cap 2.8%

Procs

Count Interval
Shadowy Recall Extra Tick 432.7 1.0sec
Shadowy Apparition Procced 225.1 2.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 279111.58
Minimum 247942.84
Maximum 327112.12
Spread ( max - min ) 79169.28
Range [ ( max - min ) / 2 * 100% ] 14.18%
Standard Deviation 9441.3541
5th Percentile 264126.59
95th Percentile 295327.75
( 95th Percentile - 5th Percentile ) 31201.16
Mean Distribution
Standard Deviation 59.7219
95.00% Confidence Intervall ( 278994.53 - 279228.63 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4395
0.1 Scale Factor Error with Delta=300 760943
0.05 Scale Factor Error with Delta=300 3043772
0.01 Scale Factor Error with Delta=300 76094319
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 279111.58
Minimum 247942.84
Maximum 327112.12
Spread ( max - min ) 79169.28
Range [ ( max - min ) / 2 * 100% ] 14.18%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 122072779.38
Minimum 87663742.39
Maximum 164990096.97
Spread ( max - min ) 77326354.58
Range [ ( max - min ) / 2 * 100% ] 31.67%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.85 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.47 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.11 mind_blast,if=active_enemies<=5&cooldown_react
I 7.96 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 4.42 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 40.63 mind_flay_insanity,interrupt=1,chain=1
L 37.82 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 39.36 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 9.68 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 11.91 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 13.40 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.29 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.67 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 4.36 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.16 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 83.32 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 36.33 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ALScHMZZZZZHZZZOZZHLZZZZccccHMQKKKKSHLLLMMMMHLZZZZcccHMZZZZZHQKKKJHLMSZLLLccHMMMOZZWWHQKKKJHLMZZLccHMZSZZZHLLLMMMGKHKKLcccccHMZZZZWHZZZOSHLQKKKALLHLMMMZNZHZZZOZWHQKKKNSccHOZZZZWHLLLMMMMHLZZZLccHMQKKKKSHZZZOZNHZZZLLLccHMMMMQKKKHJZZONZHSZZcccHOQKKKKWHLLLMMMMNHZZZcccccHMSZZZZHQKKKKMNHZZZLALHLLMMZZWHZZIFQKHKKIFLScccHGIFKKMWHLLIFLMMHLQKIF8cccHMIFQKKKHSIFZOZHLVIFQK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 344 - 556 ( 451.1 )

Performance:
Total Events Processed: 1007703892
Max Event Queue: 245
Sim Seconds: 11276687
CPU Seconds: 1296.3800
Physical Seconds: 196.3020
Speed Up: 8699

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
Standard Deviation 55.6106
5th Percentile 369.71
95th Percentile 537.08
( 95th Percentile - 5th Percentile ) 167.37
Mean Distribution
Standard Deviation 0.3518
95.00% Confidence Intervall ( 450.38 - 451.76 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 583
0.1% Error 58388
0.1 Scale Factor Error with Delta=300 26
0.05 Scale Factor Error with Delta=300 105
0.01 Scale Factor Error with Delta=300 2639
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 5190569 11507 2.58 182857 395329 19.4 19.4 40.0% 0.1% 0.0% 0.0% 22.74sec 5190569 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 3904394 8656 10.30 30648 79894 77.5 77.4 40.2% 0.1% 0.0% 0.0% 5.48sec 3904394 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 7972187 17716 23.65 30678 66101 19.4 177.4 40.3% 0.0% 0.0% 0.0% 22.74sec 7972187 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 9584728 21299 22.80 24224 52933 0.0 171.0 40.3% 0.1% 0.0% 0.0% 0.00sec 9584728 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.47 0 0 11.0 11.0 39.8% 0.1% 0.0% 0.0% 42.47sec 0 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 2748527 6093 1.48 169890 365378 11.0 11.1 39.9% 0.1% 0.0% 0.0% 42.47sec 2748527 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 0 0 16.00 0 0 11.0 120.3 43.0% 0.0% 0.0% 0.0% 42.47sec 40559743 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 12239070 27134 7.06 157387 341036 53.1 53.1 39.9% 0.1% 0.0% 0.0% 8.45sec 12239070 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 9436051 20969 21.34 39606 87152 86.8 160.1 40.7% 0.0% 0.0% 0.0% 5.07sec 9436051 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 4627710 10259 9.30 39507 105389 69.9 69.9 40.6% 0.1% 0.0% 0.0% 6.24sec 4627710 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear ticks -48045 4274 9 0.01 22115 46863 0.0 0.1 38.7% 0.1% 0.0% 0.0% 143.78sec 4274 