close

SimulationCraft 540-5

for World of Warcraft 5.4.0 Live (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 flying,first=0,duration=500,cooldown=500
1 position_switch,first=0,duration=500,cooldown=500
2 stun,duration=1.0,first=45.0,period=45.0
3 stun,duration=1.0,first=57.0,period=57.0
4 damage,first=6.0,period=6.0,last=59.5,amount=44000,type=shadow
5 damage,first=60.0,period=5.0,last=119.5,amount=44855,type=shadow
6 damage,first=120.0,period=4.0,last=179.5,amount=44855,type=shadow
7 damage,first=180.0,period=3.0,last=239.5,amount=44855,type=shadow
8 damage,first=240.0,period=2.0,last=299.5,amount=44855,type=shadow
9 damage,first=300.0,period=1.0,amount=44855,type=shadow
10 adds,count=1,first=30,cooldown=60,duration=20
HPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 7.53 - 5.83 - - - 6.84 - 4.67 5.33 4.47 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 7.63 - 5.77 - - - 6.31 - 4.86 4.97 4.55 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 7.36 - 5.89 - - - 7.16 - 4.63 4.84 4.32 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 7.58 - 5.93 - - - 7.02 - 4.78 5.45 4.74 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 7.46 - 5.91 - - - 6.72 - 4.79 4.72 4.82 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 7.49 - 5.88 - - - 7.58 - 4.67 5.56 4.70 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 7.64 - 5.91 - - - 8.26 - 4.69 6.76 5.12 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 7.70 - 6.03 - - - 8.30 - 4.80 5.63 5.09 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 7.85 - 6.18 - - - 8.62 - 4.89 8.43 5.20 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 309582 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
309582.0 309582.0 126.94 / 0.04% 16760 / 5.4% 66.2 9937.5 9937.5 80.33 / 0.81% 10598 / 106.7% 2.2 4546.3 4512.6 Mana 0.80% 51.3 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.53 5.83 6.84 4.67 5.33 4.47
Normalized 1.00 0.77 0.91 0.62 0.71 0.59
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.19 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.53, SpellDamage=5.83, HitRating=6.84, CritRating=4.67, HasteRating=5.33, MasteryRating=4.47 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.53, SpellDamage=5.83, HitRating=0.00, CritRating=4.67, HasteRating=5.33, MasteryRating=4.47 )

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:878298|663554|431971|308699|239937|219902|189121|122235&chds=0,1756595&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++878298++devouring_plague,9482C9,0,0,15|t++663554++shadow_word_pain,9482C9,1,0,15|t++431971++vampiric_touch,9482C9,2,0,15|t++308699++halo,9482C9,3,0,15|t++239937++shadow_word_death,9482C9,4,0,15|t++219902++mind_blast,9482C9,5,0,15|t++189121++mind_spike,4A79D3,6,0,15|t++122235++mind_flay,9482C9,7,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,10,9,9,7,6,6,5,5,4,4,4,3,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_spike|vampiric_touch|mind_blast|mind_flay|shadow_word_pain|devouring_plague_tick|essence_of_yulon|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadow_word_pain_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadow_word_death|shadowfiend: melee|halo_damage|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.53,6.84,5.83,5.33,4.67,4.47|7.35,6.66,5.65,5.15,4.49,4.29|7.70,7.03,6.01,5.50,4.85,4.65&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.53++Int,FFFFFF,0,0,15,0.1,e|t++++6.84++Hit,FFFFFF,0,1,15,0.1,e|t++++5.83++SP,FFFFFF,0,2,15,0.1,e|t++++5.33++Haste,FFFFFF,0,3,15,0.1,e|t++++4.67++Crit,FFFFFF,0,4,15,0.1,e|t++++4.47++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.040& http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dhknqtuwy02567786420yvussrssttuttttsrrrrrsssrqpnmlkihfedddcccbbaaaaaaaaabbbbbbbaaZZYYZacdeeffgghhhhhiijjjiiggfeddccccccccccdddddeeeffgggghgggggffghiiijjkkkkkkkkkkkklkkjiigeeeeeeeffghihhhhhhghiihhggfeddcbabbcddefghhiiiihhhiiiiihggfeddcbbbbccdddddddddeeeeffgggghgfffffghiijjkklkkkkkllmmmlkjjihgffeeffffgggggggggggghhhhhhhhhggffghhijklklmnnoooppqqrrrqqponnmmmkhfdbZXVTR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5806,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=309582|max=533223&chxp=1,1,58,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,5,12,12,20,41,50,91,147,251,278,440,569,691,845,1096,1141,1346,1465,1527,1574,1572,1561,1491,1397,1313,1102,1038,859,663,573,424,343,259,208,155,135,76,69,53,28,21,21,13,8,4,0,1,1&chds=0,1574&chbh=5&chxt=x&chxl=0:|min=272502|avg=309582|max=354001&chxp=0,1,45,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:33.7,16.9,13.5,10.4,8.9,4.9,3.8,2.6,0.9,0.8&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 123.3s|mind_spike 61.9s|mind_blast 49.5s|vampiric_touch 37.9s|shadow_word_pain 32.7s|devouring_plague 17.9s|shadow_word_death 14.1s|halo 9.6s|shadowfiend 3.2s|waiting 2.9s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 309582
devouring_plague 12675 (42896) 4.1% (13.9%) 16.6 21.60sec 946668 878298 191603 412125 279734 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.58 16.58 0.00 0.00 1.0779 0.0000 4637554.38 4637554.38 0.00 878297.64 878297.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.91 59.80% 191603.33 169721 307820 191560.77 169721 262705 1899593 1899593 0.00
crit 6.64 40.07% 412125.13 353627 769642 412245.52 0 625930 2737962 2737962 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9918 3.2% 69.2 4.97sec 52459 0 32040 83194 52525 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.17 69.08 0.00 0.00 0.0000 0.0000 3628617.42 3628617.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.27 59.74% 32039.60 28287 51304 32044.06 28827 37115 1322398 1322398 0.00
crit 27.72 40.13% 83193.62 71200 159064 83147.65 72202 105008 2306219 2306219 0.00
miss 0.09 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20303 6.6% 16.6 21.60sec 448059 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.3 32119 68990 46925 40.2% 0.0% 27.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.58 16.58 158.30 158.30 0.0000 0.6424 7428128.66 7428128.66 0.00 73051.11 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.7 59.84% 32119.26 28287 93503 32124.69 28811 69949 3042743 3042743 0.00
crit 63.6 40.16% 68990.18 58939 195241 68948.01 59819 143632 4385386 4385386 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19364 6.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 144.0 25362 54819 37201 40.3% 0.1% 31.2%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 29.93 144.00 190.44 0.0000 0.7922 7084552.75 7084552.75 0.00 62107.06 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.5 59.63% 25361.59 21101 40897 25372.85 23021 29055 2879808 2879808 0.00
crit 76.7 40.28% 54818.71 43965 102254 54818.02 48350 63863 4204744 4204744 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8113) 0.0% (2.6%) 8.9 43.37sec 332787 308699 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.92 8.92 0.00 0.00 1.0781 0.0000 0.00 0.00 0.00 308699.38 308699.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.30 59.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.61 40.45% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8113 2.6% 8.9 43.37sec 332787 0 179055 381372 260401 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.92 11.40 0.00 0.00 0.0000 0.0000 2968144.53 2968144.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.79 59.59% 179054.64 153853 275756 179103.69 153853 245216 1216117 1216117 0.00
crit 4.59 40.30% 381371.61 320566 689472 380501.46 0 612084 1752027 1752027 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 29757 9.6% 45.9 7.98sec 237012 219902 162091 349916 237013 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.93 45.93 0.00 0.00 1.0778 0.0000 10887120.63 10887120.63 0.00 219901.85 219901.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.50 59.87% 162091.11 135799 396163 162025.66 139432 194590 4457593 4457593 0.00
crit 18.37 40.00% 349916.43 282948 990526 349884.94 286368 446879 6429527 6429527 0.00
miss 0.06 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 27648 (41199) 8.9% (13.3%) 81.8 4.33sec 184209 122235 0 0 0 0.0% 0.1% 0.0% 0.0% 162.7 41631 92071 62168 40.7% 0.0% 28.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.83 81.83 162.71 162.71 1.5070 0.6304 10115583.03 10115583.03 0.00 122234.51 122234.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.72 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.5 59.28% 41631.14 35993 65277 41639.05 37475 46211 4015937 4015937 0.00
crit 66.2 40.72% 92071.49 74995 163211 92060.34 79589 107188 6099646 6099646 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 13551 4.4% 71.1 4.87sec 69747 0 41502 111376 69764 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.09 71.07 0.00 0.00 0.0000 0.0000 4958132.03 4958132.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.18 59.35% 41502.14 35993 65277 41508.01 37072 48446 1750479 1750479 0.00
crit 28.80 40.52% 111376.34 90596 202384 111374.66 93674 137883 3207653 3207653 0.00
miss 0.09 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 31985 10.3% 57.5 6.14sec 203494 189121 138917 300320 203497 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.51 57.51 0.00 0.00 1.0760 0.0000 11702211.39 11702211.39 0.00 189120.54 189120.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.36 59.75% 138917.39 110446 323346 138993.09 118009 166302 4772887 4772887 0.00
crit 23.07 40.12% 300320.50 230124 808460 300432.47 239161 402027 6929325 6929325 0.00
miss 0.08 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 12040 3.9% 193.4 1.90sec 22783 0 22784 0 22784 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 193.35 193.35 0.00 0.00 0.0000 0.0000 4405199.33 4405199.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 193.35 100.00% 22783.78 7034 330175 22788.34 16783 31613 4405199 4405199 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:31712.64
  • base_dd_max:31712.64
shadow_word_death 9215 3.0% 13.0 4.64sec 259812 239937 180572 381744 259814 39.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.0828 0.0000 3371356.98 3371356.98 0.00 239937.16 239937.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.83 60.35% 180572.50 152630 446332 180662.48 0 299481 1414206 1414206 0.00
crit 5.13 39.51% 381743.70 318016 929969 381189.90 0 755600 1957151 1957151 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 27094 (59217) 8.8% (19.1%) 30.2 12.19sec 716385 663554 0 0 0 0.0% 0.1% 0.0% 0.0% 271.6 24996 53679 36496 40.1% 0.0% 127.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.24 30.24 271.62 271.62 1.0796 1.7145 9913090.70 9913090.70 0.00 43475.02 663553.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.22 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.7 59.91% 24995.74 21342 40629 25000.02 23100 27761 4067236 4067236 0.00
crit 108.9 40.09% 53678.94 44467 101583 53662.65 48212 61194 5845854 5845854 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 13429 4.3% 118.7 3.04sec 41405 0 25245 65741 41433 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.67 118.59 0.00 0.00 0.0000 0.0000 4913420.14 4913420.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.93 59.82% 25245.17 22409 40629 25247.63 23266 28426 1790744 1790744 0.00
crit 47.50 40.05% 65740.53 56403 125965 65731.24 58174 75981 3122676 3122676 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0854 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 18693 6.0% 156.4 2.31sec 43728 0 30109 64925 44109 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.40 155.05 0.00 0.00 0.0000 0.0000 6839176.84 6839176.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.70 59.79% 30108.67 26478 48441 30107.20 27734 33945 2791122 2791122 0.00
crit 62.35 40.21% 64925.18 55169 121116 64900.20 58194 74986 4048055 4048055 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2495 0.8% 4.9 64.61sec 185179 0 111837 279966 185180 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.93 4.93 0.00 0.00 0.0000 0.0000 912771.98 912771.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.77 56.16% 111836.74 83080 153360 106197.69 0 153360 309573 309573 0.00
crit 2.15 43.71% 279965.52 173104 383445 249471.91 0 383445 603199 603199 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:118198.80
  • base_dd_max:118198.80
vampiric_touch 29931 (44729) 9.7% (14.4%) 35.1 10.34sec 466131 431971 0 0 0 0.0% 0.1% 0.0% 0.0% 229.9 32469 70183 47629 40.2% 0.0% 120.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.11 35.11 229.92 229.92 1.0791 1.9207 10950819.72 10950819.72 0.00 34130.03 431970.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.08 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.5 59.80% 32469.15 27457 53135 32474.99 29947 37073 4464580 4464580 0.00
crit 92.4 40.20% 70182.65 57209 132854 70162.82 63383 80980 6486240 6486240 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 14799 4.8% 100.4 3.56sec 53902 0 32745 85638 53937 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.45 100.38 0.00 0.00 0.0000 0.0000 5414392.27 5414392.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.96 59.73% 32744.98 28830 53135 32747.68 29920 36685 1963284 1963284 0.00
crit 40.30 40.15% 85638.33 72566 164741 85625.01 74133 101316 3451109 3451109 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 112657 / 8574
melee 112197 2.8% 28.1 13.76sec 111245 121584 77074 181250 111244 42.1% 7.4% 23.9% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.08 28.08 0.00 0.00 0.9150 0.0000 3124096.68 3124096.68 0.00 121583.84 121583.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.92 24.65% 77017.34 57590 120110 77164.46 0 120110 533198 533198 0.00
hit (blocked) 0.53 1.90% 77807.75 57590 120110 32373.90 0 120110 41412 41412 0.00
crit 10.98 39.10% 181129.18 115181 288264 180695.51 129248 264690 1988926 1988926 0.00
crit (blocked) 0.86 3.05% 182805.54 115181 288264 105719.06 0 288264 156352 156352 0.00
glance 6.23 22.20% 60139.08 43193 90083 60102.13 0 90083 374945 374945 0.00
glance (blocked) 0.48 1.71% 60799.72 43193 90083 23373.06 0 90083 29262 29262 0.00
parry 2.04 7.25% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 89.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 4.99 0.00 0.00 1.0748 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 460 0.0% 1.3 1.70sec 9925 0 5886 14492 9926 47.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.29 1.29 0.00 0.00 0.0000 0.0000 12799.60 12799.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.68 52.87% 5885.81 4377 7078 3013.06 0 7078 4013 4013 0.00
crit 0.61 47.02% 14491.63 10506 16987 6804.27 0 16987 8787 8787 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_FDCL_DI 9937
halo_heal 9937 100.0% 8.9 43.37sec 407662 0 37193 39121 38038 43.8% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.92 95.58 0.00 0.00 0.0000 0.0000 3635957.90 33624706.84 89.19 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.67 56.15% 37192.80 0 350167 36990.97 0 141180 1996271 12600988 84.22
crit 41.91 43.85% 39120.67 0 627970 38858.35 0 181526 1639687 21023718 92.21
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_FDCL_DI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.75%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 18.1 1.4 18.9sec 17.5sec 7.98% 38.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:7.98%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 16.6 0.0 21.7sec 21.7sec 11.71% 14.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:11.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.2 0.0 124.0sec 124.0sec 16.69% 16.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.69%

    Trigger Attempt Success

    • trigger_pct:99.79%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.0sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.80% 41.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.80%

    Trigger Attempt Success

    • trigger_pct:99.43%
shadow_word_death_reset_cooldown 6.6 0.0 9.8sec 9.8sec 14.88% 49.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.88%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 39.0 27.0 9.1sec 5.4sec 42.16% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:30.94%
  • surge_of_darkness_2:11.22%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 7.7 1.7 49.0sec 39.1sec 23.18% 52.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.18%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 53.7sec 53.5sec 17.91% 17.91%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.91%

    Trigger Attempt Success

    • trigger_pct:99.92%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.65% 0.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.65%

Trigger Attempt Success

  • trigger_pct:16.98%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.3sec 90.3sec 85.55% 76.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.43% 51.13%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.69% 20.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 16.6 49.7 3.0 3.0 315815.0
halo Mana 8.9 361217.9 40500.0 40499.6 8.2
mind_blast Mana 45.9 240280.6 5230.9 5230.9 45.3
mind_flay Mana 81.8 245487.4 3000.0 3000.0 61.4
shadow_word_death Mana 13.0 101221.5 7800.0 7800.6 33.3
shadow_word_pain Mana 30.2 399210.8 13200.0 13200.1 54.3
vampiric_touch Mana 35.1 315976.3 9000.0 9000.0 51.8
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 26.01 123609.16 (7.49%) 4752.81 110459.24 47.19%
Shadow Orbs from Mind Blast Shadow Orb 45.88 44.76 (87.23%) 0.98 1.12 2.43%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.55 6.55 (12.77%) 1.00 0.00 0.00%
Devouring Plague Health Health 227.39 2553166.88 (40.77%) 11228.22 2282095.10 47.20%
Vampiric Touch Mana Mana 330.30 1193118.12 (72.26%) 3612.18 487560.60 29.01%
halo_heal Health 8.92 315624.12 (5.04%) 35388.00 2763959.96 89.75%
external_healing Health 69.97 3112254.93 (49.70%) 44479.19 21399408.92 87.30%
mp5_regen Mana 1462.53 334315.82 (20.25%) 228.59 104443.36 23.80%
vampiric_embrace Health 118.64 281445.01 (4.49%) 2372.23 94439.90 25.12%
pet - shadowfiend
external_healing Health 12.79 138017.15 (97.15%) 10792.20 4853879.22 97.24%
vampiric_embrace Health 1.41 4052.83 (2.85%) 2871.25 1054.44 20.65%
Resource RPS-Gain RPS-Loss
Health 17116.49 17486.20
Mana 4512.59 4546.35
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 571040.15 55821.09 708811.00
Mana 286329.55 216900.00 300000.00
Shadow Orb 1.62 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.9%
shadowfiend-Mana Cap 23.9%
mindbender-Mana Cap 23.9%