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_mastery 124469 2190 5 0.01 22161 56691 0.1 0.1 41.6% 0.2% 0.0% 0.0% 10.58sec 2190 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 10621729 23548 7.23 133094 288295 54.3 54.3 40.3% 0.1% 0.0% 0.0% 8.00sec 10621729 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 4788063 10615 30.33 20997 0 228.0 228.0 0.0% 0.0% 0.0% 0.0% 2.02sec 4788063 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 4230152 9378 2.12 180840 390255 16.0 16.0 40.4% 0.1% 0.0% 0.0% 4.68sec 4230152 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 13514526 30032 51.11 24050 52017 72.4 383.3 40.1% 0.0% 0.0% 0.0% 6.20sec 13514526 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 6673358 14795 22.26 24142 63427 167.5 167.3 40.1% 0.1% 0.0% 0.0% 2.67sec 6673358 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 9297829 20613 29.09 28862 62710 220.8 218.7 40.4% 0.0% 0.0% 0.0% 2.03sec 9297829 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.82sec 0 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 797727 1769 0.61 105304 263042 4.6 4.6 43.9% 0.1% 0.0% 0.0% 69.04sec 797727 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 10322309 22938 29.56 31578 68632 45.5 221.7 40.4% 0.0% 0.0% 0.0% 9.82sec 10322309 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 5035420 11163 12.88 31422 82660 96.9 96.8 40.3% 0.1% 0.0% 0.0% 4.56sec 5035420 451.07sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 3703951 104366 56.65 72631 173686 33.5 33.5 41.6% 0.1% 24.0% 0.0% 11.73sec 3703951 35.49sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.39sec 0 35.49sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 13234 373 2.38 5558 13728 1.4 1.4 47.3% 0.1% 0.0% 0.0% 1.74sec 13234 35.49sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 3734584 8279 1.85 183347 396154 13.9 13.9 40.1% 0.1% 0.0% 0.0% 32.00sec 3734584 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 2843424 6304 7.44 30862 80557 56.0 55.9 40.2% 0.1% 0.0% 0.0% 7.53sec 2843424 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 5780180 12845 17.13 30733 66205 13.9 128.5 40.2% 0.0% 0.0% 0.0% 32.00sec 5780180 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 9112361 20250 22.88 24486 53873 0.0 171.6 40.3% 0.1% 0.0% 0.0% 0.00sec 9112361 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 1.47 0 0 11.1 11.1 39.9% 0.1% 0.0% 0.0% 42.28sec 0 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 2813991 6239 1.48 173059 372800 11.1 11.1 39.8% 0.1% 0.0% 0.0% 42.28sec 2813991 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 0 0 16.11 0 0 11.1 121.1 43.0% 0.0% 0.0% 0.0% 42.28sec 40896430 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 7936059 17594 4.77 151142 327077 35.9 35.9 39.9% 0.1% 0.0% 0.0% 12.58sec 7936059 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 10969133 24376 24.21 40435 89384 93.2 181.6 40.8% 0.0% 0.0% 0.0% 4.72sec 10969133 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 5381502 11931 10.55 40344 108153 79.3 79.3 40.7% 0.1% 0.0% 0.0% 5.49sec 5381502 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear ticks -48045 3951 9 0.01 21938 46506 0.0 0.1 40.2% 0.1% 0.0% 0.0% 148.37sec 3951 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_mastery 124469 1926 4 0.01 21950 55748 0.1 0.1 40.2% 0.1% 0.0% 0.0% 0.61sec 1926 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 11518107 25535 7.80 133232 289711 58.7 58.7 40.4% 0.1% 0.0% 0.0% 7.44sec 11518107 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 4582258 10159 29.90 20388 0 224.8 224.8 0.0% 0.0% 0.0% 0.0% 2.04sec 4582258 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.76sec 0 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 4260437 9445 2.14 180198 390168 16.1 16.1 40.5% 0.1% 0.0% 0.0% 4.66sec 4260437 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 14464123 32142 53.96 24361 52746 76.9 404.7 40.1% 0.0% 0.0% 0.0% 5.83sec 14464123 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 7123341 15792 23.49 24403 64207 176.8 176.6 40.1% 0.1% 0.0% 0.0% 2.53sec 7123341 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 9937136 22030 30.71 29178 63516 233.1 230.8 40.4% 0.0% 0.0% 0.0% 1.92sec 9937136 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.85sec 0 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 916242 2031 0.66 110105 277703 5.0 5.0 44.3% 0.1% 0.0% 0.0% 63.56sec 916242 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 11609176 25798 32.49 32212 70262 48.8 243.7 40.5% 0.0% 0.0% 0.0% 9.17sec 11609176 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 5625574 12472 14.15 31839 84163 106.4 106.3 40.3% 0.1% 0.0% 0.0% 4.15sec 5625574 451.07sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 3719779 104825 56.65 72783 174441 33.5 33.5 41.6% 0.1% 24.0% 0.0% 11.72sec 3719779 35.49sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.39sec 0 35.49sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 13045 368 2.36 5575 13689 1.4 1.4 46.7% 0.1% 0.0% 0.0% 1.73sec 13045 35.49sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 3971639 8805 1.86 194441 419665 14.0 14.0 40.1% 0.1% 0.0% 0.0% 31.67sec 3971639 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 2966497 6577 7.36 32612 84912 55.4 55.3 40.2% 0.1% 0.0% 0.0% 7.54sec 2966497 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 6010660 13357 16.92 32424 69706 14.0 126.9 40.1% 0.0% 0.0% 0.0% 31.67sec 6010660 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 9218612 20486 22.20 25407 55714 0.0 166.5 40.3% 0.1% 0.0% 0.0% 0.00sec 9218612 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 1.47 0 0 11.0 11.0 40.1% 0.1% 0.0% 0.0% 42.41sec 0 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 2874096 6372 1.48 177813 383664 11.0 11.1 39.6% 0.1% 0.0% 0.0% 42.41sec 2874096 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 0 0 16.11 0 0 11.0 121.1 43.0% 0.0% 0.0% 0.0% 42.41sec 42697122 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 8317858 18440 4.80 157786 340709 36.1 36.1 39.8% 0.1% 0.0% 0.0% 12.52sec 8317858 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 10700358 23779 23.37 41067 90190 93.1 175.3 40.7% 0.0% 0.0% 0.0% 4.72sec 10700358 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 5244787 11627 10.18 40976 109087 76.6 76.5 40.5% 0.1% 0.0% 0.0% 5.71sec 5244787 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear ticks -48045 3097 7 0.00 23346 49552 0.0 0.0 38.1% 0.1% 0.0% 0.0% 92.12sec 3097 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_mastery 124469 1600 4 0.01 23442 59624 0.0 0.0 40.5% 0.0% 0.0% 0.0% 3.57sec 1600 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 11264864 24974 7.41 137782 298223 55.7 55.7 40.2% 0.1% 0.0% 0.0% 7.80sec 11264864 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 4596648 10191 28.86 21187 0 217.0 217.0 0.0% 0.0% 0.0% 0.0% 2.11sec 4596648 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 4826744 10701 2.13 205546 443070 16.0 16.0 40.3% 0.1% 0.0% 0.0% 4.67sec 4826744 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 14332797 31851 51.99 25083 54251 76.9 389.9 40.0% 0.0% 0.0% 0.0% 5.84sec 14332797 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 7065981 15665 22.64 25162 66087 170.3 170.2 40.0% 0.1% 0.0% 0.0% 2.63sec 7065981 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 9829435 21791 29.54 30056 65289 224.2 222.1 40.3% 0.0% 0.0% 0.0% 2.00sec 9829435 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.86sec 0 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 831655 1844 0.62 108437 268666 4.7 4.7 43.9% 0.1% 0.0% 0.0% 69.83sec 831655 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 10990546 24423 30.38 32767 71113 48.3 227.9 40.3% 0.0% 0.0% 0.0% 9.24sec 10990546 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 5385618 11940 13.24 32726 85955 99.6 99.5 40.3% 0.1% 0.0% 0.0% 4.42sec 5385618 451.07sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 3704671 104402 56.65 72531 173740 33.5 33.5 41.6% 0.1% 24.0% 0.0% 11.73sec 3704671 35.48sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.38sec 0 35.48sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 13177 371 2.38 5570 13714 1.4 1.4 46.6% 0.1% 0.0% 0.0% 1.70sec 13177 35.48sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 5206470 11543 2.58 183084 395700 19.4 19.4 40.1% 0.1% 0.0% 0.0% 22.58sec 5206470 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 3912865 8675 10.29 30711 80105 77.5 77.4 40.3% 0.1% 0.0% 0.0% 5.47sec 3912865 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 7984070 17742 23.65 30722 66201 19.4 177.4 40.3% 0.0% 0.0% 0.0% 22.58sec 7984070 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 9453464 21008 21.74 24192 52715 0.0 163.0 40.3% 0.1% 0.0% 0.0% 0.00sec 9453464 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.47 0 0 11.0 11.0 39.9% 0.1% 0.0% 0.0% 42.37sec 0 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 2788589 6182 1.50 170235 365842 11.0 11.2 39.8% 0.1% 0.0% 0.0% 42.37sec 2788589 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 0 0 16.00 0 0 11.0 120.3 43.1% 0.0% 0.0% 0.0% 42.37sec 40573529 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 13185733 29232 7.07 169824 366478 53.1 53.1 39.9% 0.1% 0.0% 0.0% 8.44sec 13185733 