Procs

Count Interval
Shadowy Recall Extra Tick 359.1 1.0sec
Shadowy Apparition Procced 156.4 2.3sec
Divine Insight Mind Blast CD Reset 33.1 17.5sec
FDCL Mind Spike proc 66.0 5.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 309581.96
Minimum 272501.89
Maximum 354001.23
Spread ( max - min ) 81499.34
Range [ ( max - min ) / 2 * 100% ] 13.16%
Standard Deviation 10239.0709
5th Percentile 293337.25
95th Percentile 326856.86
( 95th Percentile - 5th Percentile ) 33519.61
Mean Distribution
Standard Deviation 64.7679
95.00% Confidence Intervall ( 309455.01 - 309708.90 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4202
0.1 Scale Factor Error with Delta=300 894962
0.05 Scale Factor Error with Delta=300 3579849
0.01 Scale Factor Error with Delta=300 89496235
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 309581.96
Minimum 272501.89
Maximum 354001.23
Spread ( max - min ) 81499.34
Range [ ( max - min ) / 2 * 100% ] 13.16%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 110130272.77
Minimum 96835748.89
Maximum 126253023.15
Spread ( max - min ) 29417274.25
Range [ ( max - min ) / 2 * 100% ] 13.36%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 9937.48
Minimum 0.00
Maximum 37985.30
Spread ( max - min ) 37985.30
Range [ ( max - min ) / 2 * 100% ] 191.12%
Standard Deviation 6479.1224
5th Percentile 2308.10
95th Percentile 23504.93
( 95th Percentile - 5th Percentile ) 21196.82
Mean Distribution
Standard Deviation 40.9841
95.00% Confidence Intervall ( 9857.16 - 10017.81 )
Normalized 95.00% Confidence Intervall ( 99.19% - 100.81% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16329
0.1% Error 1632960
0.1 Scale Factor Error with Delta=300 358357
0.05 Scale Factor Error with Delta=300 1433428
0.01 Scale Factor Error with Delta=300 35835711
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 9937.48
Minimum 0.00
Maximum 37985.30
Spread ( max - min ) 37985.30
Range [ ( max - min ) / 2 * 100% ] 191.12%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 3635957.90
Minimum 0.00
Maximum 13902618.23
Spread ( max - min ) 13902618.23
Range [ ( max - min ) / 2 * 100% ] 191.18%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 9369.17
Minimum 4651.98
Maximum 12288.90
Spread ( max - min ) 7636.92
Range [ ( max - min ) / 2 * 100% ] 40.76%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.42 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 2.01 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 47.07 mind_blast,if=active_enemies<=5&cooldown_react
I 6.55 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 11.63 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 17.37 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 18.61 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 19.82 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.17 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 14.57 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 14.53 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.92 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.93 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 15.54 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 42.97 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 81.83 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZZHXZZZOZNHQXZZXZZHLMMHZZHNGHRRXOMNHRSRXZNHQOXZZWWHXZZZZHNOXZZZHQZZZLHMMLSZHRXXZXOHNMQZNZWHZZZOZWHZZXZNXHQOSZZZHZZHLMLORXXHQZZZOZHNMLRXZWWWWWWWWHZZAROSHQXNZZZHZOXZZZHXXHNQLHMMRXZZHZHQNOHMSZXZWHRXZZONWHQRXZXZWHXOZZHNZZZZHLMOQRSXZHNXZOOXNHXZZZHGIFNMXWHZVIFQXWWWWWHOZIFNSHQXWWWWWWWWWWH8IFLMMXZHGIFLXXOHOIFQZXZHVIFNOASZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 311612 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
311612.0 311612.0 126.17 / 0.04% 16652 / 5.3% 64.6 10610.8 10610.8 92.93 / 0.88% 12393 / 116.8% 2.3 4691.0 4661.0 Mana 0.59% 50.6 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.63 5.77 6.31 4.86 4.97 4.55
Normalized 1.00 0.76 0.83 0.64 0.65 0.60
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.20 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste ~= Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.63, SpellDamage=5.77, HitRating=6.31, CritRating=4.86, HasteRating=4.97, MasteryRating=4.55 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.63, SpellDamage=5.77, HitRating=0.00, CritRating=4.86, HasteRating=4.97, MasteryRating=4.55 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:902502|688614|456921|320170|239101|219078|191212|130040&chds=0,1805004&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++902502++devouring_plague,9482C9,0,0,15|t++688614++shadow_word_pain,9482C9,1,0,15|t++456921++vampiric_touch,9482C9,2,0,15|t++320170++halo,9482C9,3,0,15|t++239101++shadow_word_death,9482C9,4,0,15|t++219078++mind_blast,9482C9,5,0,15|t++191212++mind_spike,4A79D3,6,0,15|t++130040++mind_flay,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,11,10,9,8,7,6,6,5,5,5,4,3,3,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_spike|vampiric_touch|mind_flay|shadow_word_pain|mind_blast|essence_of_yulon|shadowy_apparition|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|shadow_word_pain_mastery|multistrike_spell|devouring_plague|shadow_word_death|shadowfiend: melee|halo_damage|devouring_plague_mastery|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.63,6.31,5.77,4.97,4.86,4.55|7.45,6.11,5.59,4.80,4.68,4.37|7.81,6.51,5.94,5.15,5.03,4.73&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.63++Int,FFFFFF,0,0,15,0.1,e|t++++6.31++Hit,FFFFFF,0,1,15,0.1,e|t++++5.77++SP,FFFFFF,0,2,15,0.1,e|t++++4.97++Haste,FFFFFF,0,3,15,0.1,e|t++++4.86++Crit,FFFFFF,0,4,15,0.1,e|t++++4.55++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.166& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cgjmpruvxy1357786420xutsrqqqrrqpnnmljjjhijkkjjihgfedbaZZZZYYXWUUTTTTUUUUVVWWWXXXXXWWWXYZZZZaaaaaaaaaaabccbbaaZZZZZYYYZZZZZaabbbbcddeffggggggggfffggfffffffffeeeeeeeeedddccbZZZYYYYZZabcbbbbbbbbcccbbbbaZZYXXXXXYZaabbccccccbbccccccbaaZYYXXXXXYZaaaabcccdddeefggghhggfeeeeeeeeffffffeeeeeffffeeddccbaaZZaaaaabbbbbbbbbbbcccccccccbbbabccdeegfghiiijjjjjkkkkkkjihhhggecbZYWVTRQ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5085,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=311612|max=612778&chxp=1,1,51,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,9,24,67,144,300,595,956,1521,1980,2456,2813,2846,2795,2396,1884,1438,1054,704,439,245,160,84,32,20,13,4,3,0,0,0,2,0,2,1,1,0,0,0,0,0,0,0,0,0,0,1,0,0,1&chds=0,2846&chbh=5&chxt=x&chxl=0:|min=274866|avg=311612|max=419715&chxp=0,1,25,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:35.8,18.0,10.8,10.4,9.0,4.0,3.9,2.6,0.9,0.6&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 131.1s|mind_spike 65.7s|mind_blast 39.4s|vampiric_touch 38.2s|shadow_word_pain 33.0s|devouring_plague 14.7s|shadow_word_death 14.1s|halo 9.6s|shadowfiend 3.2s|waiting 2.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 311612
devouring_plague 10561 (36234) 3.4% (11.6%) 13.7 26.39sec 969858 902502 193822 415258 282671 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.67 13.67 0.00 0.00 1.0747 0.0000 3863855.50 3863855.50 0.00 902502.13 902502.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.15 59.64% 193821.77 169721 323211 193737.51 169721 250215 1579947 1579947 0.00
crit 5.50 40.24% 415258.46 353627 711800 415018.15 0 622825 2283908 2283908 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8374 2.7% 58.0 5.92sec 52855 0 32336 83641 52925 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.96 57.89 0.00 0.00 0.0000 0.0000 3063684.62 3063684.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.53 59.66% 32336.17 28287 53869 32343.12 28730 38081 1116700 1116700 0.00
crit 23.28 40.21% 83640.60 71200 150602 83599.64 72273 102809 1946985 1946985 0.00
miss 0.08 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17300 5.6% 13.7 26.39sec 463046 0 0 0 0 0.0% 0.0% 0.0% 0.0% 132.6 32651 70023 47727 40.3% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.67 13.67 132.61 132.61 0.0000 0.6290 6329313.67 6329313.67 0.00 75883.77 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.1 59.66% 32651.13 28287 307001 32655.89 29009 243465 2583241 2583241 0.00
crit 53.5 40.34% 70022.50 58939 639660 69967.86 60665 506565 3746072 3746072 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20012 6.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.0 25653 55670 37739 40.3% 0.1% 32.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.80 148.04 194.01 0.0000 0.7919 7321822.72 7321822.72 0.00 62451.04 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.5 59.55% 25652.69 21101 42942 25664.68 23251 29055 2963920 2963920 0.00
crit 78.3 40.35% 55670.36 43965 107367 55674.52 48819 65919 4357903 4357903 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8398) 0.0% (2.7%) 9.0 42.92sec 342204 320170 0 0 0 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.0689 0.0000 0.00 0.00 0.00 320170.15 320170.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.31 59.15% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.66 40.71% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8398 2.7% 9.0 42.92sec 342204 0 181272 386462 263597 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 11.66 0.00 0.00 0.0000 0.0000 3072672.97 3072672.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.96 59.70% 181271.89 153853 289544 181267.93 0 245999 1261404 1261404 0.00
crit 4.69 40.21% 386461.94 320566 603288 385623.27 0 603288 1811269 1811269 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 23594 7.6% 36.8 10.01sec 234722 219078 160182 346784 234722 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.78 36.78 0.00 0.00 1.0714 0.0000 8632332.25 8632332.25 0.00 219078.05 219078.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.00 59.82% 160182.29 135799 415972 160172.04 138956 192781 3524144 3524144 0.00
crit 14.73 40.05% 346784.26 282948 866710 346966.01 287699 446801 5108189 5108189 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 31252 (46598) 10.0% (15.0%) 88.0 4.06sec 193763 130040 0 0 0 0.0% 0.1% 0.0% 0.0% 180.3 42354 94021 63412 40.8% 0.0% 29.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.99 87.99 180.32 180.32 1.4900 0.6033 11434460.64 11434460.64 0.00 130039.51 130039.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.88 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.8 59.24% 42353.70 35993 68540 42360.71 38760 47854 4524591 4524591 0.00
crit 73.5 40.76% 94021.02 74995 171371 94005.05 82773 113537 6909870 6909870 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 15345 4.9% 78.8 4.44sec 71291 0 42239 113900 71330 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.75 78.71 0.00 0.00 0.0000 0.0000 5614499.20 5614499.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.60 59.20% 42238.82 35993 68540 42244.51 37450 49520 1968361 1968361 0.00
crit 32.01 40.67% 113899.97 90596 212503 113869.17 96048 142681 3646138 3646138 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 34351 11.0% 61.4 5.79sec 204747 191212 139470 302330 204750 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.38 61.38 0.00 0.00 1.0708 0.0000 12568000.75 12568000.75 0.00 191212.28 191212.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.64 59.69% 139470.20 110446 339513 139548.05 118930 167019 5109888 5109888 0.00
crit 24.67 40.19% 302329.68 230124 764988 302459.39 233862 383103 7458112 7458112 0.00
miss 0.08 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11977 3.8% 194.6 1.89sec 22520 0 22520 0 22520 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 194.59 194.59 0.00 0.00 0.0000 0.0000 4382097.98 4382097.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.59 100.00% 22519.88 7034 303122 22524.17 16667 33552 4382098 4382098 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:55340.55
  • base_dd_max:55340.55
power_infusion 0 0.0% 4.0 120.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 3.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9244 3.0% 13.1 4.60sec 258153 239101 179069 379184 258160 39.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.10 13.10 0.00 0.00 1.0797 0.0000 3382089.24 3382089.24 0.00 239101.40 239101.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.89 60.24% 179068.84 152630 468649 179158.38 152630 274816 1413195 1413195 0.00
crit 5.19 39.63% 379183.67 318016 976467 378685.44 0 754686 1968894 1968894 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 28453 (62127) 9.1% (19.9%) 30.8 11.83sec 738748 688614 0 0 0 0.0% 0.1% 0.0% 0.0% 280.8 25345 54554 37074 40.2% 0.0% 127.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.77 30.77 280.80 280.80 1.0728 1.6606 10410106.01 10410106.01 0.00 45524.37 688613.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.74 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 168.0 59.85% 25345.49 21342 42660 25350.05 23366 28686 4259236 4259236 0.00
crit 112.7 40.15% 54553.65 44467 106663 54535.75 49557 63914 6150870 6150870 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 14063 4.5% 122.7 2.94sec 41934 0 25505 66608 41963 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.70 122.62 0.00 0.00 0.0000 0.0000 5145395.82 5145395.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.26 59.75% 25504.69 22409 42660 25507.19 23522 28391 1868439 1868439 0.00
crit 49.20 40.12% 66608.10 56403 132264 66597.38 59601 77011 3276957 3276957 0.00
miss 0.16 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 19611 6.3% 161.9 2.23sec 44304 0 30433 65774 44671 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.95 160.62 0.00 0.00 0.0000 0.0000 7174951.79 7174951.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.91 59.71% 30433.13 26478 50863 30430.54 27733 33898 2918808 2918808 0.00
crit 64.71 40.29% 65773.86 55169 127172 65752.55 58628 75251 4256144 4256144 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2818 0.9% 5.3 60.17sec 196089 0 117424 295995 196087 44.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 0.0000 0.0000 1031155.03 1031155.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.93 55.71% 117423.71 83080 161028 112085.79 0 161028 344021 344021 0.00
crit 2.32 44.15% 295994.83 173104 402617 268238.58 0 402617 687134 687134 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 31946 (47671) 10.3% (15.3%) 35.5 10.21sec 490739 456921 0 0 0 0.0% 0.1% 0.0% 0.0% 240.8 33000 71622 48547 40.3% 0.0% 121.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.54 35.54 240.76 240.76 1.0740 1.8508 11688160.24 11688160.24 0.00 36053.61 456920.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.51 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.8 59.75% 33000.16 27457 55792 33005.36 30338 36951 4746830 4746830 0.00
crit 96.9 40.25% 71621.75 57209 139496 71602.41 64127 82031 6941331 6941331 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15725 5.0% 105.2 3.41sec 54709 0 33141 87063 54750 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.16 105.08 0.00 0.00 0.0000 0.0000 5753422.67 5753422.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.75 59.71% 33140.91 28830 55792 33144.17 29719 37324 2079483 2079483 0.00
crit 42.20 40.16% 87062.97 72566 172978 87054.18 76287 102494 3673940 3673940 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 112897 / 8587
melee 112436 2.7% 28.1 13.72sec 111227 121539 77088 181331 111226 42.1% 7.4% 24.1% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.13 28.13 0.00 0.00 0.9152 0.0000 3128909.25 3128909.25 0.00 121539.36 121539.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.93 24.63% 77036.15 57590 120110 77178.72 0 120110 533670 533670 0.00
hit (blocked) 0.53 1.89% 77765.81 57590 120110 32198.34 0 120110 41351 41351 0.00
crit 10.98 39.04% 181183.51 115181 288264 180777.27 132149 259759 1989957 1989957 0.00
crit (blocked) 0.85 3.03% 183231.94 115181 288264 106341.28 0 288264 156281 156281 0.00
glance 6.27 22.30% 60195.08 43193 90083 60144.28 0 90083 377543 377543 0.00
glance (blocked) 0.50 1.76% 60671.23 43193 90083 23969.35 0 90083 30107 30107 0.00
parry 2.03 7.22% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 89.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 4.99 0.00 0.00 1.0747 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 461 0.0% 1.3 1.76sec 9951 0 5894 14513 9951 47.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.29 1.29 0.00 0.00 0.0000 0.0000 12815.20 12815.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.68 52.70% 5893.97 4377 7078 2996.28 0 7078 4000 4000 0.00
crit 0.61 47.17% 14513.34 10506 16987 6778.45 0 16987 8815 8815 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_FDCL_PI 10611
halo_heal 10611 100.0% 9.0 42.92sec 432366 0 39954 42238 40958 44.0% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.98 94.78 0.00 0.00 0.0000 0.0000 3882246.35 33464425.96 88.40 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.13 56.05% 39954.20 0 350167 39732.66 0 151971 2122467 12512761 83.11
crit 41.66 43.95% 42238.21 0 603832 41999.56 0 182293 1759779 20951665 91.60
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_FDCL_PI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.40%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.7 0.0 26.5sec 26.5sec 10.29% 12.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:10.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.2 0.0 123.7sec 123.7sec 16.68% 16.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.68%

    Trigger Attempt Success

    • trigger_pct:99.69%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.0sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.3sec 41.80% 41.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.80%

    Trigger Attempt Success

    • trigger_pct:99.33%
power_infusion 4.0 0.0 120.8sec 120.8sec 17.05% 17.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:17.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.6 0.0 9.7sec 9.7sec 15.01% 49.52%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.01%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 41.7 27.5 8.5sec 5.1sec 41.59% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:30.96%
  • surge_of_darkness_2:10.64%

Trigger Attempt Success

  • trigger_pct:20.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 7.7 1.7 49.0sec 39.0sec 23.23% 43.38%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.23%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 53.8sec 53.6sec 17.91% 17.91%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.91%

    Trigger Attempt Success

    • trigger_pct:99.91%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.80% 0.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.80%

Trigger Attempt Success

  • trigger_pct:20.68%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.3sec 90.3sec 85.55% 77.03%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.42% 50.99%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.71% 20.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 13.7 41.0 3.0 3.0 323575.9
halo Mana 9.0 341997.6 38088.3 38088.3 9.0
mind_blast Mana 36.8 317297.5 8627.6 8627.6 27.2
mind_flay Mana 88.0 251887.1 2862.7 2862.7 67.7
shadow_word_death Mana 13.1 100767.2 7691.0 7691.5 33.6
shadow_word_pain Mana 30.8 394635.8 12825.8 12825.8 57.6
vampiric_touch Mana 35.5 309735.6 8714.8 8714.8 56.3
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 26.06 113646.85 (6.66%) 4360.41 120923.03 51.55%
Shadow Orbs from Mind Blast Shadow Orb 36.73 35.88 (84.44%) 0.98 0.85 2.32%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.61 6.61 (15.56%) 1.00 0.00 0.00%
Devouring Plague Health Health 190.50 2207531.20 (35.23%) 11587.97 1843367.04 45.51%
Vampiric Touch Mana Mana 345.84 1255448.07 (73.62%) 3630.12 504352.05 28.66%
halo_heal Health 8.98 390407.92 (6.23%) 43479.72 2724549.05 87.47%
external_healing Health 69.91 3381292.78 (53.96%) 48365.73 21110756.60 86.19%
mp5_regen Mana 1462.53 336244.66 (19.72%) 229.91 102514.52 23.36%
vampiric_embrace Health 118.64 286778.51 (4.58%) 2417.18 89106.41 23.71%
pet - shadowfiend
external_healing Health 12.79 139191.18 (97.13%) 10878.83 4856088.69 97.21%
vampiric_embrace Health 1.41 4118.03 (2.87%) 2927.82 974.53 19.14%
Resource RPS-Gain RPS-Loss
Health 17126.11 17486.20
Mana 4660.99 4691.01
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 575447.41 119249.12 708811.00
Mana 286867.93 214200.00 300000.00
Shadow Orb 1.48 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.5%
shadowfiend-Mana Cap 23.5%
mindbender-Mana Cap 23.5%