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 12763188 28363 29.03 39490 86647 118.4 217.7 40.6% 0.0% 0.0% 0.0% 3.72sec 12763188 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 6265807 13891 12.65 39420 104792 95.2 95.1 40.5% 0.1% 0.0% 0.0% 4.59sec 6265807 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear ticks -48045 26283 58 0.08 22307 47490 0.3 0.6 39.4% 0.1% 0.0% 0.0% 136.57sec 26283 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_mastery 124469 12798 28 0.05 22301 57250 0.4 0.4 39.5% 0.1% 0.0% 0.0% 28.93sec 12798 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.81sec 0 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 4440747 9845 30.46 19390 0 229.0 229.0 0.0% 0.0% 0.0% 0.0% 2.01sec 4440747 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 4346960 9637 2.11 187524 403852 15.8 15.8 40.3% 0.1% 0.0% 0.0% 4.72sec 4346960 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 13724675 30499 52.07 23988 51855 77.2 390.6 40.0% 0.0% 0.0% 0.0% 5.82sec 13724675 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 6788478 15050 22.68 24131 63336 170.6 170.5 40.1% 0.1% 0.0% 0.0% 2.62sec 6788478 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 9449562 20949 29.60 28838 62627 224.7 222.5 40.3% 0.0% 0.0% 0.0% 1.99sec 9449562 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 815422 1808 0.62 106042 264946 4.6 4.6 43.8% 0.1% 0.0% 0.0% 68.13sec 815422 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 10297470 22883 29.53 31543 68517 45.7 221.5 40.4% 0.0% 0.0% 0.0% 9.78sec 10297470 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 5018038 11125 12.86 31402 82492 96.7 96.7 40.2% 0.1% 0.0% 0.0% 4.56sec 5018038 451.07sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 9774839 83704 56.98 61801 135166 110.9 110.9 40.7% 0.1% 24.0% 0.0% 3.95sec 9774839 116.78sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.28sec 0 116.78sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 28922 248 1.92 4820 11502 3.7 3.7 43.9% 0.1% 0.0% 0.0% 70.57sec 28922 116.78sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 3927009 8706 1.93 184277 398458 14.5 14.5 40.2% 0.1% 0.0% 0.0% 30.87sec 3927009 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3013820 6682 7.84 31015 81074 59.0 58.9 40.3% 0.1% 0.0% 0.0% 7.22sec 3013820 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 6121589 13604 18.00 30911 66766 14.5 135.0 40.2% 0.0% 0.0% 0.0% 30.87sec 6121589 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 8710073 19356 21.25 24369 53514 0.0 159.4 40.3% 0.1% 0.0% 0.0% 0.00sec 8710073 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.47 0 0 11.1 11.1 39.9% 0.1% 0.0% 0.0% 42.24sec 0 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 2876922 6378 1.52 173039 372432 11.1 11.4 40.0% 0.1% 0.0% 0.0% 42.24sec 2876922 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 0 0 16.11 0 0 11.1 121.1 43.1% 0.0% 0.0% 0.0% 42.24sec 40882160 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 9068571 20105 5.02 164512 355892 37.7 37.7 39.7% 0.1% 0.0% 0.0% 11.96sec 9068571 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 14658758 32575 32.58 40260 88709 126.1 244.3 40.7% 0.0% 0.0% 0.0% 3.50sec 14658758 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 7206226 15976 14.19 40215 107545 106.7 106.7 40.7% 0.1% 0.0% 0.0% 4.10sec 7206226 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear ticks -48045 47396 105 0.13 23355 49993 0.5 1.0 40.8% 0.1% 0.0% 0.0% 145.30sec 47396 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_mastery 124469 22968 51 0.08 23368 60415 0.6 0.6 40.1% 0.2% 0.0% 0.0% 43.81sec 22968 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.85sec 0 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 4227905 9373 30.11 18680 0 226.3 226.3 0.0% 0.0% 0.0% 0.0% 2.02sec 4227905 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.86sec 0 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 4392730 9739 2.12 187809 405222 16.0 16.0 40.2% 0.1% 0.0% 0.0% 4.68sec 4392730 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 14630020 32511 54.88 24252 52468 82.5 411.6 40.0% 0.0% 0.0% 0.0% 5.44sec 14630020 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 7215896 15997 23.89 24322 63936 179.8 179.6 40.1% 0.1% 0.0% 0.0% 2.49sec 7215896 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 10045156 22270 31.18 29071 63230 236.7 234.4 40.3% 0.0% 0.0% 0.0% 1.89sec 10045156 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 940422 2085 0.67 111680 280962 5.0 5.0 44.2% 0.1% 0.0% 0.0% 62.15sec 940422 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 11479969 25511 32.26 32099 70030 48.9 241.9 40.5% 0.0% 0.0% 0.0% 9.14sec 11479969 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 5566630 12341 14.04 31764 83811 105.7 105.6 40.4% 0.1% 0.0% 0.0% 4.17sec 5566630 451.07sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 9810994 84062 56.99 62091 135504 110.8 110.8 40.8% 0.1% 24.0% 0.0% 3.95sec 9810994 116.71sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.71sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 28603 245 1.89 4848 11562 3.7 3.7 43.5% 0.1% 0.0% 0.0% 67.45sec 28603 116.71sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 4088694 9064 1.91 194269 419558 14.4 14.4 40.0% 0.1% 0.0% 0.0% 30.27sec 4088694 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3073245 6813 7.59 32750 85335 57.1 57.0 40.3% 0.1% 0.0% 0.0% 7.23sec 3073245 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 6190986 13758 17.44 32383 69647 14.4 130.8 40.1% 0.0% 0.0% 0.0% 30.27sec 6190986 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 8793048 19540 20.37 25353 55418 0.0 152.8 40.2% 0.1% 0.0% 0.0% 0.00sec 8793048 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 1.47 0 0 11.1 11.1 39.8% 0.1% 0.0% 0.0% 42.25sec 0 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 2946275 6532 1.51 178295 383920 11.1 11.3 40.0% 0.1% 0.0% 0.0% 42.25sec 2946275 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 0 0 16.04 0 0 11.1 120.6 43.1% 0.0% 0.0% 0.0% 42.25sec 42605650 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 9319555 20661 4.97 170964 368619 37.4 37.4 39.7% 0.1% 0.0% 0.0% 12.06sec 9319555 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 14196107 31547 31.19 40935 89629 124.4 233.9 40.6% 0.0% 0.0% 0.0% 3.54sec 14196107 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 6963927 15439 13.58 40896 108483 102.1 102.1 40.5% 0.1% 0.0% 0.0% 4.28sec 6963927 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear ticks -48045 25201 56 0.06 23163 48968 0.2 0.5 39.4% 0.1% 0.0% 0.0% 135.96sec 25201 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_mastery 124469 12293 27 0.04 23110 59284 0.3 0.3 39.3% 0.2% 0.0% 0.0% 21.52sec 12293 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.88sec 0 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 4234155 9387 28.98 19436 0 217.9 217.9 0.0% 0.0% 0.0% 0.0% 2.10sec 4234155 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 4992021 11067 2.12 213893 460615 15.9 15.9 40.4% 0.1% 0.0% 0.0% 4.69sec 4992021 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 14592221 32427 53.05 25037 54128 82.6 397.9 40.0% 0.0% 0.0% 0.0% 5.43sec 14592221 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 7198431 15959 23.11 25148 65947 173.8 173.7 40.0% 0.1% 0.0% 0.0% 2.57sec 7198431 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 9998169 22166 30.12 30024 65145 228.7 226.5 40.2% 0.0% 0.0% 0.0% 1.95sec 9998169 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 835785 1853 0.62 109346 270538 4.6 4.6 43.9% 0.1% 0.0% 0.0% 68.04sec 835785 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 10878761 24175 30.26 32606 70678 48.4 227.0 40.3% 0.0% 0.0% 0.0% 9.22sec 10878761 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 5341527 11842 13.18 32665 85661 99.2 99.1 40.2% 0.1% 0.0% 0.0% 4.45sec 5341527 451.07sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 9775262 83796 56.99 61930 135067 110.8 110.8 40.8% 0.1% 24.0% 0.0% 3.96sec 9775262 116.66sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.66sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 26681 229 1.72 4923 11811 3.4 3.4 44.2% 0.1% 0.0% 0.0% 60.83sec 26681 116.66sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 5105188 11318 2.53 182879 395386 19.0 19.0 40.2% 0.1% 0.0% 0.0% 23.03sec 5105188 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 3838041 8509 10.11 30673 79993 76.1 76.0 40.2% 0.1% 0.0% 0.0% 5.55sec 3838041 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 7804509 17343 23.23 30595 65911 19.0 174.2 40.2% 0.0% 0.0% 0.0% 23.03sec 7804509 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 9458457 21019 21.71 24187 52734 0.0 162.8 40.3% 0.1% 0.0% 0.0% 0.00sec 9458457 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 1.37 0 0 10.3 10.3 39.9% 0.1% 0.0% 0.0% 45.47sec 0 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 2767493 6135 1.49 169588 363263 10.3 11.2 39.8% 0.1% 0.0% 0.0% 45.47sec 2767493 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 0 0 14.75 0 0 10.3 110.9 43.0% 0.0% 0.0% 0.0% 45.47sec 37278806 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 12924006 28652 6.92 169693 366626 52.1 52.1 40.0% 0.1% 0.0% 