Procs

Count Interval
Shadowy Recall Extra Tick 364.3 1.0sec
Shadowy Apparition Procced 161.9 2.2sec
FDCL Mind Spike proc 69.2 5.1sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 311612.03
Minimum 274866.27
Maximum 419714.84
Spread ( max - min ) 144848.57
Range [ ( max - min ) / 2 * 100% ] 23.24%
Standard Deviation 10176.4693
5th Percentile 295495.44
95th Percentile 328798.77
( 95th Percentile - 5th Percentile ) 33303.33
Mean Distribution
Standard Deviation 64.3719
95.00% Confidence Intervall ( 311485.87 - 311738.20 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4096
0.1 Scale Factor Error with Delta=300 884052
0.05 Scale Factor Error with Delta=300 3536208
0.01 Scale Factor Error with Delta=300 88405221
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 311612.03
Minimum 274866.27
Maximum 419714.84
Spread ( max - min ) 144848.57
Range [ ( max - min ) / 2 * 100% ] 23.24%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 110868021.08
Minimum 97843465.00
Maximum 146223978.02
Spread ( max - min ) 48380513.02
Range [ ( max - min ) / 2 * 100% ] 21.82%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 10610.83
Minimum 0.00
Maximum 38296.37
Spread ( max - min ) 38296.37
Range [ ( max - min ) / 2 * 100% ] 180.46%
Standard Deviation 7495.3199
5th Percentile 2077.60
95th Percentile 26863.97
( 95th Percentile - 5th Percentile ) 24786.37
Mean Distribution
Standard Deviation 47.4122
95.00% Confidence Intervall ( 10517.90 - 10703.76 )
Normalized 95.00% Confidence Intervall ( 99.12% - 100.88% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19168
0.1% Error 1916804
0.1 Scale Factor Error with Delta=300 479583
0.05 Scale Factor Error with Delta=300 1918333
0.01 Scale Factor Error with Delta=300 47958325
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 10610.83
Minimum 0.00
Maximum 38296.37
Spread ( max - min ) 38296.37
Range [ ( max - min ) / 2 * 100% ] 180.46%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 3882246.35
Minimum 0.00
Maximum 14016470.81
Spread ( max - min ) 14016470.81
Range [ ( max - min ) / 2 * 100% ] 180.52%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 10308.85
Minimum 5614.26
Maximum 13346.60
Spread ( max - min ) 7732.34
Range [ ( max - min ) / 2 * 100% ] 37.50%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 3.98 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.49 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 0.71 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 38.98 mind_blast,if=active_enemies<=5&cooldown_react
I 6.61 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 11.38 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 16.02 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 19.39 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 21.71 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.21 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.95 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 14.78 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.98 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.97 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 6.71 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 46.60 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 87.99 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABHLMSZZXZHXZXZZXNHMQXZZZZHZLMXOZNRHRXRXZORHLMQRNSXHXZZZOZWHZZZNXZHQORXZZWHZXZLMLOHSXZXZXZHMNONQRXWHZZZBZOWHXZXZNZZHZSXOXZHQZZNXZLHMORXZZZHXXNONORWHQXXZSXAHZNMZZZHZZZZOXHQNZZZZLHMOXZZSXHNZZONMWHQRRXZXZHNRBORXXZWHXZZZZZHNMQSZXZHZZLMONRHRXXZZRHOONQRXNWHXZIFXSOHQXVIFZZHLXVIFOQXWHZZIF8ZLMHNGIFMRXZHOIFNQRNOHRIFSXXZABHG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 313032 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
313031.8 313031.8 126.19 / 0.04% 16689 / 5.3% 62.4 10172.7 10172.7 88.05 / 0.87% 11709 / 115.1% 2.1 4883.0 4835.7 Mana 0.60% 49.5 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.36 5.89 7.16 4.63 4.84 4.32
Normalized 1.00 0.80 0.97 0.63 0.66 0.59
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.18 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.36, SpellDamage=5.89, HitRating=7.16, CritRating=4.63, HasteRating=4.84, MasteryRating=4.32 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.36, SpellDamage=5.89, HitRating=0.00, CritRating=4.63, HasteRating=4.84, MasteryRating=4.32 )

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:921282|687176|446757|323421|272725|225376|196738|125909&chds=0,1842565&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++921282++devouring_plague,9482C9,0,0,15|t++687176++shadow_word_pain,9482C9,1,0,15|t++446757++vampiric_touch,9482C9,2,0,15|t++323421++halo,9482C9,3,0,15|t++272725++shadow_word_death,9482C9,4,0,15|t++225376++mind_blast,9482C9,5,0,15|t++196738++mind_spike,4A79D3,6,0,15|t++125909++mind_flay,9482C9,7,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,10,9,8,7,6,6,5,5,5,4,4,3,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_spike|vampiric_touch|mind_flay|shadow_word_pain|mind_blast|essence_of_yulon|shadowy_apparition|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|shadow_word_pain_mastery|multistrike_spell|devouring_plague|shadow_word_death|devouring_plague_mastery|halo_damage|shadowfiend: melee|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.36,7.16,5.89,4.84,4.63,4.32|7.18,6.98,5.71,4.66,4.46,4.14|7.53,7.34,6.06,5.02,4.81,4.49&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.36++Int,FFFFFF,0,0,15,0.1,e|t++++7.16++Hit,FFFFFF,0,1,15,0.1,e|t++++5.89++SP,FFFFFF,0,2,15,0.1,e|t++++4.84++Haste,FFFFFF,0,3,15,0.1,e|t++++4.63++Crit,FFFFFF,0,4,15,0.1,e|t++++4.32++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.838& http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dhknqtuwxz0457686530zwuttsttuvvutssqonnnnpqqqppnlljihgeeeeedcaZYXXWWYYYZZaabbcccbbaaabdeeeeeeeeeeeeegghiihhgffeeddccccccbbbabbaabccdefggghhhhhhhhijjijjjjjjjjjijjijjkkjjiigfeeeedeeefghhgggggfghihhggffeddbbbbccdeffgghhhhggghhiihhhgfedcbbababcccccddeeefghhijkkllllkjjjkklmnnnoopooooopqrrrqqpommlkjijjkkkllllmlklllllmmmmnmmmmlkkklmmnoqrqrstuuuuvwwxxxxxwwusssrromkhfdbYWU&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6009,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=313032|max=520911&chxp=1,1,60,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:5,8,23,21,43,58,96,145,226,270,352,517,650,808,931,1104,1164,1264,1354,1458,1588,1524,1420,1365,1330,1193,1069,912,800,714,566,451,373,313,256,176,122,89,82,42,38,33,14,9,6,5,0,3,1,1&chds=0,1588&chbh=5&chxt=x&chxl=0:|min=280089|avg=313032|max=356750&chxp=0,1,43,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:36.5,17.3,10.9,10.5,9.0,4.0,3.9,2.6,0.9,0.6&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 133.4s|mind_spike 63.1s|mind_blast 39.9s|vampiric_touch 38.4s|shadow_word_pain 33.0s|devouring_plague 14.8s|shadow_word_death 14.1s|halo 9.7s|shadowfiend 3.2s|waiting 2.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 313032
devouring_plague 11115 (37247) 3.6% (11.9%) 13.7 26.25sec 994343 921282 203916 436581 296732 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.71 13.71 0.00 0.00 1.0793 0.0000 4066692.09 4066692.09 0.00 921282.49 921282.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.20 59.86% 203915.73 169721 353993 203827.85 169721 258129 1672825 1672825 0.00
crit 5.48 40.01% 436581.22 353627 737573 436163.63 0 682141 2393867 2393867 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8554 2.7% 56.6 6.05sec 55312 0 33921 87557 55377 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.58 56.52 0.00 0.00 0.0000 0.0000 3129761.30 3129761.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.79 59.78% 33921.31 28287 59000 33926.74 29913 40087 1146067 1146067 0.00
crit 22.66 40.09% 87556.91 71200 150602 87514.55 74090 107304 1983694 1983694 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17578 5.6% 13.7 26.25sec 469251 0 0 0 0 0.0% 0.0% 0.0% 0.0% 129.5 34051 72828 49655 40.2% 0.0% 23.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.71 13.71 129.52 129.52 0.0000 0.6493 6431157.28 6431157.28 0.00 76475.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.4 59.76% 34051.15 28287 142003 34058.47 30141 54735 2635406 2635406 0.00
crit 52.1 40.24% 72827.99 58939 295874 72781.91 63410 118208 3795751 3795751 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 20137 6.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 143.2 26562 57401 38955 40.3% 0.1% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 29.70 143.15 189.12 0.0000 0.7925 7367429.33 7367429.33 0.00 64938.16 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.8 59.63% 26561.94 21101 47031 26570.97 23659 30470 2995538 2995538 0.00
crit 76.2 40.27% 57401.49 43965 102254 57393.24 50003 68837 4371892 4371892 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8534) 0.0% (2.7%) 9.0 43.13sec 348684 323421 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.95 8.95 0.00 0.00 1.0781 0.0000 0.00 0.00 0.00 323420.62 323420.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.33 59.58% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.61 40.29% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8534 2.7% 9.0 43.13sec 348684 0 187170 398380 271758 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.95 11.49 0.00 0.00 0.0000 0.0000 3122302.66 3122302.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.87 59.76% 187170.17 153853 317120 187183.50 0 288091 1285095 1285095 0.00
crit 4.61 40.14% 398379.97 320566 660744 397430.68 0 660744 1837208 1837208 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 24594 7.9% 37.0 9.96sec 243052 225376 166164 358486 243054 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.02 37.02 0.00 0.00 1.0785 0.0000 8998352.84 8998352.84 0.00 225375.77 225375.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.13 59.79% 166164.24 135799 455588 166148.94 143171 198264 3678026 3678026 0.00
crit 14.84 40.09% 358485.93 282948 949254 358645.76 291464 471707 5320327 5320327 0.00
miss 0.05 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 30798 (45912) 9.8% (14.7%) 88.4 4.03sec 189997 125909 0 0 0 0.0% 0.1% 0.0% 0.0% 176.0 42942 94776 64021 40.7% 0.0% 30.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.41 88.41 176.01 176.01 1.5090 0.6306 11268206.15 11268206.15 0.00 125909.17 125909.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.30 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.4 59.33% 42941.99 35993 75068 42949.30 39386 47880 4484518 4484518 0.00
crit 71.6 40.67% 94776.49 74995 163211 94767.08 83834 108422 6783689 6783689 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 15114 4.8% 76.9 4.54sec 71929 0 42867 114722 71946 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.88 76.86 0.00 0.00 0.0000 0.0000 5529840.25 5529840.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.59 59.32% 42866.58 35993 75068 42872.33 38157 48963 1954403 1954403 0.00
crit 31.17 40.55% 114721.74 90596 202384 114715.91 97828 144912 3575437 3575437 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 33947 10.8% 58.7 6.02sec 211642 196738 144605 312380 211642 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.68 58.68 0.00 0.00 1.0758 0.0000 12420055.57 12420055.57 0.00 196737.77 196737.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.09 59.79% 144605.26 110446 371848 144698.10 119727 179535 5073732 5073732 0.00
crit 23.52 40.07% 312379.71 230124 774774 312506.19 246390 421726 7346324 7346324 0.00
miss 0.08 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 12093 3.9% 189.2 1.94sec 23389 0 23389 0 23389 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.16 189.16 0.00 0.00 0.0000 0.0000 4424324.71 4424324.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.16 100.00% 23389.39 7034 356488 23393.08 15797 31989 4424325 4424325 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:171417.11
  • base_dd_max:171417.11
shadow_word_death 10538 3.4% 13.1 4.60sec 295314 272725 205259 434144 295310 39.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.06 13.06 0.00 0.00 1.0829 0.0000 3855507.43 3855507.43 0.00 272724.58 272724.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.89 60.41% 205259.03 175524 513282 205474.28 175524 295897 1618985 1618985 0.00
crit 5.15 39.46% 434143.95 365719 1069464 433623.98 0 810452 2236522 2236522 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 28300 (61965) 9.0% (19.8%) 30.6 12.06sec 741801 687176 0 0 0 0.0% 0.1% 0.0% 0.0% 272.1 26068 55962 38047 40.1% 0.0% 127.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.56 30.56 272.14 272.14 1.0795 1.7128 10354113.89 10354113.89 0.00 45423.04 687176.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.54 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.1 59.93% 26067.94 21342 46723 26072.06 24138 29194 4251311 4251311 0.00
crit 109.1 40.07% 55961.57 44467 97351 55943.31 50478 63470 6102803 6102803 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 14080 4.5% 118.9 3.04sec 43323 0 26438 68807 43355 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.91 118.82 0.00 0.00 0.0000 0.0000 5151594.91 5151594.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.13 59.86% 26438.28 22409 46723 26440.46 23748 29846 1880513 1880513 0.00
crit 47.54 40.01% 68807.23 56403 125965 68796.96 61440 81037 3271082 3271082 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 19585 6.3% 156.6 2.31sec 45759 0 31510 67914 46158 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.59 155.24 0.00 0.00 0.0000 0.0000 7165609.79 7165609.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.78 59.76% 31510.14 26478 55707 31508.65 28921 35724 2923537 2923537 0.00
crit 62.46 40.24% 67914.43 55169 121116 67885.64 60597 80315 4242073 4242073 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2630 0.8% 5.0 64.79sec 193323 0 117187 289632 193319 44.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.98 4.98 0.00 0.00 0.0000 0.0000 962235.55 962235.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.77 55.64% 117186.83 91415 166781 111020.50 0 166781 324519 324519 0.00
crit 2.20 44.24% 289632.33 199070 383445 259200.77 0 383445 637717 637717 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 31333 (46887) 10.0% (15.0%) 35.6 10.22sec 482187 446757 0 0 0 0.0% 0.1% 0.0% 0.0% 231.0 33866 73116 49635 40.2% 0.0% 121.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.58 35.58 230.97 230.97 1.0793 1.9218 11463950.95 11463950.95 0.00 35570.00 446756.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.55 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.2 59.82% 33865.70 27457 61105 33871.05 31099 38468 4679340 4679340 0.00
crit 92.8 40.18% 73115.86 57209 132854 73095.36 66122 85573 6784610 6784610 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15554 5.0% 100.9 3.55sec 56385 0 34283 89642 56422 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.92 100.86 0.00 0.00 0.0000 0.0000 5690608.28 5690608.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.31 59.79% 34282.84 28830 61105 34284.95 31133 38557 2067447 2067447 0.00
crit 40.42 40.07% 89642.37 72566 164741 89632.38 78804 105921 3623161 3623161 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 112318 / 8548
melee 111859 2.7% 28.1 13.74sec 110843 121134 77058 180821 110842 42.0% 7.4% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.10 28.10 0.00 0.00 0.9151 0.0000 3114837.48 3114837.48 0.00 121133.91 121133.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.94 24.68% 77009.18 57590 120110 77160.32 0 120110 534083 534083 0.00
hit (blocked) 0.54 1.91% 77693.64 57590 120110 32431.79 0 120110 41703 41703 0.00
crit 10.94 38.92% 180661.52 115181 288264 180271.90 123031 269392 1975720 1975720 0.00
crit (blocked) 0.86 3.07% 182837.53 115181 288264 106623.17 0 288264 157919 157919 0.00
glance 6.25 22.25% 60060.75 43193 90083 59994.46 0 90083 375500 375500 0.00
glance (blocked) 0.49 1.75% 60755.08 43193 90083 24023.96 0 90083 29912 29912 0.00
parry 2.05 7.29% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 89.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 4.99 0.00 0.00 1.0747 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 459 0.0% 1.3 1.76sec 9893 0 5867 14408 9893 47.2% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.29 1.29 0.00 0.00 0.0000 0.0000 12790.46 12790.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.68 52.61% 5867.46 4377 7078 2991.73 0 7078 3991 3991 0.00
crit 0.61 47.23% 14408.11 10506 16987 6771.83 0 16987 8799 8799 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_FDCL_ToF 10173
halo_heal 10173 100.0% 9.0 43.13sec 415650 0 38738 39975 39280 43.8% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.95 94.77 0.00 0.00 0.0000 0.0000 3721957.23 34757629.88 89.29 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.27 56.20% 38737.69 0 402692 38450.40 0 155517 2063052 13054021 84.28
crit 41.51 43.80% 39975.41 0 677398 39682.45 0 193702 1658906 21703609 92.37
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_FDCL_ToF
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.7 0.0 26.3sec 26.3sec 10.40% 12.48%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:10.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.2 0.0 124.7sec 124.7sec 16.64% 16.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.64%

    Trigger Attempt Success

    • trigger_pct:99.74%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.0sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.2sec 41.86% 41.86%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.86%

    Trigger Attempt Success

    • trigger_pct:99.41%
shadow_word_death_reset_cooldown 6.6 0.0 9.7sec 9.7sec 15.03% 49.53%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.03%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
surge_of_darkness 40.4 25.9 8.8sec 5.3sec 40.60% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:30.27%
  • surge_of_darkness_2:10.33%

Trigger Attempt Success

  • trigger_pct:19.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 7.7 1.7 49.0sec 39.1sec 23.15% 52.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.15%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 54.1sec 53.9sec 17.85% 17.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.85%

    Trigger Attempt Success

    • trigger_pct:99.91%
twist_of_fate 1.0 254.6 113.3sec 0.5sec 31.83% 31.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:31.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.74% 0.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.74%

Trigger Attempt Success

  • trigger_pct:19.14%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.3sec 90.3sec 85.55% 77.01%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.42% 51.15%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.69% 20.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 13.7 41.1 3.0 3.0 331744.8
halo Mana 9.0 362659.7 40500.0 40500.1 8.6
mind_blast Mana 37.0 333201.6 9000.0 9000.0 27.0
mind_flay Mana 88.4 265233.8 3000.0 3000.0 63.3
shadow_word_death Mana 13.1 101841.2 7800.0 7800.6 37.9
shadow_word_pain Mana 30.6 403426.3 13200.0 13200.0 56.2
vampiric_touch Mana 35.6 320188.7 9000.0 9000.0 53.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 26.02 128843.06 (7.28%) 4952.42 105302.74 44.97%
Shadow Orbs from Mind Blast Shadow Orb 36.98 36.14 (84.58%) 0.98 0.84 2.26%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.59 6.59 (15.42%) 1.00 0.00 0.00%
Devouring Plague Health Health 186.03 2201524.09 (35.21%) 11834.07 1754335.36 44.35%
Vampiric Touch Mana Mana 331.83 1286815.25 (72.73%) 3877.98 401563.15 23.78%
halo_heal Health 8.95 369593.83 (5.91%) 41274.37 2869942.73 88.59%
external_healing Health 69.94 3395139.91 (54.30%) 48546.77 20955335.18 86.06%
mp5_regen Mana 1462.53 353611.39 (19.99%) 241.78 85147.79 19.41%
vampiric_embrace Health 118.64 286628.64 (4.58%) 2415.92 89256.27 23.75%
pet - shadowfiend
external_healing Health 12.79 138372.91 (97.13%) 10819.24 4843873.64 97.22%
vampiric_embrace Health 1.41 4081.50 (2.87%) 2887.72 1026.01 20.09%
Resource RPS-Gain RPS-Loss
Health 17090.24 17486.20
Mana 4835.73 4882.96
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 558864.91 118519.20 708811.00
Mana 281195.45 212100.00 300000.00
Shadow Orb 1.63 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 19.5%
shadowfiend-Mana Cap 19.5%
mindbender-Mana Cap 19.5%

Procs

Count Interval
Shadowy Recall Extra Tick 353.1 1.0sec
Shadowy Apparition Procced 156.6 2.3sec
FDCL Mind Spike proc 66.3 5.3sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 313031.82
Minimum 280088.69
Maximum 356750.16
Spread ( max - min ) 76661.47
Range [ ( max - min ) / 2 * 100% ] 12.24%
Standard Deviation 10178.1730
5th Percentile 296968.86
95th Percentile 330347.41
( 95th Percentile - 5th Percentile ) 33378.55
Mean Distribution
Standard Deviation 64.3827
95.00% Confidence Intervall ( 312905.63 - 313158.00 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4061
0.1 Scale Factor Error with Delta=300 884348
0.05 Scale Factor Error with Delta=300 3537393
0.01 Scale Factor Error with Delta=300 88434826
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 313031.82
Minimum 280088.69
Maximum 356750.16
Spread ( max - min ) 76661.47
Range [ ( max - min ) / 2 * 100% ] 12.24%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 111401742.97
Minimum 99480054.50
Maximum 127411962.42
Spread ( max - min ) 27931907.93
Range [ ( max - min ) / 2 * 100% ] 12.54%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 10172.66
Minimum 0.00
Maximum 39747.24
Spread ( max - min ) 39747.24
Range [ ( max - min ) / 2 * 100% ] 195.36%
Standard Deviation 7102.1221
5th Percentile 2057.78
95th Percentile 25475.30
( 95th Percentile - 5th Percentile ) 23417.52
Mean Distribution
Standard Deviation 44.9250
95.00% Confidence Intervall ( 10084.61 - 10260.71 )
Normalized 95.00% Confidence Intervall ( 99.13% - 100.87% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18724
0.1% Error 1872421
0.1 Scale Factor Error with Delta=300 430586
0.05 Scale Factor Error with Delta=300 1722344
0.01 Scale Factor Error with Delta=300 43058602
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 10172.66
Minimum 0.00
Maximum 39747.24
Spread ( max - min ) 39747.24
Range [ ( max - min ) / 2 * 100% ] 195.36%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 3721957.23
Minimum 0.00
Maximum 14509370.45
Spread ( max - min ) 14509370.45
Range [ ( max - min ) / 2 * 100% ] 194.92%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 10289.70
Minimum 5491.40
Maximum 13061.09
Spread ( max - min ) 7569.69
Range [ ( max - min ) / 2 * 100% ] 36.78%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.47 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 0.74 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 38.90 mind_blast,if=active_enemies<=5&cooldown_react
I 6.59 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 11.72 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 17.48 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 18.84 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 20.33 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.19 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.97 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 13.86 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.95 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.96 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 6.59 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 44.82 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 88.41 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZZHXXZZOZZHLQZXZZZHLMMRXZZNHZXZOMNHQSXZXNWHXOXZZXWHZXZZZNMHQZZXZZHXOLMMLSHZXZXZZHMMNQNRWHRRXZOZZHZZZNRRHORSXZZHQXZZNLMHMXZZZZZHORONNRRWHQXZRXOAHMSXNZZWHXZXOZZZHQZZNZZHLMMZXXZHRXZNOOHQSZZRRRHRONXZZWHXZZXZXOHQRNRXZZHXZLMMSXHXNZXZZHMMLQXZXHNIFROXZHGIFRXXZHNIFMRSWHQXVIF8XZLMHONIFQRXXHZIFMLMRHQNIFXZAHOR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 310620 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
310620.0 310620.0 125.57 / 0.04% 16672 / 5.4% 59.7 10574.1 10574.1 87.06 / 0.82% 11690 / 110.6% 2.2 4843.5 4775.1 Mana 0.74% 48.5 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.58 5.93 7.02 4.78 5.45 4.74
Normalized 1.00 0.78 0.93 0.63 0.72 0.63
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.19 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Haste > Crit ~= Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.58, SpellDamage=5.93, HitRating=7.02, CritRating=4.78, HasteRating=5.45, MasteryRating=4.74 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.58, SpellDamage=5.93, HitRating=0.00, CritRating=4.78, HasteRating=5.45, MasteryRating=4.74 )

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:881177|667019|434899|312889|253649|243075|120694&chds=0,1762353&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++881177++devouring_plague,9482C9,0,0,15|t++667019++shadow_word_pain,9482C9,1,0,15|t++434899++vampiric_touch,9482C9,2,0,15|t++312889++halo,9482C9,3,0,15|t++253649++shadow_word_death,9482C9,4,0,15|t++243075++mind_blast,9482C9,5,0,15|t++120694++mind_flay,9482C9,6,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,11,10,9,7,7,7,7,6,5,5,4,4,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mind_blast|vampiric_touch|shadow_word_pain|mindbender: melee|devouring_plague_tick|mind_flay_mastery|essence_of_yulon|shadowy_apparition|vampiric_touch_mastery|shadow_word_pain_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadow_word_death|halo_damage|stormlash|mindbender: stormlash& DPS Taken Timeline Chart
http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.58,7.02,5.93,5.45,4.78,4.74|7.40,6.84,5.76,5.27,4.60,4.57|7.75,7.21,6.11,5.62,4.96,4.92&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.58++Int,FFFFFF,0,0,15,0.1,e|t++++7.02++Hit,FFFFFF,0,1,15,0.1,e|t++++5.93++SP,FFFFFF,0,2,15,0.1,e|t++++5.45++Haste,FFFFFF,0,3,15,0.1,e|t++++4.78++Crit,FFFFFF,0,4,15,0.1,e|t++++4.74++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.101& http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bfinrtvxz13557786531zxvrqpqqrrsrrrsrqqqqqqqqqpomlkihgfdddddddddeeedeeeeeeeeeddccbaZYYYZbbccdeeffffffggghggfeedccbbbbbccdeffghhghhiijjjjjiiihggffefggghhhiiijjjjjjiijjiihhgfedcccccccdeffgghgggghhhhggffedccbbbbbcdeffgggggggggggggffedcbbaaaaabcdeefgghhhiiiijjjjjjihgffeeeefgghhiiiiiiiijjjjjjihggffedeeffghiijkjjkkkkkkkllkkjjiihgfghhhiijjklmmnnnoooppppoonmlmlkjhfdbZXVTRQ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5753,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=310620|max=539910&chxp=1,1,58,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,4,7,16,51,77,152,237,372,553,761,961,1326,1450,1729,1952,1958,1919,1885,1776,1628,1363,1155,925,765,557,436,306,232,152,91,72,47,35,15,13,4,1,3,2,1,0,0,0,0,0,0,0,0,1&chds=0,1958&chbh=5&chxt=x&chxl=0:|min=275394|avg=310620|max=375126&chxp=0,1,35,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:49.4,13.4,10.3,8.9,4.8,3.8,2.6,2.0,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 180.8s|mind_blast 49.1s|vampiric_touch 37.7s|shadow_word_pain 32.4s|devouring_plague 17.7s|shadow_word_death 13.7s|halo 9.7s|mindbender 7.5s|waiting 2.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 310620
devouring_plague 12574 (42651) 4.0% (13.7%) 16.4 21.81sec 949716 881177 191645 412407 279984 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 0.00 0.00 1.0778 0.0000 4600420.99 4600420.99 0.00 881176.59 881176.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.82 59.74% 191645.11 169721 307820 191612.90 169721 235393 1881240 1881240 0.00
crit 6.59 40.13% 412407.49 353627 769642 412562.54 0 613075 2719181 2719181 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9870 3.2% 68.8 5.00sec 52501 0 32065 83275 52579 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.78 68.68 0.00 0.00 0.0000 0.0000 3610963.39 3610963.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.02 59.73% 32065.27 28287 51304 32070.02 28513 36631 1315323 1315323 0.00
crit 27.57 40.14% 83274.60 71200 159064 83224.14 72145 108437 2295641 2295641 0.00
miss 0.09 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20208 6.5% 16.4 21.81sec 449965 0 0 0 0 0.0% 0.0% 0.0% 0.0% 157.3 32156 69080 46991 40.2% 0.0% 27.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 157.34 157.34 0.0000 0.6422 7393371.89 7393371.89 0.00 73166.93 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.1 59.82% 32155.64 28287 127553 32161.16 28814 109561 3026518 3026518 0.00
crit 63.2 40.18% 69079.87 58939 277867 69032.32 60678 226305 4366854 4366854 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18954 6.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.7 25360 54786 37194 40.3% 0.1% 30.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.82 140.74 186.45 0.0000 0.7953 6934757.65 6934757.65 0.00 61956.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.1 59.60% 25359.99 21101 40897 25369.61 23162 28653 2818162 2818162 0.00
crit 75.1 40.30% 54786.33 43965 102254 54786.81 48791 62780 4116595 4116595 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8282) 0.0% (2.7%) 9.0 42.97sec 337324 312889 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.0781 0.0000 0.00 0.00 0.00 312889.03 312889.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.33 59.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.64 40.49% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8282 2.7% 9.0 42.97sec 337324 0 178635 380056 259423 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 11.68 0.00 0.00 0.0000 0.0000 3030330.25 3030330.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.97 59.70% 178635.45 153853 275756 178652.34 153853 275756 1245682 1245682 0.00
crit 4.70 40.20% 380055.98 320566 689472 379275.01 0 574560 1784649 1784649 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 32629 10.5% 45.6 8.04sec 261965 243075 179453 386560 261967 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.57 45.57 0.00 0.00 1.0777 0.0000 11937898.17 11937898.17 0.00 243074.97 243074.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.30 59.91% 179452.71 135799 396163 179413.37 147210 215311 4898999 4898999 0.00
crit 18.21 39.96% 386560.07 282948 990526 386574.47 295722 498410 7038899 7038899 0.00
miss 0.06 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 40021 (59639) 12.9% (19.2%) 120.2 2.99sec 181510 120694 0 0 0 0.0% 0.1% 0.0% 0.0% 238.2 41367 90999 61481 40.5% 0.0% 41.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.22 120.22 238.16 238.16 1.5039 0.6312 14642718.94 14642718.94 0.00 120694.01 120694.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.06 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.6 59.47% 41366.78 35993 65277 41370.82 38578 46998 5859299 5859299 0.00
crit 96.5 40.53% 90999.43 74995 163211 90992.24 82999 101945 8783420 8783420 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 19618 6.3% 104.0 3.43sec 69045 0 41298 110113 69066 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.96 103.93 0.00 0.00 0.0000 0.0000 7177672.57 7177672.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.77 59.44% 41298.07 35993 65277 41301.70 38040 46410 2551152 2551152 0.00
crit 42.02 40.43% 110112.53 90596 202384 110101.75 96116 133026 4626521 4626521 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 6.89 0.00 0.00 1.0830 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 11101 3.6% 195.4 1.87sec 20785 0 20785 0 20785 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.41 195.41 0.00 0.00 0.0000 0.0000 4061568.98 4061568.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 195.41 100.00% 20785.16 7034 330175 20787.67 15485 28853 4061569 4061569 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:25461.18
  • base_dd_max:25461.18
shadow_word_death 9520 3.1% 12.7 4.67sec 274638 253649 190670 403250 274645 39.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.68 12.68 0.00 0.00 1.0828 0.0000 3482850.95 3482850.95 0.00 253648.75 253648.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.64 60.26% 190670.10 152630 446332 190745.16 0 319576 1456983 1456983 0.00
crit 5.02 39.62% 403250.34 318016 929969 402078.97 0 754686 2025868 2025868 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 27059 (59141) 8.7% (19.0%) 30.0 12.26sec 720163 667019 0 0 0 0.0% 0.1% 0.0% 0.0% 271.2 24994 53668 36499 40.1% 0.0% 127.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.05 30.05 271.24 271.24 1.0797 1.7147 9899953.64 9899953.64 0.00 43491.53 667018.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.02 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.4 59.88% 24993.82 21342 40629 24998.57 23080 28146 4059168 4059168 0.00
crit 108.8 40.12% 53668.03 44467 101583 53651.53 48524 61198 5840785 5840785 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 13411 4.3% 118.5 3.04sec 41406 0 25252 65748 41435 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.50 118.42 0.00 0.00 0.0000 0.0000 4906729.86 4906729.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.85 59.83% 25251.92 22409 40629 25254.01 23267 28202 1789181 1789181 0.00
crit 47.42 40.04% 65748.25 56403 125965 65738.02 59281 75889 3117549 3117549 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 18672 6.0% 156.2 2.31sec 43722 0 30116 64940 44115 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.25 154.85 0.00 0.00 0.0000 0.0000 6831396.74 6831396.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.60 59.80% 30116.17 26478 48441 30114.15 27835 33717 2788820 2788820 0.00
crit 62.25 40.20% 64940.38 55169 121116 64915.74 58109 75733 4042577 4042577 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2624 0.8% 5.1 60.77sec 187053 0 112477 281737 187054 44.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 5.13 0.00 0.00 0.0000 0.0000 959873.28 959873.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.86 55.72% 112477.09 83080 153360 107063.59 0 153360 321628 321628 0.00
crit 2.27 44.15% 281736.73 173104 383445 254367.22 0 383445 638245 638245 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:110260.80
  • base_dd_max:110260.80
vampiric_touch 30017 (44784) 9.7% (14.4%) 34.9 10.37sec 469266 434899 0 0 0 0.0% 0.1% 0.0% 0.0% 229.6 32586 70456 47838 40.3% 0.0% 120.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.92 34.92 229.58 229.58 1.0790 1.9202 10982511.02 10982511.02 0.00 34242.70 434899.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.88 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.1 59.72% 32586.08 27457 53135 32592.14 30001 36695 4467943 4467943 0.00
crit 92.5 40.28% 70456.08 57209 132854 70436.50 62790 80393 6514568 6514568 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 14767 4.8% 100.3 3.56sec 53860 0 32739 85644 53899 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.31 100.24 0.00 0.00 0.0000 0.0000 5402755.79 5402755.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.94 59.79% 32739.02 28830 53135 32741.52 29842 36892 1962262 1962262 0.00
crit 40.17 40.08% 85643.84 72566 164741 85630.67 75939 98482 3440494 3440494 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 85233 / 21295
melee 84914 6.8% 87.3 4.06sec 88886 91816 64931 144137 88886 40.9% 7.5% 24.0% 6.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.32 87.32 0.00 0.00 0.9681 0.0000 7761908.64 7761908.64 0.00 91815.62 91815.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.27 25.50% 64919.07 50679 105697 65031.15 55749 82617 1445656 1445656 0.00
hit (blocked) 1.78 2.04% 65074.20 50679 105697 54273.91 0 105697 116008 116008 0.00
crit 33.06 37.86% 144107.71 101359 253672 143966.39 116908 182481 4764124 4764124 0.00
crit (blocked) 2.65 3.04% 144507.87 101359 253672 134392.15 0 253672 383361 383361 0.00
glance 19.42 22.24% 50188.41 38010 79273 50198.07 41668 64401 974503 974503 0.00
glance (blocked) 1.56 1.78% 50284.31 38010 79273 39791.39 0 79273 78257 78257 0.00
parry 6.48 7.42% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.05 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.9 20.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 0.00 0.00 1.0781 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 320 0.0% 3.6 84.40sec 8071 0 5042 11984 8071 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.62 3.62 0.00 0.00 0.0000 0.0000 29230.49 29230.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.03 56.13% 5041.75 3835 7078 4440.47 0 7078 10249 10249 0.00
crit 1.58 43.73% 11983.98 7669 16987 9669.94 0 16987 18981 18981 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5088.96
  • base_dd_max:5088.96
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MB_DI 10574
halo_heal 10574 100.0% 9.0 42.97sec 430667 0 39806 41842 40700 43.9% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.98 95.04 0.00 0.00 0.0000 0.0000 3868871.06 33465815.86 88.44 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.30 56.08% 39806.20 -0 343072 39604.27 0 146153 2121838 12518472 83.11
crit 41.75 43.92% 41841.72 -0 603832 41619.83 0 178905 1747033 20947344 91.65
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MB_DI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.17%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 18.0 1.4 19.0sec 17.5sec 8.10% 38.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.10%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 16.4 0.0 21.9sec 21.9sec 26.25% 27.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:26.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 126.1sec 126.1sec 16.58% 16.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.58%

    Trigger Attempt Success

    • trigger_pct:99.81%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.0sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.3 5.4 36.4sec 23.3sec 41.79% 41.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.79%

    Trigger Attempt Success

    • trigger_pct:99.37%
shadow_word_death_reset_cooldown 6.4 0.0 9.8sec 9.8sec 14.77% 49.34%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.77%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 7.7 1.7 49.0sec 38.9sec 23.23% 52.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.23%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.5 0.0 54.6sec 54.4sec 17.69% 17.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.69%

    Trigger Attempt Success

    • trigger_pct:99.90%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.60% 0.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.60%