0.0% 8.61sec 12924006 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 8355176 18567 18.74 39729 88104 73.9 140.6 40.7% 0.0% 0.0% 0.0% 5.79sec 8355176 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 4107918 9107 8.16 39683 106794 61.4 61.4 40.7% 0.1% 0.0% 0.0% 6.83sec 4107918 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 11072686 24606 12.94 77970 167639 52.1 97.0 40.3% 0.0% 0.0% 0.0% 8.12sec 11072686 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 4941090 10954 5.64 70959 184831 42.4 42.4 40.2% 0.1% 0.0% 0.0% 9.87sec 4941090 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear ticks -48045 39836 89 0.09 22089 46905 0.3 0.6 39.1% 0.0% 0.0% 0.0% 113.47sec 39836 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_mastery 124469 19592 43 0.07 22084 56899 0.5 0.5 39.3% 0.1% 0.0% 0.0% 21.13sec 19592 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 4700538 10421 30.08 20789 0 226.1 226.1 0.0% 0.0% 0.0% 0.0% 2.03sec 4700538 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 4288720 9508 2.08 187011 402655 15.7 15.7 40.3% 0.1% 0.0% 0.0% 4.77sec 4288720 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 13108210 29129 49.77 23967 51826 76.3 373.3 40.0% 0.0% 0.0% 0.0% 5.87sec 13108210 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 6486364 14380 21.67 24120 63328 163.1 162.9 40.1% 0.1% 0.0% 0.0% 2.74sec 6486364 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 9034729 20030 28.30 28830 62622 214.7 212.8 40.3% 0.0% 0.0% 0.0% 2.08sec 9034729 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.83sec 0 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 837937 1858 0.64 105091 261847 4.8 4.8 43.7% 0.1% 0.0% 0.0% 67.07sec 837937 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 9514312 21143 27.31 31511 68506 41.3 204.8 40.4% 0.0% 0.0% 0.0% 10.79sec 9514312 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 4645591 10299 11.89 31394 82642 89.4 89.4 40.2% 0.1% 0.0% 0.0% 4.92sec 4645591 451.07sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 3698978 104227 56.65 72504 173370 33.5 33.5 41.6% 0.1% 24.0% 0.0% 11.72sec 3698978 35.49sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.36sec 0 35.49sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 13088 369 2.37 5549 13668 1.4 1.4 47.0% 0.1% 0.0% 0.0% 1.76sec 13088 35.49sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 3914975 8679 1.93 184218 398301 14.5 14.5 40.0% 0.1% 0.0% 0.0% 30.91sec 3914975 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 3046751 6755 7.92 31026 81138 59.6 59.5 40.3% 0.1% 0.0% 0.0% 7.13sec 3046751 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 6167942 13707 18.20 30833 66577 14.5 136.5 40.2% 0.0% 0.0% 0.0% 30.91sec 6167942 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 8660242 19245 21.11 24362 53522 0.0 158.3 40.2% 0.1% 0.0% 0.0% 0.00sec 8660242 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 1.38 0 0 10.4 10.4 40.1% 0.1% 0.0% 0.0% 45.16sec 0 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 2908956 6449 1.54 171902 368838 10.4 11.6 40.0% 0.1% 0.0% 0.0% 45.16sec 2908956 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 0 0 15.09 0 0 10.4 113.4 43.0% 0.0% 0.0% 0.0% 45.16sec 38234365 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 9072434 20113 5.03 164312 355276 37.8 37.8 39.7% 0.1% 0.0% 0.0% 11.95sec 9072434 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 10464256 23254 23.00 40454 89954 87.0 172.5 40.8% 0.0% 0.0% 0.0% 4.96sec 10464256 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 5161508 11443 10.03 40475 109253 75.4 75.4 40.8% 0.1% 0.0% 0.0% 5.63sec 5161508 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 9356563 20792 10.74 79246 170802 43.2 80.5 40.3% 0.0% 0.0% 0.0% 9.91sec 9356563 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 4250385 9423 4.67 73630 191789 35.2 35.1 40.1% 0.1% 0.0% 0.0% 12.02sec 4250385 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear ticks -48045 41704 93 0.08 22185 47094 0.3 0.6 39.7% 0.1% 0.0% 0.0% 126.81sec 41704 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_mastery 124469 20270 45 0.08 22152 56917 0.6 0.6 39.5% 0.2% 0.0% 0.0% 24.51sec 20270 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 4488842 9952 30.05 19869 0 225.9 225.9 0.0% 0.0% 0.0% 0.0% 2.03sec 4488842 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.77sec 0 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 4352710 9650 2.11 187448 404462 15.8 15.8 40.4% 0.1% 0.0% 0.0% 4.72sec 4352710 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 14466028 32147 54.30 24242 52441 84.0 407.3 40.0% 0.0% 0.0% 