Trigger Attempt Success

  • trigger_pct:15.49%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.9 0.0 20.1sec 20.1sec 85.38% 76.31%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.0 0.0 180.0sec 180.0sec 20.51% 26.67%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 20.47% 20.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.16% 2.16%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.16%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 16.4 49.3 3.0 3.0 316845.3
halo Mana 9.0 363829.3 40500.0 40500.0 8.3
mind_blast Mana 45.6 237850.6 5219.4 5219.4 50.2
mind_flay Mana 120.2 360645.7 3000.0 3000.0 60.5
shadow_word_death Mana 12.7 98924.0 7800.0 7800.6 35.2
shadow_word_pain Mana 30.0 396607.7 13200.0 13200.0 54.6
vampiric_touch Mana 34.9 314250.5 9000.0 9000.0 52.1
Resource Gains Type Count Total Average Overflow
mindbender Mana 80.74 232464.63 (13.31%) 2879.30 190440.74 45.03%
Shadow Orbs from Mind Blast Shadow Orb 45.51 44.38 (87.35%) 0.98 1.13 2.47%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.43 6.43 (12.65%) 1.00 0.00 0.00%
Devouring Plague Health Health 226.01 2539513.27 (40.51%) 11236.14 2266499.19 47.16%
Vampiric Touch Mana Mana 329.81 1187154.70 (67.95%) 3599.48 491010.26 29.26%
halo_heal Health 8.98 344718.31 (5.50%) 38372.64 2760485.53 88.90%
external_healing Health 69.91 3104001.89 (49.51%) 44402.15 21388826.06 87.33%
mp5_regen Mana 1462.53 327457.34 (18.74%) 223.90 111301.84 25.37%
vampiric_embrace Health 118.64 281229.06 (4.49%) 2370.41 94655.85 25.18%
pet - mindbender
external_healing Health 20.37 870512.47 (98.40%) 42740.40 6796961.20 88.65%
vampiric_embrace Health 4.97 14190.15 (1.60%) 2855.64 2524.64 15.10%
Resource RPS-Gain RPS-Loss
Health 17135.54 17486.20
Mana 4775.07 4843.48
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 578589.40 97984.79 708811.00
Mana 274387.68 219600.00 300000.00
Shadow Orb 1.54 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.5%
shadowfiend-Mana Cap 25.5%
mindbender-Mana Cap 25.5%

Procs

Count Interval
Shadowy Recall Extra Tick 391.3 0.9sec
Shadowy Apparition Procced 156.2 2.3sec
Divine Insight Mind Blast CD Reset 33.0 17.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 310620.03
Minimum 275393.60
Maximum 375126.00
Spread ( max - min ) 99732.39
Range [ ( max - min ) / 2 * 100% ] 16.05%
Standard Deviation 10128.6007
5th Percentile 294606.66
95th Percentile 327951.17
( 95th Percentile - 5th Percentile ) 33344.51
Mean Distribution
Standard Deviation 64.0691
95.00% Confidence Intervall ( 310494.46 - 310745.60 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4084
0.1 Scale Factor Error with Delta=300 875754
0.05 Scale Factor Error with Delta=300 3503019
0.01 Scale Factor Error with Delta=300 87575489
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 310620.03
Minimum 275393.60
Maximum 375126.00
Spread ( max - min ) 99732.39
Range [ ( max - min ) / 2 * 100% ] 16.05%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 105855774.11
Minimum 93259997.32
Maximum 127521223.68
Spread ( max - min ) 34261226.35
Range [ ( max - min ) / 2 * 100% ] 16.18%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 10574.11
Minimum 0.00
Maximum 38441.89
Spread ( max - min ) 38441.89
Range [ ( max - min ) / 2 * 100% ] 181.77%
Standard Deviation 7021.8948
5th Percentile 2532.44
95th Percentile 25912.70
( 95th Percentile - 5th Percentile ) 23380.27
Mean Distribution
Standard Deviation 44.4175
95.00% Confidence Intervall ( 10487.05 - 10661.17 )
Normalized 95.00% Confidence Intervall ( 99.18% - 100.82% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16940
0.1% Error 1694014
0.1 Scale Factor Error with Delta=300 420912
0.05 Scale Factor Error with Delta=300 1683651
0.01 Scale Factor Error with Delta=300 42091296
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 10574.11
Minimum 0.00
Maximum 38441.89
Spread ( max - min ) 38441.89
Range [ ( max - min ) / 2 * 100% ] 181.77%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 3868871.06
Minimum 0.00
Maximum 14069730.63
Spread ( max - min ) 14069730.63
Range [ ( max - min ) / 2 * 100% ] 181.83%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 9425.94
Minimum 4873.59
Maximum 12588.11
Spread ( max - min ) 7714.53
Range [ ( max - min ) / 2 * 100% ] 40.92%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 6.89 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.26 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 2.06 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 46.72 mind_blast,if=active_enemies<=5&cooldown_react
I 6.43 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 12.30 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 18.36 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 17.74 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 18.47 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.15 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 14.37 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.98 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.90 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 14.71 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 120.22 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9HLMSZZZWHZZZZOZHNQZZZZHZLMOZZZHLHQZHSOHMLZZZHNQO9ZZZHZZZZZZHLMZZZZHQSZZLMMHLZZZZZHZOHMNQZNZHZZ9OZZHZSZNZZHMQZZZHZZZLLMHMZHQZZZZHMNLSZZZHZZZ9OZWHQZNZZZHOZZZZZWHZNZZLMMHQSZHZZZHNMMZZHQZZZZ9HMNZZZZHZZSOZZZHNQZZZLHMMZZZZHNZOONZWHQZZZIFHN9OSZZIFHQZZZIFHLMZZVI8FHLMQZOIFHNZZOIFHNOQSZIFHNZZZ9

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 312275 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
312274.6 312274.6 125.40 / 0.04% 16587 / 5.3% 58.1 12051.8 12051.8 100.71 / 0.84% 13162 / 109.2% 2.4 5007.4 4940.0 Mana 0.56% 47.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.46 5.91 6.72 4.79 4.72 4.82
Normalized 1.00 0.79 0.90 0.64 0.63 0.65
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.20 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Hit > SP > Mastery ~= Crit ~= Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.46, SpellDamage=5.91, HitRating=6.72, CritRating=4.79, HasteRating=4.72, MasteryRating=4.82 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.46, SpellDamage=5.91, HitRating=0.00, CritRating=4.79, HasteRating=4.72, MasteryRating=4.82 )

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:905014|689505|459051|322728|251906|246131|128015&chds=0,1810029&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++905014++devouring_plague,9482C9,0,0,15|t++689505++shadow_word_pain,9482C9,1,0,15|t++459051++vampiric_touch,9482C9,2,0,15|t++322728++halo,9482C9,3,0,15|t++251906++shadow_word_death,9482C9,4,0,15|t++246131++mind_blast,9482C9,5,0,15|t++128015++mind_flay,9482C9,6,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,11,10,9,8,7,7,7,6,5,5,4,4,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|vampiric_touch|shadow_word_pain|mind_blast|mind_flay_mastery|mindbender: melee|shadowy_apparition|essence_of_yulon|devouring_plague_tick|vampiric_touch_mastery|shadow_word_pain_mastery|multistrike_spell|devouring_plague|shadow_word_death|halo_damage|devouring_plague_mastery|stormlash|mindbender: stormlash& DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.46,6.72,5.91,4.82,4.79,4.72|7.29,6.52,5.73,4.64,4.61,4.54|7.64,6.92,6.08,4.99,4.96,4.90&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.46++Int,FFFFFF,0,0,15,0.1,e|t++++6.72++Hit,FFFFFF,0,1,15,0.1,e|t++++5.91++SP,FFFFFF,0,2,15,0.1,e|t++++4.82++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.79++Crit,FFFFFF,0,4,15,0.1,e|t++++4.72++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,8.963& http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:aeimqsvxyz2356786431zxurppooopoonmlkiiihhhhiihgfeecbaZYYZZYZYXXXWWWWXXXXYYYZZZZYYXWWWXXYYYYYYYYYYYYYYYZaaZZZZYYYXXXYYZZabbcceddeeffghhiiihhgggffeeeeeeeedddddddddcccccccbbaZZYXXXXXXXZZZaaaaaabbbbbbbbbaaZYXXXWXYYZaaabbabaaaaaaaaaZZYXXWVVVWWXYZabbcdefggghhijjjjiihgfeddcccccccddcccccccdddddccbbaaZYZZaabccdeeeeeffffffffffeeddcbabcccddeefghhhhihiiiiiiiihgfgfedbaYWVUSRPO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5022,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=312275|max=621856&chxp=1,1,50,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,5,8,28,73,164,331,526,814,1249,1608,1999,2390,2501,2494,2384,2077,1774,1404,1067,739,518,331,217,102,79,52,27,11,6,4,1,4,0,1,1,0,0,0,1,0,0,0,0,0,0,0,0,0,1&chds=0,2501&chbh=5&chxt=x&chxl=0:|min=275500|avg=312275|max=402675&chxp=0,1,29,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:52.4,10.8,10.4,9.0,4.0,3.8,2.6,2.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 191.6s|mind_blast 39.5s|vampiric_touch 38.1s|shadow_word_pain 33.0s|devouring_plague 14.6s|shadow_word_death 13.8s|halo 9.6s|mindbender 7.4s|waiting 2.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 312275
devouring_plague 10514 (36204) 3.4% (11.6%) 13.6 26.42sec 972525 905014 193530 415243 282424 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.62 13.62 0.00 0.00 1.0746 0.0000 3846629.99 3846629.99 0.00 905014.42 905014.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.13 59.66% 193530.09 169721 323211 193477.28 169721 253419 1572652 1572652 0.00
crit 5.48 40.21% 415243.05 353627 728700 414954.34 0 637612 2273978 2273978 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8380 2.7% 58.1 5.92sec 52789 0 32303 83545 52849 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.08 58.01 0.00 0.00 0.0000 0.0000 3065992.58 3065992.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.63 59.69% 32302.78 28287 53869 32310.25 28611 38084 1118645 1118645 0.00
crit 23.31 40.18% 83545.31 71200 150602 83509.15 72077 101441 1947348 1947348 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17310 5.5% 13.6 26.42sec 464990 0 0 0 0 0.0% 0.0% 0.0% 0.0% 132.9 32629 69939 47660 40.3% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.62 13.62 132.88 132.88 0.0000 0.6283 6333168.43 6333168.43 0.00 75852.69 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.3 59.71% 32628.75 28287 202043 32635.48 28793 157924 2588982 2588982 0.00
crit 53.5 40.29% 69939.09 58939 420973 69885.55 59986 329487 3744186 3744186 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19357 6.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.9 25648 55593 37708 40.4% 0.1% 31.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 29.19 142.91 187.82 0.0000 0.7958 7082141.18 7082141.18 0.00 62273.72 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.8 59.54% 25647.78 21101 42942 25658.09 23476 29248 2868219 2868219 0.00
crit 75.8 40.36% 55592.88 43965 107367 55603.58 49006 66668 4213923 4213923 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8473) 0.0% (2.7%) 9.0 42.60sec 344516 322728 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.0676 0.0000 0.00 0.00 0.00 322727.86 322727.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.34 59.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.64 40.48% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8473 2.7% 9.0 42.60sec 344516 0 180661 384799 262369 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 11.82 0.00 0.00 0.0000 0.0000 3100123.85 3100123.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.07 59.80% 180661.20 153853 289544 180662.00 0 243210 1276575 1276575 0.00
crit 4.74 40.11% 384799.27 320566 603288 384113.81 0 603288 1823549 1823549 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26540 8.5% 36.8 9.99sec 263739 246131 180411 389394 263737 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.82 36.82 0.00 0.00 1.0715 0.0000 9710341.51 9710341.51 0.00 246130.53 246130.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.05 59.90% 180410.71 135799 415972 180317.70 140359 216843 3978484 3978484 0.00
crit 14.72 39.98% 389393.88 282948 937492 389380.37 296311 515656 5731857 5731857 0.00
miss 0.05 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 44960 (67053) 14.4% (21.5%) 128.9 2.80sec 190329 128015 0 0 0 0.0% 0.1% 0.0% 0.0% 262.2 42051 92963 62734 40.6% 0.0% 43.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.90 128.90 262.21 262.21 1.4868 0.6058 16449549.41 16449549.41 0.00 128014.70 128014.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.73 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.17 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 155.7 59.37% 42050.86 35993 68540 42055.09 39117 46446 6546780 6546780 0.00
crit 106.5 40.63% 92962.89 74995 171371 92952.25 84303 105464 9902770 9902770 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 22094 7.1% 114.6 3.13sec 70547 0 42010 112621 70571 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.58 114.54 0.00 0.00 0.0000 0.0000 8083443.47 8083443.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.98 59.35% 42009.53 35993 68540 42012.68 38090 48306 2855850 2855850 0.00
crit 46.42 40.52% 112620.99 90596 212503 112611.08 98000 133957 5227594 5227594 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 1.0812 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10988 3.5% 197.1 1.86sec 20401 0 20401 0 20401 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.07 197.07 0.00 0.00 0.0000 0.0000 4020263.06 4020263.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.07 100.00% 20400.70 7034 309990 20402.36 15403 29565 4020263 4020263 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:51655.41
  • base_dd_max:51655.41
power_infusion 0 0.0% 3.7 121.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 3.66 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9513 3.0% 12.8 4.64sec 272487 251906 189383 400792 272493 39.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 0.00 0.00 1.0817 0.0000 3480330.58 3480330.58 0.00 251905.80 251905.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.72 60.44% 189383.39 152630 468649 189485.21 152630 300848 1461844 1461844 0.00
crit 5.04 39.43% 400792.28 318016 976467 399787.89 0 817354 2018487 2018487 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 28452 (62096) 9.1% (19.9%) 30.7 11.86sec 739771 689505 0 0 0 0.0% 0.1% 0.0% 0.0% 280.6 25357 54567 37101 40.2% 0.0% 127.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.71 30.71 280.58 280.58 1.0729 1.6612 10409694.62 10409694.62 0.00 45524.63 689505.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.68 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.8 59.80% 25357.33 21342 42660 25361.79 23444 28454 4254278 4254278 0.00
crit 112.8 40.20% 54566.64 44467 106663 54550.35 49464 62072 6155416 6155416 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 14035 4.5% 122.6 2.95sec 41901 0 25506 66554 41931 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.55 122.46 0.00 0.00 0.0000 0.0000 5135030.29 5135030.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.20 59.78% 25505.57 22409 42660 25507.52 23543 28620 1867112 1867112 0.00
crit 49.10 40.10% 66553.75 56403 132264 66547.33 59553 76487 3267918 3267918 0.00
miss 0.16 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 19609 6.3% 161.9 2.23sec 44313 0 30434 65774 44678 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.91 160.58 0.00 0.00 0.0000 0.0000 7174477.92 7174477.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.86 59.70% 30434.29 26478 50863 30432.44 27981 34050 2917443 2917443 0.00
crit 64.72 40.30% 65773.89 55169 127172 65753.50 58424 74357 4257035 4257035 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 3123 1.0% 5.8 54.27sec 198428 0 118358 298522 198429 44.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.76 5.76 0.00 0.00 0.0000 0.0000 1142437.34 1142437.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.18 55.31% 118357.59 83080 161028 114731.73 0 161028 376919 376919 0.00
crit 2.56 44.54% 298522.02 173104 402617 277086.08 0 402617 765518 765518 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 32047 (47750) 10.3% (15.3%) 35.4 10.22sec 493031 459051 0 0 0 0.0% 0.1% 0.0% 0.0% 240.7 33094 71801 48706 40.3% 0.0% 121.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.44 35.44 240.73 240.73 1.0740 1.8489 11724975.22 11724975.22 0.00 36160.73 459050.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.40 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.6 59.67% 33093.70 27457 55792 33098.74 30432 36993 4753459 4753459 0.00
crit 97.1 40.33% 71800.98 57209 139496 71783.23 63700 82368 6971517 6971517 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15704 5.0% 105.1 3.41sec 54674 0 33114 86967 54720 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.09 105.00 0.00 0.00 0.0000 0.0000 5745575.62 5745575.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.65 59.66% 33113.60 28830 55792 33115.79 30116 36869 2074502 2074502 0.00
crit 42.21 40.20% 86967.14 72566 172978 86960.55 76826 101933 3671073 3671073 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 84891 / 21177
melee 84571 6.8% 86.9 4.05sec 88791 91735 64859 144079 88792 40.9% 7.6% 24.0% 6.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.93 86.93 0.00 0.00 0.9679 0.0000 7718840.52 7718840.52 0.00 91734.79 91734.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.21 25.55% 64850.86 50679 105697 64955.33 55557 87278 1440242 1440242 0.00
hit (blocked) 1.77 2.04% 64958.07 50679 105697 54030.66 0 105697 115208 115208 0.00
crit 32.89 37.83% 144052.32 101359 253672 143884.29 116867 182278 4737963 4737963 0.00
crit (blocked) 2.64 3.03% 144406.75 101359 253672 134437.05 0 253672 380597 380597 0.00
glance 19.29 22.19% 50102.72 38010 79273 50108.82 41331 65858 966490 966490 0.00
glance (blocked) 1.56 1.79% 50297.99 38010 79273 39671.28 0 79273 78341 78341 0.00
parry 6.46 7.43% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.06 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.9 19.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.87 18.87 0.00 0.00 1.0678 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 320 0.0% 3.6 85.30sec 8062 0 5046 12011 8063 43.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.62 3.62 0.00 0.00 0.0000 0.0000 29173.00 29173.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.04 56.43% 5045.80 3835 7078 4447.37 0 7078 10303 10303 0.00
crit 1.57 43.42% 12011.00 7669 16987 9660.97 0 16987 18870 18870 0.00
miss 0.01 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3651.90
  • base_dd_max:3651.90
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MB_PI 12052
halo_heal 12052 100.0% 9.0 42.60sec 490026 0 45674 48515 46921 43.9% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.00 93.97 0.00 0.00 0.0000 0.0000 4409492.38 33075889.37 86.67 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.72 56.10% 45674.17 0 350167 45366.03 0 151764 2408062 12381630 80.65
crit 41.25 43.90% 48515.23 0 592877 48222.17 0 186807 2001430 20694259 90.33
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MB_PI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.06%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.6 0.0 26.6sec 26.6sec 27.62% 25.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 126.2sec 126.2sec 16.54% 16.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.54%

    Trigger Attempt Success

    • trigger_pct:99.78%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.1sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.5 36.4sec 23.2sec 41.88% 41.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.88%

    Trigger Attempt Success

    • trigger_pct:99.37%
power_infusion 3.7 0.0 121.4sec 121.4sec 16.61% 16.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:16.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.5 0.0 9.8sec 9.8sec 14.90% 49.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.90%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 6.16%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 7.7 1.7 49.0sec 39.0sec 23.25% 43.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.25%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.5 0.0 55.1sec 54.9sec 17.55% 17.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.55%

    Trigger Attempt Success

    • trigger_pct:99.89%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.73% 0.79%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.73%

Trigger Attempt Success

  • trigger_pct:18.39%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.9 0.0 20.1sec 20.1sec 85.38% 76.40%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.0 0.0 180.0sec 180.0sec 20.55% 26.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 20.48% 20.48%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.19% 2.19%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.19%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 13.6 40.8 3.0 3.0 324473.3
halo Mana 9.0 340745.0 37866.9 37866.9 9.1
mind_blast Mana 36.8 318123.0 8640.4 8640.4 30.5
mind_flay Mana 128.9 371130.8 2879.3 2879.3 66.1
shadow_word_death Mana 12.8 99132.1 7760.9 7761.4 35.1
shadow_word_pain Mana 30.7 394056.9 12831.0 12831.1 57.7
vampiric_touch Mana 35.4 308893.0 8717.1 8717.2 56.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 80.36 225204.60 (12.46%) 2802.55 195712.60 46.50%
Shadow Orbs from Mind Blast Shadow Orb 36.77 35.93 (84.73%) 0.98 0.84 2.29%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.48 6.48 (15.27%) 1.00 0.00 0.00%
Devouring Plague Health Health 190.90 2203959.52 (35.14%) 11545.27 1855341.54 45.71%
Vampiric Touch Mana Mana 345.73 1251535.44 (69.24%) 3619.97 507851.16 28.87%
halo_heal Health 9.00 470067.14 (7.50%) 52238.51 2637114.55 84.87%
external_healing Health 69.89 3310924.57 (52.79%) 47372.34 21184829.97 86.48%
mp5_regen Mana 1462.53 330680.32 (18.30%) 226.10 108078.86 24.63%
vampiric_embrace Health 118.64 286446.89 (4.57%) 2414.39 89438.02 23.79%
pet - mindbender
external_healing Health 20.26 879162.43 (98.38%) 43388.17 6760009.15 88.49%
vampiric_embrace Health 5.04 14433.54 (1.62%) 2864.82 2545.11 14.99%
Resource RPS-Gain RPS-Loss
Health 17140.83 17486.20
Mana 4940.00 5007.40
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 578829.33 118519.20 708811.00
Mana 274253.76 217200.00 300000.00
Shadow Orb 1.56 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.8%
shadowfiend-Mana Cap 24.8%
mindbender-Mana Cap 24.8%

Procs

Count Interval
Shadowy Recall Extra Tick 400.0 0.9sec
Shadowy Apparition Procced 161.9 2.2sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 312274.62
Minimum 275499.55
Maximum 402674.81
Spread ( max - min ) 127175.25
Range [ ( max - min ) / 2 * 100% ] 20.36%
Standard Deviation 10114.4597
5th Percentile 296256.39
95th Percentile 329430.29
( 95th Percentile - 5th Percentile ) 33173.90
Mean Distribution
Standard Deviation 63.9797
95.00% Confidence Intervall ( 312149.23 - 312400.02 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4030
0.1 Scale Factor Error with Delta=300 873311
0.05 Scale Factor Error with Delta=300 3493244
0.01 Scale Factor Error with Delta=300 87331123
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 312274.62
Minimum 275499.55
Maximum 402674.81
Spread ( max - min ) 127175.25
Range [ ( max - min ) / 2 * 100% ] 20.36%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 106504175.06
Minimum 94043293.99
Maximum 135417773.34
Spread ( max - min ) 41374479.35
Range [ ( max - min ) / 2 * 100% ] 19.42%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 12051.79
Minimum 0.00
Maximum 38797.01
Spread ( max - min ) 38797.01
Range [ ( max - min ) / 2 * 100% ] 160.96%
Standard Deviation 8123.0981
5th Percentile 2431.54
95th Percentile 28755.39
( 95th Percentile - 5th Percentile ) 26323.85
Mean Distribution
Standard Deviation 51.3832
95.00% Confidence Intervall ( 11951.08 - 12152.50 )
Normalized 95.00% Confidence Intervall ( 99.16% - 100.84% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17451
0.1% Error 1745164
0.1 Scale Factor Error with Delta=300 563283
0.05 Scale Factor Error with Delta=300 2253134
0.01 Scale Factor Error with Delta=300 56328353
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 12051.79
Minimum 0.00
Maximum 38797.01
Spread ( max - min ) 38797.01
Range [ ( max - min ) / 2 * 100% ] 160.96%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 4409492.38
Minimum 0.00
Maximum 14199707.47
Spread ( max - min ) 14199707.47
Range [ ( max - min ) / 2 * 100% ] 161.01%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 10334.21
Minimum 5507.67
Maximum 13099.68
Spread ( max - min ) 7592.01
Range [ ( max - min ) / 2 * 100% ] 36.73%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 6.87 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 3.66 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.30 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 0.75 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 38.76 mind_blast,if=active_enemies<=5&cooldown_react
I 6.48 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 11.57 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 17.15 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 19.15 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 20.15 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.18 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.87 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 9.00 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.92 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 6.89 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 128.90 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9BHLMSZZZZHZZZZNMHQZZZZWHZLMOZZLHZZZZSOOHLQZZNZHZ9MZZZHZZNZOZHQZZZSZHZLMLMZZHZZZZOOHNNQZZZWHZZ9BMZZSHZNZZZOHQZZZZZHNZLMMZZHZZZZONHMNQSZZWHZZO9ZZHLZZZZOHQZZZZNHZOLMSZZHZZZZNOHMQZZZWHZZOZ9BLHZZZZZSHOQZZNZHZZZOLMHMZZNZZHQOONZZHSZNIFZWHO9QZIFZWHZZNIFMHQZZZI8FWHLMOZNIFHPQSZOIFHMZZNVIFQHZZOVI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 313656 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
313655.5 313655.5 122.78 / 0.04% 16412 / 5.2% 56.3 10163.2 10163.2 84.89 / 0.84% 11435 / 112.5% 2.0 5194.9 5111.9 Mana 0.58% 46.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.49 5.88 7.58 4.67 5.56 4.70
Normalized 1.00 0.78 1.01 0.62 0.74 0.63
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.17 0.17 0.18 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Hit ~= Int > SP > Haste > Mastery ~= Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.49, SpellDamage=5.88, HitRating=7.58, CritRating=4.67, HasteRating=5.56, MasteryRating=4.70 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.49, SpellDamage=5.88, HitRating=0.00, CritRating=4.67, HasteRating=5.56, MasteryRating=4.70 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:925741|689049|449588|323190|288846|254781|124943&chds=0,1851481&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++925741++devouring_plague,9482C9,0,0,15|t++689049++shadow_word_pain,9482C9,1,0,15|t++449588++vampiric_touch,9482C9,2,0,15|t++323190++halo,9482C9,3,0,15|t++288846++shadow_word_death,9482C9,4,0,15|t++254781++mind_blast,9482C9,5,0,15|t++124943++mind_flay,9482C9,6,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,11,10,10,7,7,7,7,6,5,5,4,4,4,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|vampiric_touch|shadow_word_pain|mind_blast|mind_flay_mastery|mindbender: melee|essence_of_yulon|shadowy_apparition|devouring_plague_tick|vampiric_touch_mastery|shadow_word_pain_mastery|devouring_plague|multistrike_spell|shadow_word_death|devouring_plague_mastery|halo_damage|stormlash|mindbender: stormlash& DPS Taken Timeline Chart
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:7.58,7.49,5.88,5.56,4.70,4.67|7.40,7.32,5.71,5.38,4.53,4.49|7.76,7.67,6.05,5.73,4.87,4.84&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.58++Hit,FFFFFF,0,0,15,0.1,e|t++++7.49++Int,FFFFFF,0,1,15,0.1,e|t++++5.88++SP,FFFFFF,0,2,15,0.1,e|t++++5.56++Haste,FFFFFF,0,3,15,0.1,e|t++++4.70++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.67++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.106& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cfjoruvxy024576875420yvsrqrrsttssrrponmmmnnonnnlkkihgfeeefffedddcbbbdccdddeeeeedccbaZbcdddddddcccccceefggefeeddcccccdddeeeeefeddeefghhiiiiiihggggghhhhhiiihihhhhhhhiiiiihhgfeedddddddffffggffffghhhhggffeedcbbbbcdeeefffffeeeffggggfeddcbbaaabbcdeeffghhiijklmmnnnnnmlkjiiijjkkkkklkkklkmmnoooonnmmlkjijjklmmnoppooppppppqqqqqpoonmlklmmmnoppqrstttutuuvvvwvvusrsrpomjhfdbZWUS&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5986,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=313656|max=524021&chxp=1,1,60,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,4,4,12,18,27,59,100,158,211,348,426,520,726,833,1015,1204,1388,1516,1597,1676,1526,1612,1558,1377,1195,1140,961,821,664,547,442,351,273,191,151,121,66,64,28,16,14,12,4,3,3,3,1,3&chds=0,1676&chbh=5&chxt=x&chxl=0:|min=277278|avg=313656|max=357620&chxp=0,1,45,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:52.2,10.9,10.5,9.0,4.0,3.8,2.6,2.1,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 190.9s|mind_blast 40.0s|vampiric_touch 38.3s|shadow_word_pain 32.9s|devouring_plague 14.8s|shadow_word_death 13.9s|halo 9.7s|mindbender 7.5s|waiting 2.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 313656
devouring_plague 11106 (37362) 3.5% (11.9%) 13.7 26.18sec 999175 925741 203861 436311 297009 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.68 13.68 0.00 0.00 1.0794 0.0000 4063372.63 4063372.63 0.00 925740.54 925740.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.17 59.70% 203860.93 169721 353993 203782.16 169721 266361 1664967 1664967 0.00
crit 5.50 40.18% 436310.94 353627 737573 436001.90 0 721385 2398406 2398406 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8588 2.7% 56.9 5.97sec 55239 0 33895 87394 55288 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.88 56.83 0.00 0.00 0.0000 0.0000 3142065.40 3142065.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.98 59.79% 33895.10 28287 59000 33897.80 29551 41182 1151794 1151794 0.00
crit 22.77 40.07% 87393.85 71200 150602 87349.74 73777 108491 1990272 1990272 0.00
miss 0.08 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17668 5.6% 13.7 26.18sec 472491 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.2 34070 72748 49630 40.2% 0.0% 23.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.68 13.68 130.24 130.24 0.0000 0.6493 6464046.84 6464046.84 0.00 76432.47 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.8 59.77% 34069.77 28287 134852 34077.91 29824 53317 2652228 2652228 0.00
crit 52.4 40.23% 72747.56 58939 280975 72699.98 61784 115940 3811819 3811819 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19620 6.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.7 26569 57373 38950 40.3% 0.1% 30.4%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.50 139.70 184.30 0.0000 0.7960 7178252.21 7178252.21 0.00 64552.63 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.9 59.62% 26568.87 21101 47031 26573.15 24211 29931 2919345 2919345 0.00
crit 74.2 40.28% 57373.27 43965 102254 57362.87 50517 66133 4258908 4258908 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8561) 0.0% (2.7%) 9.0 42.93sec 348394 323190 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 8.99 0.00 0.00 1.0780 0.0000 0.00 0.00 0.00 323189.80 323189.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.36 59.59% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.62 40.28% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8561 2.7% 9.0 42.93sec 348394 0 186549 396867 270570 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 11.58 0.00 0.00 0.0000 0.0000 3132355.53 3132355.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.93 59.87% 186549.37 153853 317120 186560.11 153853 265891 1293025 1293025 0.00
crit 4.63 40.03% 396866.66 320566 660744 395814.15 0 628295 1839330 1839330 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27880 8.9% 37.1 9.89sec 274653 254781 188070 404969 274651 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.14 37.14 0.00 0.00 1.0780 0.0000 10200422.92 10200422.92 0.00 254781.27 254781.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.22 59.84% 188070.46 135799 455588 188007.91 146085 223995 4179791 4179791 0.00
crit 14.87 40.03% 404968.97 282948 949254 404965.75 300971 552491 6020632 6020632 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 43724 (65201) 13.9% (20.8%) 127.1 2.83sec 187745 124943 0 0 0 0.0% 0.1% 0.0% 0.0% 251.6 42841 94059 63590 40.5% 0.0% 43.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.06 127.06 251.58 251.58 1.5026 0.6309 15997559.58 15997559.58 0.00 124943.41 124943.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.90 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.16 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.7 59.49% 42840.83 35993 75068 42843.78 39953 46732 6411490 6411490 0.00
crit 101.9 40.51% 94058.66 74995 163211 94053.76 84677 106125 9586070 9586070 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 21477 6.8% 109.9 3.24sec 71522 0 42822 113991 71537 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.87 109.84 0.00 0.00 0.0000 0.0000 7857885.85 7857885.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.29 59.44% 42821.99 35993 75068 42825.23 39142 48229 2796039 2796039 0.00
crit 44.41 40.43% 113990.78 90596 202384 113974.27 98477 136677 5061847 5061847 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 1.0831 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 11098 3.5% 191.2 1.91sec 21231 0 21231 0 21231 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 191.25 191.25 0.00 0.00 0.0000 0.0000 4060360.21 4060360.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 191.25 100.00% 21230.87 7034 337346 21232.83 15320 29120 4060360 4060360 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:29280.36
  • base_dd_max:29280.36
shadow_word_death 10962 3.5% 12.8 4.63sec 312801 288846 217058 459196 312803 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.82 12.82 0.00 0.00 1.0830 0.0000 4010632.03 4010632.03 0.00 288846.38 288846.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.72 60.22% 217057.93 175524 513282 217102.36 175524 335203 1676027 1676027 0.00
crit 5.08 39.65% 459196.49 365719 1069464 458033.64 0 867889 2334605 2334605 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 28267 (61918) 9.0% (19.7%) 30.4 12.08sec 743976 689049 0 0 0 0.0% 0.1% 0.0% 0.0% 272.0 26059 55925 38027 40.1% 0.0% 127.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.45 30.45 271.97 271.97 1.0797 1.7129 10342259.49 10342259.49 0.00 45421.94 689049.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.43 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.0 59.93% 26059.40 21342 46723 26063.80 24116 29224 4247383 4247383 0.00
crit 109.0 40.07% 55924.53 44467 101583 55906.45 50231 63244 6094877 6094877 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 14071 4.5% 118.8 3.04sec 43336 0 26446 68813 43369 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.80 118.71 0.00 0.00 0.0000 0.0000 5148248.07 5148248.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.05 59.85% 26446.45 22409 46723 26448.34 24229 30388 1878944 1878944 0.00
crit 47.51 40.02% 68813.04 56403 125965 68803.13 60713 79467 3269304 3269304 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 19579 6.2% 156.5 2.31sec 45774 0 31526 67956 46185 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.49 155.10 0.00 0.00 0.0000 0.0000 7163367.62 7163367.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.69 59.76% 31525.77 26478 55707 31523.80 28723 35724 2922241 2922241 0.00
crit 62.41 40.24% 67955.81 55169 121116 67928.28 61030 78906 4241126 4241126 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2796 0.9% 5.3 59.65sec 193546 0 117493 290150 193540 44.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.29 5.29 0.00 0.00 0.0000 0.0000 1022900.21 1022900.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.95 55.73% 117493.41 91415 166781 112627.01 0 166781 346063 346063 0.00
crit 2.33 44.14% 290150.07 199070 383445 263581.68 0 383445 676837 676837 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 31465 (47032) 10.0% (15.0%) 35.5 10.23sec 485257 449588 0 0 0 0.0% 0.1% 0.0% 0.0% 231.0 33976 73391 49840 40.2% 0.0% 121.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.46 35.46 230.98 230.98 1.0794 1.9214 11512174.93 11512174.93 0.00 35693.16 449588.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.43 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.0 59.75% 33975.65 27457 61105 33981.39 31185 38666 4689049 4689049 0.00
crit 93.0 40.25% 73390.73 57209 132854 73372.60 64806 87165 6823126 6823126 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15567 5.0% 100.9 3.55sec 56423 0 34281 89626 56466 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.94 100.86 0.00 0.00 0.0000 0.0000 5695356.20 5695356.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.22 59.70% 34280.65 28830 61105 34283.43 31030 39222 2064355 2064355 0.00
crit 40.51 40.17% 89626.39 72566 164741 89620.92 78833 103937 3631002 3631002 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 84713 / 21227
melee 84393 6.7% 87.7 4.08sec 88223 91115 64521 143188 88223 40.8% 7.5% 24.0% 6.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.70 87.70 0.00 0.00 0.9683 0.0000 7737014.74 7737014.74 0.00 91114.82 91114.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.47 25.62% 64510.71 50679 105697 64611.92 55566 82197 1449669 1449669 0.00
hit (blocked) 1.80 2.06% 64651.60 50679 105697 54113.37 0 105697 116559 116559 0.00
crit 33.12 37.76% 143156.70 101359 253672 143019.98 116764 178623 4740769 4740769 0.00
crit (blocked) 2.65 3.03% 143575.31 101359 253672 133914.92 0 253672 381136 381136 0.00
glance 19.48 22.21% 49836.52 38010 79273 49845.81 41516 65261 970886 970886 0.00
glance (blocked) 1.56 1.78% 49868.56 38010 79273 39632.50 0 79273 77996 77996 0.00
parry 6.49 7.40% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.06 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.9 20.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.94 18.94 0.00 0.00 1.0779 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 319 0.0% 3.6 86.13sec 8063 0 5046 12024 8063 43.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.63 3.63 0.00 0.00 0.0000 0.0000 29267.80 29267.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.05 56.57% 5046.13 3835 7078 4466.98 0 7078 10362 10362 0.00
crit 1.57 43.32% 12023.70 7669 16987 9664.93 0 16987 18906 18906 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3803.10
  • base_dd_max:3803.10
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MB_ToF 10163
halo_heal 10163 100.0% 9.0 42.93sec 413584 0 39127 40103 39554 43.8% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.99 94.01 0.00 0.00 0.0000 0.0000 3718465.16 34438692.15 89.20 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.82 56.18% 39126.83 0 402692 38872.00 0 171073 2066398 12927861 84.09
crit 41.20 43.82% 40102.57 -0 694407 39850.03 0 204840 1652067 21510831 92.32
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MB_ToF
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.23%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.7 0.0 26.3sec 26.3sec 27.11% 26.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 127.1sec 127.1sec 16.53% 16.53%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.53%