0.0% 5.34sec 14466028 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 7137270 15823 23.65 24315 63904 177.9 177.8 40.0% 0.1% 0.0% 0.0% 2.52sec 7137270 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 9935287 22026 30.86 29059 63212 234.1 232.0 40.3% 0.0% 0.0% 0.0% 1.91sec 9935287 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.93sec 0 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 964414 2138 0.70 110393 276423 5.3 5.3 44.2% 0.1% 0.0% 0.0% 60.86sec 964414 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 11172248 24827 31.38 32103 70074 47.4 235.4 40.5% 0.0% 0.0% 0.0% 9.41sec 11172248 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 5410796 11996 13.66 31731 83858 102.8 102.7 40.3% 0.1% 0.0% 0.0% 4.29sec 5410796 451.07sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 3732207 105197 56.65 72884 174923 33.5 33.5 41.8% 0.1% 23.9% 0.0% 11.72sec 3732207 35.48sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.39sec 0 35.48sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 12980 366 2.35 5539 13668 1.4 1.4 46.9% 0.1% 0.0% 0.0% 1.73sec 12980 35.48sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 4224096 9365 1.98 193741 420473 14.9 14.9 40.0% 0.1% 0.0% 0.0% 29.22sec 4224096 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3198966 7092 7.89 32650 85531 59.4 59.3 40.3% 0.1% 0.0% 0.0% 6.95sec 3198966 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 6433226 14296 18.16 32243 69698 14.9 136.2 40.0% 0.0% 0.0% 0.0% 29.22sec 6433226 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 9009529 20021 20.74 25332 55374 0.0 155.6 40.2% 0.1% 0.0% 0.0% 0.00sec 9009529 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 1.37 0 0 10.3 10.3 40.1% 0.1% 0.0% 0.0% 45.64sec 0 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 2997318 6645 1.55 177602 379513 10.3 11.6 39.8% 0.1% 0.0% 0.0% 45.64sec 2997318 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 0 0 14.62 0 0 10.3 109.9 43.0% 0.0% 0.0% 0.0% 45.64sec 38781908 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 9847527 21832 5.17 173807 374479 38.9 38.9 39.7% 0.1% 0.0% 0.0% 11.59sec 9847527 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 9676838 21504 21.16 40906 90217 83.3 158.7 40.7% 0.0% 0.0% 0.0% 5.17sec 9676838 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 4762495 10558 9.22 40890 109309 69.4 69.3 40.7% 0.1% 0.0% 0.0% 6.13sec 4762495 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 9860898 21913 10.94 82048 176722 45.0 82.1 40.2% 0.0% 0.0% 0.0% 9.18sec 9860898 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 4503052 9983 4.77 76286 199235 35.9 35.8 40.2% 0.1% 0.0% 0.0% 11.44sec 4503052 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear ticks -48045 24813 55 0.04 23544 50174 0.2 0.3 40.1% 0.0% 0.0% 0.0% 119.20sec 24813 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_mastery 124469 12220 27 0.04 23609 60267 0.3 0.3 40.2% 0.1% 0.0% 0.0% 15.93sec 12220 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 4568241 10128 29.18 20821 0 219.4 219.4 0.0% 0.0% 0.0% 0.0% 2.09sec 4568241 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 4947765 10969 2.10 213367 460088 15.8 15.8 40.4% 0.1% 0.0% 0.0% 4.73sec 4947765 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 14362533 31917 52.25 25025 54099 83.8 391.9 40.0% 0.0% 0.0% 0.0% 5.34sec 14362533 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 7087640 15713 22.75 25146 65943 171.1 171.0 40.0% 0.1% 0.0% 0.0% 2.61sec 7087640 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 9853485 21845 29.68 30030 65166 225.1 223.1 40.2% 0.0% 0.0% 0.0% 1.99sec 9853485 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.93sec 0 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 869942 1929 0.65 108399 267346 4.9 4.9 43.8% 0.1% 0.0% 0.0% 65.15sec 869942 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 10618017 23596 29.56 32575 70599 47.4 221.7 40.3% 0.0% 0.0% 0.0% 9.39sec 10618017 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 5214177 11560 12.88 32625 85620 96.9 96.8 40.1% 0.1% 0.0% 0.0% 4.54sec 5214177 451.07sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 3716270 104750 56.65 72638 174137 33.5 33.5 41.7% 0.1% 23.9% 0.0% 11.73sec 3716270 35.48sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.39sec 0 35.48sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 12947 365 2.35 5541 13636 1.4 1.4 46.8% 0.1% 0.0% 0.0% 1.73sec 12947 35.48sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.07% 8.07%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.54% 8.54%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.57% 10.57%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.93% 10.93%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.25% 11.25%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.30% 11.30%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.76% 10.76%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.98% 11.98%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.39% 10.39%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.21% 6.21%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.21%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:0.