    Trigger Attempt Success

    • trigger_pct:99.84%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.1sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.2sec 41.87% 41.87%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.87%

    Trigger Attempt Success

    • trigger_pct:99.39%
shadow_word_death_reset_cooldown 6.5 0.0 9.8sec 9.8sec 14.94% 49.40%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.94%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 7.6 1.7 49.1sec 39.1sec 23.16% 52.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.16%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.5 0.0 54.8sec 54.6sec 17.62% 17.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.62%

    Trigger Attempt Success

    • trigger_pct:99.86%
twist_of_fate 1.0 258.9 113.0sec 0.5sec 31.85% 31.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:31.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.71% 0.81%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.72%

Trigger Attempt Success

  • trigger_pct:17.95%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
mindbender-shadowcrawl 18.9 0.0 20.1sec 20.1sec 85.41% 76.27%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.0 0.0 180.0sec 180.0sec 20.45% 26.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:20.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 20.45% 20.45%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 2.0 0.0 180.0sec 0.0sec 2.14% 2.14%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:2.14%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 13.7 41.0 3.0 3.0 333326.9
halo Mana 9.0 364129.0 40500.0 40500.0 8.6
mind_blast Mana 37.1 334254.2 9000.0 9000.0 30.5
mind_flay Mana 127.1 381188.0 3000.0 3000.0 62.6
shadow_word_death Mana 12.8 100016.6 7800.0 7800.6 40.1
shadow_word_pain Mana 30.4 401936.8 13200.0 13200.0 56.4
vampiric_touch Mana 35.5 319147.2 9000.0 9000.0 53.9
Resource Gains Type Count Total Average Overflow
mindbender Mana 81.09 246426.23 (13.18%) 3038.91 178333.01 41.98%
Shadow Orbs from Mind Blast Shadow Orb 37.09 36.26 (84.82%) 0.98 0.84 2.25%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.49 6.49 (15.18%) 1.00 0.00 0.00%
Devouring Plague Health Health 187.08 2212102.86 (35.33%) 11824.45 1766000.78 44.39%
Vampiric Touch Mana Mana 331.85 1278985.23 (68.38%) 3854.13 409512.21 24.25%
halo_heal Health 8.99 382800.82 (6.11%) 42576.76 2861880.22 88.20%
external_healing Health 69.90 3378784.74 (53.97%) 48337.99 20971019.47 86.12%
mp5_regen Mana 1462.53 344911.43 (18.44%) 235.83 93847.75 21.39%
vampiric_embrace Health 118.64 286734.06 (4.58%) 2416.81 89150.85 23.72%
pet - mindbender
external_healing Health 20.32 863490.28 (98.42%) 42496.61 6770583.97 88.69%
vampiric_embrace Health 4.85 13904.84 (1.58%) 2867.21 2465.34 15.06%
Resource RPS-Gain RPS-Loss
Health 17110.83 17486.20
Mana 5111.92 5194.87
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 563962.32 132932.64 708811.00
Mana 268714.06 213600.00 300000.00
Shadow Orb 1.76 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.5%
shadowfiend-Mana Cap 21.5%
mindbender-Mana Cap 21.5%

Procs

Count Interval
Shadowy Recall Extra Tick 386.2 0.9sec
Shadowy Apparition Procced 156.5 2.3sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 313655.50
Minimum 277277.80
Maximum 357619.75
Spread ( max - min ) 80341.95
Range [ ( max - min ) / 2 * 100% ] 12.81%
Standard Deviation 9903.3049
5th Percentile 297743.73
95th Percentile 330567.49
( 95th Percentile - 5th Percentile ) 32823.76
Mean Distribution
Standard Deviation 62.6440
95.00% Confidence Intervall ( 313532.72 - 313778.28 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3829
0.1 Scale Factor Error with Delta=300 837228
0.05 Scale Factor Error with Delta=300 3348913
0.01 Scale Factor Error with Delta=300 83722842
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 313655.50
Minimum 277277.80
Maximum 357619.75
Spread ( max - min ) 80341.95
Range [ ( max - min ) / 2 * 100% ] 12.81%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 106991259.72
Minimum 94484030.19
Maximum 121765613.88
Spread ( max - min ) 27281583.69
Range [ ( max - min ) / 2 * 100% ] 12.75%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 10163.15
Minimum 0.00
Maximum 38798.34
Spread ( max - min ) 38798.34
Range [ ( max - min ) / 2 * 100% ] 190.88%
Standard Deviation 6847.1375
5th Percentile 2267.66
95th Percentile 25137.53
( 95th Percentile - 5th Percentile ) 22869.87
Mean Distribution
Standard Deviation 43.3120
95.00% Confidence Intervall ( 10078.26 - 10248.04 )
Normalized 95.00% Confidence Intervall ( 99.16% - 100.84% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17436
0.1% Error 1743642
0.1 Scale Factor Error with Delta=300 400222
0.05 Scale Factor Error with Delta=300 1600890
0.01 Scale Factor Error with Delta=300 40022274
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 10163.15
Minimum 0.00
Maximum 38798.34
Spread ( max - min ) 38798.34
Range [ ( max - min ) / 2 * 100% ] 190.88%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 3718465.16
Minimum 0.00
Maximum 14200191.71
Spread ( max - min ) 14200191.71
Range [ ( max - min ) / 2 * 100% ] 190.94%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 10281.24
Minimum 5747.39
Maximum 13166.32
Spread ( max - min ) 7418.93
Range [ ( max - min ) / 2 * 100% ] 36.08%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 6.94 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.33 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 0.76 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 38.59 mind_blast,if=active_enemies<=5&cooldown_react
I 6.49 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 12.31 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 18.92 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 18.14 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 18.77 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.18 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.92 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.99 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.94 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 6.49 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 127.06 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9HLMSZZZWHZZZZZMHNQZZZZWHZLMOZZZHLZZZZOHMLQSZZNHZ9OZZZHZZZNOZHQZZZZWHZZLMMNSHZZZZZHMMNQZNWHZZZ9OZHZZZZNZWHSOZZZZHQZZZLLHMMZZZZHZZONNZHQZZSZO9HZZNZZZHZZZMZZHQZNZZLHMMZZSZHZZNOMHQZZZZZHZZ9MNZWHZZZZZZHOQSZNZWHZZLMOZHZZZNZZHMNMQZZZHZIFZNO9HGSIFZZWHZIFMNQWHZZI8FZLHMOGIFNZHZZIFMMHQSZVIFNZHZO9

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 318213 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
318213.0 318213.0 133.09 / 0.04% 17653 / 5.5% 66.7 11332.5 11332.5 59.65 / 0.53% 7873 / 69.5% 2.4 4643.8 4583.5 Mana 0.50% 46.8 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.64 5.91 8.26 4.69 6.76 5.12
Normalized 1.00 0.77 1.08 0.61 0.88 0.67
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.19 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Hit > Int > Haste > SP > Mastery > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.64, SpellDamage=5.91, HitRating=8.26, CritRating=4.69, HasteRating=6.76, MasteryRating=5.12 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.64, SpellDamage=5.91, HitRating=0.00, CritRating=4.69, HasteRating=6.76, MasteryRating=5.12 )

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:878104|692855|449121|311239|253088|242809|222387|124065&chds=0,1756209&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++878104++devouring_plague,9482C9,0,0,15|t++692855++shadow_word_pain,9482C9,1,0,15|t++449121++vampiric_touch,9482C9,2,0,15|t++311239++halo,9482C9,3,0,15|t++253088++shadow_word_death,9482C9,4,0,15|t++242809++mind_blast,9482C9,5,0,15|t++222387++mind_flay_insanity,9482C9,6,0,15|t++124065++mind_flay,9482C9,7,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,9,8,8,6,6,6,5,4,4,4,4,4,3,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay_insanity|mind_blast|vampiric_touch|shadow_word_pain|mind_flay|devouring_plague_tick|essence_of_yulon|shadowy_apparition|mind_flay_insanity_mastery|vampiric_touch_mastery|shadow_word_pain_mastery|mind_flay_mastery|devouring_plague|multistrike_spell|devouring_plague_mastery|shadow_word_death|shadowfiend: melee|halo_damage|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.26,7.64,6.76,5.91,5.12,4.69|8.07,7.45,6.57,5.73,4.94,4.51|8.45,7.83,6.95,6.10,5.31,4.88&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.26++Hit,FFFFFF,0,0,15,0.1,e|t++++7.64++Int,FFFFFF,0,1,15,0.1,e|t++++6.76++Haste,FFFFFF,0,2,15,0.1,e|t++++5.91++SP,FFFFFF,0,3,15,0.1,e|t++++5.12++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.69++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.918& http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cfilortvx01446687542zxwuttttuuuuuttsrrrrqqrrrqpnmlkihfeedccbbbbbbbabbbbbbbbbbbbbaaaZZaabbcddefgghhhhiijjihhggffeedccccbbccccdddddeeeeffffgggggggghiiijjkkklllllmllkkkjjiihgeeeddddeefghhhhhhhhiiiihhggfeedccccccddeeffgffggffggggggffeeeddccccddddddddddeeeeeefffffffeeeeffgghhijjkkkkkkllmmmllkkjiihggggggggghhhggghhhhhhhhhhhhhhhhghiiijjkjkklmmnnnoooppppponmmmmmkhfdbZXVTR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5785,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=318213|max=550087&chxp=1,1,58,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,4,5,20,15,29,45,89,135,201,300,395,535,670,828,1013,1161,1277,1433,1561,1605,1610,1580,1529,1410,1265,1155,973,898,715,565,454,388,281,217,187,136,86,64,52,34,25,16,12,5,4,2,3,3,1&chds=0,1610&chbh=5&chxt=x&chxl=0:|min=280663|avg=318213|max=366197&chxp=0,1,44,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:30.8,22.0,13.2,9.4,8.1,4.8,3.7,2.4,0.9,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 112.6s|mind_flay_insanity 80.6s|mind_blast 48.3s|vampiric_touch 34.2s|shadow_word_pain 29.6s|devouring_plague 17.5s|shadow_word_death 13.7s|halo 8.8s|shadowfiend 3.2s|waiting 1.8s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 318213
devouring_plague 12398 (41943) 3.9% (13.2%) 16.2 22.15sec 946491 878104 191798 412456 279763 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 0.00 0.00 1.0779 0.0000 4535863.06 4535863.06 0.00 878104.32 878104.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.71 59.90% 191798.34 169721 307820 191762.43 169721 235567 1862807 1862807 0.00
crit 6.48 39.97% 412455.70 353627 769642 412576.63 0 688446 2673056 2673056 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9703 3.0% 67.7 5.08sec 52464 0 32051 83185 52530 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.67 67.58 0.00 0.00 0.0000 0.0000 3550153.32 3550153.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.38 59.74% 32050.94 28287 51304 32056.99 28829 38225 1294090 1294090 0.00
crit 27.12 40.13% 83184.99 71200 159064 83138.62 72170 104866 2256064 2256064 0.00
miss 0.09 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 19842 6.2% 16.2 22.15sec 447764 0 0 0 0 0.0% 0.0% 0.0% 0.0% 154.8 32084 68916 46887 40.2% 0.0% 27.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 154.84 154.84 0.0000 0.6422 7259734.72 7259734.72 0.00 73006.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.6 59.81% 32083.98 28287 94466 32090.32 28976 41609 2971221 2971221 0.00
crit 62.2 40.19% 68915.51 58939 253866 68877.05 60168 86018 4288513 4288513 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 18905 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.4 25357 54798 37197 40.3% 0.1% 30.5%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.78 140.36 185.95 0.0000 0.7950 6916737.66 6916737.66 0.00 61986.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.8 59.61% 25357.41 21101 40897 25365.77 23157 29406 2810487 2810487 0.00
crit 74.9 40.30% 54798.39 43965 102254 54797.06 48761 63075 4106251 4106251 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7528) 0.0% (2.4%) 8.2 46.54sec 335312 311239 0 0 0 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 1.0774 0.0000 0.00 0.00 0.00 311239.24 311239.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.90 59.66% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.30 40.20% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7528 2.4% 8.2 46.54sec 335312 0 178191 381093 259470 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 10.61 0.00 0.00 0.0000 0.0000 2754155.99 2754155.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.34 59.76% 178191.26 153853 275756 178195.34 0 242422 1130389 1130389 0.00
crit 4.26 40.14% 381093.40 320566 689472 379403.81 0 574560 1623767 1623767 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 32085 10.1% 44.9 8.18sec 261673 242809 179367 386144 261671 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.86 44.86 0.00 0.00 1.0777 0.0000 11739064.20 11739064.20 0.00 242808.53 242808.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.90 59.96% 179367.44 135799 396163 179336.52 151016 211211 4824538 4824538 0.00
crit 17.91 39.92% 386143.77 282948 990526 386234.61 302098 504831 6914526 6914526 0.00
miss 0.06 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 25582 (38169) 8.0% (12.0%) 75.1 4.66sec 185935 124065 0 0 0 0.0% 0.1% 0.0% 0.0% 149.8 41671 92799 62493 40.7% 0.0% 25.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.11 75.11 149.78 149.78 1.4987 0.6244 9359923.81 9359923.81 0.00 124065.06 124065.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.01 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.8 59.27% 41671.12 35993 65277 41681.94 37921 48036 3699543 3699543 0.00
crit 61.0 40.73% 92798.75 74995 163211 92779.45 80543 109564 5660381 5660381 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 34023 (48968) 10.7% (15.4%) 51.5 6.69sec 347568 222387 0 0 0 0.0% 0.1% 0.0% 0.0% 104.3 81696 175391 119349 40.2% 0.0% 18.4%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.55 51.55 104.30 104.30 1.5629 0.6465 12447968.60 12447968.60 0.00 222386.74 222386.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.48 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.4 59.81% 81696.18 71987 130553 81711.20 73835 95647 5096480 5096480 0.00
crit 41.9 40.19% 175391.48 149990 326421 175306.53 153489 215459 7351489 7351489 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 14945 4.7% 45.6 7.53sec 119975 0 73239 190353 120080 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.58 45.54 0.00 0.00 0.0000 0.0000 5467952.22 5467952.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.23 59.79% 73238.97 35993 130553 73285.53 56171 91186 1993963 1993963 0.00
crit 18.25 40.08% 190353.12 90596 404768 190338.11 130073 289774 3473989 3473989 0.00
miss 0.06 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 12587 4.0% 65.4 5.22sec 70387 0 41642 112583 70414 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.43 65.40 0.00 0.00 0.0000 0.0000 4605087.75 4605087.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.74 59.24% 41642.44 35993 65277 41653.62 36710 50300 1613251 1613251 0.00
crit 26.57 40.63% 112582.79 90596 202384 112554.30 92840 149954 2991836 2991836 0.00
miss 0.08 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
multistrike_spell 11905 3.7% 192.6 1.90sec 22613 0 22613 0 22613 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.62 192.62 0.00 0.00 0.0000 0.0000 4355609.73 4355609.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 192.62 100.00% 22613.25 7034 330175 22616.71 15882 31067 4355610 4355610 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:31017.15
  • base_dd_max:31017.15
shadow_word_death 9472 3.0% 12.6 4.75sec 274047 253088 190117 401529 274051 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.65 12.65 0.00 0.00 1.0829 0.0000 3465529.48 3465529.48 0.00 253087.67 253087.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.59 60.06% 190116.81 152630 446332 190132.39 152630 298260 1443899 1443899 0.00
crit 5.03 39.82% 401528.63 318016 929969 400424.34 0 807052 2021631 2021631 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 25599 (56050) 8.0% (17.6%) 27.5 13.34sec 747008 692855 0 0 0 0.0% 0.1% 0.0% 0.0% 257.7 24923 53466 36349 40.0% 0.0% 121.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.45 27.45 257.67 257.67 1.0782 1.7201 9365999.83 9365999.83 0.00 43372.33 692855.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.43 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 154.5 59.97% 24922.63 21342 40629 24927.31 22681 27886 3851088 3851088 0.00
crit 103.1 40.03% 53466.11 44467 101583 53446.74 47952 60459 5514912 5514912 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 12736 4.0% 112.6 3.20sec 41402 0 25262 65788 41436 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.55 112.46 0.00 0.00 0.0000 0.0000 4659910.69 4659910.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.34 59.88% 25261.51 22409 40629 25263.80 23349 28518 1701206 1701206 0.00
crit 44.97 39.99% 65788.03 56403 125965 65778.41 58082 74383 2958705 2958705 0.00
miss 0.14 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0853 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 17715 5.6% 148.1 2.44sec 43756 0 30122 64973 44149 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.12 146.80 0.00 0.00 0.0000 0.0000 6481220.64 6481220.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.72 59.75% 30122.13 26478 48441 30120.53 27499 33640 2642254 2642254 0.00
crit 59.09 40.25% 64973.43 55169 121116 64948.67 58547 74768 3838966 3838966 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2631 0.8% 5.1 60.44sec 187722 0 112702 282357 187729 44.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 5.13 0.00 0.00 0.0000 0.0000 962471.99 962471.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.85 55.56% 112701.96 83080 153360 107573.53 0 153360 321063 321063 0.00
crit 2.27 44.31% 282357.46 173104 383445 254966.47 0 383445 641409 641409 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:106984.80
  • base_dd_max:106984.80
vampiric_touch 28135 (42004) 8.8% (13.2%) 31.7 11.43sec 484344 449121 0 0 0 0.0% 0.1% 0.0% 0.0% 215.3 32567 70446 47818 40.3% 0.0% 112.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.73 31.73 215.28 215.28 1.0785 1.9155 10293973.37 10293973.37 0.00 34412.43 449120.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.70 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.6 59.74% 32566.67 27457 53135 32573.47 29856 36982 4188192 4188192 0.00
crit 86.7 40.26% 70445.99 57209 132854 70426.60 61956 81387 6105781 6105781 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 13868 4.4% 94.0 3.78sec 53959 0 32765 85785 53991 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.04 93.98 0.00 0.00 0.0000 0.0000 5074033.64 5074033.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.16 59.76% 32764.61 28830 53135 32767.10 29331 37020 1840079 1840079 0.00
crit 37.70 40.11% 85785.38 72566 164741 85778.72 75683 101278 3233955 3233955 0.00
miss 0.12 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 112728 / 8553
melee 112265 2.7% 28.1 13.76sec 111058 121388 77038 181002 111059 42.1% 7.4% 24.0% 6.6% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.06 28.06 0.00 0.00 0.9149 0.0000 3116635.95 3116635.95 0.00 121387.96 121387.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.94 24.73% 76986.27 57590 120110 77157.15 0 120110 534323 534323 0.00
hit (blocked) 0.53 1.87% 77721.93 57590 120110 32017.64 0 120110 40815 40815 0.00
crit 10.96 39.06% 180891.98 115181 288264 180475.88 130326 266331 1983004 1983004 0.00
crit (blocked) 0.85 3.02% 182424.03 115181 288264 105002.28 0 288264 154505 154505 0.00
glance 6.24 22.24% 60041.36 43193 90083 59981.95 0 90083 374707 374707 0.00
glance (blocked) 0.48 1.72% 60629.33 43193 90083 23346.99 0 90083 29282 29282 0.00
parry 2.03 7.23% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 89.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 4.99 0.00 0.00 1.0748 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 463 0.0% 1.3 1.75sec 9894 0 5861 14406 9893 47.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.30 1.30 0.00 0.00 0.0000 0.0000 12837.21 12837.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.68 52.55% 5860.90 4377 7078 2995.20 0 7078 3996 3996 0.00
crit 0.61 47.30% 14406.03 10506 16987 6774.83 0 16987 8841 8841 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4169.46
  • base_dd_max:4169.46
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MFI_DI 11332
halo_heal 11332 100.0% 8.2 46.54sec 504803 0 44934 47040 45852 43.6% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.21 90.42 0.00 0.00 0.0000 0.0000 4146304.05 31517203.07 86.84 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.99 56.40% 44933.76 -0 350167 45020.52 0 132476 2291463 11881772 80.66
crit 39.43 43.60% 47040.27 -0 631328 47115.76 0 178433 1854841 19635431 90.49
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_DI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 17.2 1.3 19.9sec 18.4sec 7.97% 36.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:7.97%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 16.2 0.0 22.2sec 22.2sec 27.21% 27.39%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 126.2sec 126.2sec 16.59% 16.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.59%