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:0.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:0.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:0.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:0.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:0.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:0.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2306112.95
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 25407
death count pct 101.63
avg death time 451.02
min death time 343.71
max death time 555.60
dmg taken 1040626120.77

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 451.07
Minimum 343.71
Maximum 555.60
Spread ( max - min ) 211.90
Range [ ( max - min ) / 2 * 100% ] 23.49%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 2309434.04
Minimum 2199311.65
Maximum 2438587.51
Spread ( max - min ) 239275.86
Range [ ( max - min ) / 2 * 100% ] 5.18%
Standard Deviation 33099.7642
5th Percentile 2257155.03
95th Percentile 2365766.37
( 95th Percentile - 5th Percentile ) 108611.34
Mean Distribution
Standard Deviation 209.3748
95.00% Confidence Intervall ( 2309023.68 - 2309844.41 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 789
0.1 Scale Factor Error with Delta=300 9352623
0.05 Scale Factor Error with Delta=300 37410495
0.01 Scale Factor Error with Delta=300 935262385
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 831279686 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
312597.6 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100 http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.3s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 312597.61
Combat End Resource Mean Min Max
Health 1037659024.79 827689771.08 1244664660.05

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 94.27
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.52%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 312426.95
Minimum 258558.23
Maximum 370183.35
Spread ( max - min ) 111625.12
Range [ ( max - min ) / 2 * 100% ] 17.86%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add2 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
274582.0 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add2 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100 http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add2 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.3s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 274581.96
Combat End Resource Mean Min Max
Health 1038073250.00 828419828.29 1244670869.05

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 24992
Mean 94.27
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.52%
DPS
Sample Data Add2 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add2 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 24992
Mean 274274.63
Minimum 226016.83
Maximum 337042.84
Spread ( max - min ) 111026.01
Range [ ( max - min ) / 2 * 100% ] 20.24%
HPS
Sample Data Add2 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add2 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add3 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
257356.6 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add3 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-nan,100 http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add3 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.3s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 257356.57
Combat End Resource Mean Min Max
Health 1038303825.71 828481075.26 1245133323.97

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 24992
Mean 94.27
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.52%
DPS
Sample Data Add3 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add3 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 24992
Mean 257035.40
Minimum 210403.52
Maximum 315367.28
Spread ( max - min ) 104963.76
Range [ ( max - min ) / 2 * 100% ] 20.42%
HPS
Sample Data Add3 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add3 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.