    Trigger Attempt Success

    • trigger_pct:99.80%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.1sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.3sec 23.3sec 41.86% 41.86%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.86%

    Trigger Attempt Success

    • trigger_pct:99.40%
shadow_word_death_reset_cooldown 6.4 0.0 10.0sec 10.0sec 14.53% 49.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 7.7 1.7 49.1sec 39.1sec 23.17% 52.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.17%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 54.5sec 54.4sec 17.70% 17.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.70%

    Trigger Attempt Success

    • trigger_pct:99.90%
vampiric_embrace 0.1 0.0 0.0sec 0.0sec 0.57% 0.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.57%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.3sec 90.3sec 85.51% 76.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.76% 51.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.76% 20.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 16.2 48.6 3.0 3.0 315755.7
halo Mana 8.2 332655.7 40500.0 40500.1 8.3
mind_blast Mana 44.9 239851.1 5346.5 5346.5 48.9
mind_flay Mana 75.1 225316.9 3000.0 2999.9 62.0
mind_flay_insanity Mana 51.5 154640.2 3000.0 3000.0 115.9
shadow_word_death Mana 12.6 98644.4 7800.0 7800.6 35.1
shadow_word_pain Mana 27.5 362370.1 13200.0 13200.0 56.6
vampiric_touch Mana 31.7 285563.9 9000.0 8999.9 53.8
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 26.00 119635.74 (7.13%) 4601.54 114355.62 48.87%
Shadow Orbs from Mind Blast Shadow Orb 44.80 43.73 (87.26%) 0.98 1.08 2.40%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.39 6.39 (12.74%) 1.00 0.00 0.00%
Devouring Plague Health Health 222.42 2561981.23 (40.88%) 11518.53 2167685.49 45.83%
Vampiric Touch Mana Mana 309.25 1199911.02 (71.55%) 3880.01 373683.42 23.75%
halo_heal Health 8.21 374315.05 (5.97%) 45571.93 2438099.77 86.69%
external_healing Health 70.68 3047895.46 (48.64%) 43124.73 21734285.40 87.70%
mp5_regen Mana 1462.53 357424.49 (21.31%) 244.39 81334.69 18.54%
vampiric_embrace Health 118.64 282601.08 (4.51%) 2381.97 93283.83 24.82%
pet - shadowfiend
external_healing Health 12.76 138308.00 (97.15%) 10842.86 4838230.08 97.22%
vampiric_embrace Health 1.39 4055.14 (2.85%) 2908.49 996.79 19.73%
Resource RPS-Gain RPS-Loss
Health 17128.25 17486.20
Mana 4583.46 4643.78
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 574540.47 160682.90 708811.00
Mana 277048.56 182700.00 300000.00
Shadow Orb 1.54 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 18.6%
shadowfiend-Mana Cap 18.6%
mindbender-Mana Cap 18.6%

Procs

Count Interval
Shadowy Recall Extra Tick 385.0 0.9sec
Shadowy Apparition Procced 148.1 2.4sec
Divine Insight Mind Blast CD Reset 31.4 18.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 318213.02
Minimum 280662.70
Maximum 366197.18
Spread ( max - min ) 85534.48
Range [ ( max - min ) / 2 * 100% ] 13.44%
Standard Deviation 10735.1438
5th Percentile 301236.31
95th Percentile 336541.41
( 95th Percentile - 5th Percentile ) 35305.10
Mean Distribution
Standard Deviation 67.9059
95.00% Confidence Intervall ( 318079.92 - 318346.11 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4371
0.1 Scale Factor Error with Delta=300 983783
0.05 Scale Factor Error with Delta=300 3935132
0.01 Scale Factor Error with Delta=300 98378320
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 318213.02
Minimum 280662.70
Maximum 366197.18
Spread ( max - min ) 85534.48
Range [ ( max - min ) / 2 * 100% ] 13.44%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 113295390.68
Minimum 99394077.28
Maximum 129305226.69
Spread ( max - min ) 29911149.41
Range [ ( max - min ) / 2 * 100% ] 13.20%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 11332.50
Minimum 0.00
Maximum 36141.52
Spread ( max - min ) 36141.52
Range [ ( max - min ) / 2 * 100% ] 159.46%
Standard Deviation 4811.0425
5th Percentile 4328.10
95th Percentile 20074.15
( 95th Percentile - 5th Percentile ) 15746.05
Mean Distribution
Standard Deviation 30.4326
95.00% Confidence Intervall ( 11272.85 - 11392.15 )
Normalized 95.00% Confidence Intervall ( 99.47% - 100.53% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 6923
0.1% Error 692345
0.1 Scale Factor Error with Delta=300 197588
0.05 Scale Factor Error with Delta=300 790354
0.01 Scale Factor Error with Delta=300 19758867
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 11332.50
Minimum 0.00
Maximum 36141.52
Spread ( max - min ) 36141.52
Range [ ( max - min ) / 2 * 100% ] 159.46%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 4146304.05
Minimum 0.00
Maximum 13227795.76
Spread ( max - min ) 13227795.76
Range [ ( max - min ) / 2 * 100% ] 159.51%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 9353.59
Minimum 4450.43
Maximum 12193.19
Spread ( max - min ) 7742.76
Range [ ( max - min ) / 2 * 100% ] 41.39%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.26 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 2.12 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 46.05 mind_blast,if=active_enemies<=5&cooldown_react
I 6.39 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 5.67 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 45.87 mind_flay_insanity,interrupt=1,chain=1
L 15.96 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 19.20 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 11.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 14.28 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.15 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 14.09 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.21 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.34 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 9.91 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 75.11 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSHZZHQKKKJOHNZZZHZZZLHMMQKKKHLZZHONMSZZHQKKKLHOZZZZWHZZZOHNQKKKJHZSLMMHZNZZZZHQKKKHMZZNZWHZWHQKKKJHMSNZZZWHZZZOZHQKKKJHLLMMZZZHZZZSOZHNGAHKKZZZOHZZZNZWHQKKKJHLMMSZNZHZZZOMHQKKHKLZZOWHZZZZZWHQKKKJHLMSZZZHLMZOZNHQKKKOHNOZWWWWWWWWWWWHZIFLQKHKKIFHMQKKHIFLHQHKK8IFLMHMQKKHIFLSZOZHGIFKKZHNOIAFM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 318317 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
318317.3 318317.3 130.76 / 0.04% 17295 / 5.4% 63.8 11864.3 11864.3 62.64 / 0.53% 8282 / 69.8% 2.4 4857.6 4784.2 Mana 0.33% 46.6 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.70 6.03 8.30 4.80 5.63 5.09
Normalized 1.00 0.78 1.08 0.62 0.73 0.66
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.18 0.19 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Hit > Int > SP > Haste > Mastery > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.70, SpellDamage=6.03, HitRating=8.30, CritRating=4.80, HasteRating=5.63, MasteryRating=5.09 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.70, SpellDamage=6.03, HitRating=0.00, CritRating=4.80, HasteRating=5.63, MasteryRating=5.09 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:900175|714684|468352|321382|252484|245382|227312|132878&chds=0,1800350&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++900175++devouring_plague,9482C9,0,0,15|t++714684++shadow_word_pain,9482C9,1,0,15|t++468352++vampiric_touch,9482C9,2,0,15|t++321382++halo,9482C9,3,0,15|t++252484++shadow_word_death,9482C9,4,0,15|t++245382++mind_blast,9482C9,5,0,15|t++227312++mind_flay_insanity,9482C9,6,0,15|t++132878++mind_flay,9482C9,7,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:11,10,10,9,8,6,6,5,5,5,4,4,4,3,3,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|vampiric_touch|mind_flay_insanity|shadow_word_pain|mind_blast|essence_of_yulon|shadowy_apparition|devouring_plague_tick|mind_flay_mastery|vampiric_touch_mastery|shadow_word_pain_mastery|mind_flay_insanity_mastery|multistrike_spell|devouring_plague|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|halo_damage|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.30,7.70,6.03,5.63,5.09,4.80|8.11,7.52,5.84,5.45,4.90,4.61|8.48,7.88,6.21,5.82,5.27,4.98&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.30++Hit,FFFFFF,0,0,15,0.1,e|t++++7.70++Int,FFFFFF,0,1,15,0.1,e|t++++6.03++SP,FFFFFF,0,2,15,0.1,e|t++++5.63++Haste,FFFFFF,0,3,15,0.1,e|t++++5.09++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.80++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,9.966& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:bfilnqsuvwz0356775320ywutsrrstsrqonkihiggghiiiihffedbaZYZZYYXWVUTSRRSSSSTTUVVWXXXXXXYYYYZZabbbbaaaZZZZZaZZaaaaZZZZYYZZZaaaaabaaaaabccdeefffffffffggghhhhggffeedddccccccbbaZYYYYYYYYZZabbbbbbbbcddcccbbbaaZYYYYYYYYZZZaaaaaaZZZaaaaaaaaaZZYYYZYZZZaaaabbbccddeeffffggfeeeeeeeeeeeeeeeddedeeefeeeddccbbbaabbbbbbcccbbccccccccccccccccccddddeefeeffgghhhiiiiiiiiihgghhhfdbZXWUSRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5026,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=318317|max=633330&chxp=1,1,50,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,3,8,15,19,35,77,96,150,221,312,431,555,716,883,1058,1200,1474,1507,1565,1675,1692,1527,1520,1329,1229,1078,951,802,642,542,422,300,250,192,133,123,82,59,37,30,21,10,7,3,5,0,2,2&chds=0,1692&chbh=5&chxt=x&chxl=0:|min=279841|avg=318317|max=365212&chxp=0,1,45,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:36.6,18.8,10.6,9.7,8.3,3.9,3.8,2.5,0.9,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 134.0s|mind_flay_insanity 69.0s|mind_blast 38.8s|vampiric_touch 35.6s|shadow_word_pain 30.5s|devouring_plague 14.4s|shadow_word_death 13.8s|halo 9.0s|shadowfiend 3.2s|waiting 1.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 318317
devouring_plague 10339 (35429) 3.2% (11.1%) 13.4 26.85sec 966942 900175 193728 414641 282177 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.41 13.41 0.00 0.00 1.0742 0.0000 3782767.00 3782767.00 0.00 900175.21 900175.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.01 59.72% 193727.81 169721 323211 193649.50 0 254771 1550906 1550906 0.00
crit 5.38 40.15% 414641.10 353627 728700 414558.89 0 637612 2231861 2231861 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8182 2.6% 56.9 6.01sec 52635 0 32239 83345 52706 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.88 56.80 0.00 0.00 0.0000 0.0000 2993627.40 2993627.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.93 59.74% 32239.44 28287 53869 32249.14 28511 38399 1093886 1093886 0.00
crit 22.79 40.13% 83345.21 71200 150602 83308.42 71515 103526 1899742 1899742 0.00
miss 0.08 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16908 5.3% 13.4 26.85sec 461455 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.2 32538 69714 47518 40.3% 0.0% 22.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.41 13.41 130.19 130.19 0.0000 0.6291 6186128.59 6186128.59 0.00 75529.94 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.7 59.71% 32538.38 28287 73905 32543.48 28885 38002 2529150 2529150 0.00
crit 52.5 40.29% 69714.37 58939 153986 69668.57 60111 83136 3656979 3656979 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19348 6.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.6 25653 55634 37718 40.3% 0.1% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 29.19 142.65 187.68 0.0000 0.7953 7079013.38 7079013.38 0.00 62394.90 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.8 59.57% 25653.21 21101 42942 25663.40 23338 28826 2868231 2868231 0.00
crit 75.7 40.33% 55633.96 43965 107367 55643.92 49420 64237 4210782 4210782 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (7918) 0.0% (2.5%) 8.4 45.45sec 344651 321382 0 0 0 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 1.0725 0.0000 0.00 0.00 0.00 321381.63 321381.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.02 59.72% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.38 40.17% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 7918 2.5% 8.4 45.45sec 344651 0 179152 384042 260883 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 11.10 0.00 0.00 0.0000 0.0000 2896934.00 2896934.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.66 59.94% 179151.58 153853 289544 179137.09 0 237768 1192308 1192308 0.00
crit 4.44 39.97% 384042.27 320566 655612 382810.17 0 603288 1704626 1704626 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26004 8.2% 36.2 10.16sec 262915 245382 179966 388079 262911 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.19 36.19 0.00 0.00 1.0715 0.0000 9514213.17 9514213.17 0.00 245382.44 245382.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.68 59.91% 179965.93 135799 415972 179910.93 145253 216873 3901694 3901694 0.00
crit 14.46 39.97% 388078.50 282948 937492 388184.46 288649 513061 5612519 5612519 0.00
miss 0.04 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 32588 (48670) 10.2% (15.3%) 89.9 3.94sec 198130 132878 0 0 0 0.0% 0.1% 0.0% 0.0% 187.3 42378 94676 63666 40.7% 0.0% 30.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.88 89.88 187.28 187.28 1.4911 0.5941 11922957.93 11922957.93 0.00 132878.19 132878.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.76 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.0 59.30% 42378.02 35993 68540 42390.37 38629 47850 4705990 4705990 0.00
crit 76.2 40.70% 94675.85 74995 171371 94665.73 81425 111679 7216968 7216968 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 29729 (42843) 9.3% (13.5%) 44.7 7.67sec 350920 227312 0 0 0 0.0% 0.1% 0.0% 0.0% 90.6 82239 176101 120034 40.3% 0.0% 15.7%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.67 44.67 90.62 90.62 1.5438 0.6353 10876962.27 10876962.27 0.00 227311.90 227311.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.61 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.1 59.73% 82239.14 71987 137081 82278.66 73592 97958 4451556 4451556 0.00
crit 36.5 40.27% 176101.29 149990 309058 176025.73 152198 212095 6425406 6425406 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 13114 4.1% 39.6 8.57sec 121051 0 74138 191738 121169 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.64 39.60 0.00 0.00 0.0000 0.0000 4798011.55 4798011.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.68 59.79% 74137.95 35993 137081 74219.68 57183 95135 1755303 1755303 0.00
crit 15.87 40.08% 191738.43 90596 383238 191797.69 127324 262600 3042709 3042709 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 16083 5.1% 81.8 4.24sec 71893 0 42421 115097 71920 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.85 81.82 0.00 0.00 0.0000 0.0000 5884181.24 5884181.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.44 59.21% 42421.32 35993 68540 42434.72 37543 49603 2054902 2054902 0.00
crit 33.27 40.66% 115096.75 90596 212503 115083.67 94712 144790 3829279 3829279 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
multistrike_spell 11702 3.7% 195.1 1.87sec 21940 0 21941 0 21941 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.14 195.14 0.00 0.00 0.0000 0.0000 4281399.40 4281399.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 195.14 100.00% 21940.53 7034 325489 21943.49 16330 30180 4281399 4281399 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:68852.50
  • base_dd_max:68852.50
power_infusion 0 0.0% 4.0 120.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 3.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9534 3.0% 12.8 4.70sec 272720 252484 189468 400294 272725 39.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 0.00 0.00 1.0802 0.0000 3488065.71 3488065.71 0.00 252483.95 252483.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.71 60.28% 189467.50 152630 468649 189526.39 0 286275 1460742 1460742 0.00
crit 5.06 39.60% 400293.91 318016 976467 399463.64 0 909365 2027323 2027323 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 27284 (59613) 8.6% (18.7%) 28.5 12.88sec 766509 714684 0 0 0 0.0% 0.1% 0.0% 0.0% 269.4 25316 54518 37050 40.2% 0.0% 122.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.45 28.45 269.43 269.43 1.0725 1.6651 9982383.03 9982383.03 0.00 45520.38 714683.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.43 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 161.2 59.82% 25315.81 21342 42660 25320.53 23470 28451 4080171 4080171 0.00
crit 108.3 40.18% 54518.18 44467 106663 54502.68 49223 62051 5902212 5902212 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 13495 4.2% 117.6 3.06sec 41980 0 25536 66723 42013 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.62 117.53 0.00 0.00 0.0000 0.0000 4937573.09 4937573.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.27 59.79% 25535.86 22409 42660 25538.31 23415 29023 1794314 1794314 0.00
crit 47.11 40.08% 66722.56 56403 132264 66718.65 58346 76591 3143260 3143260 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 18834 5.9% 155.4 2.32sec 44351 0 30462 65876 44738 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 155.37 154.03 0.00 0.00 0.0000 0.0000 6890767.63 6890767.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.94 59.69% 30462.24 26478 50863 30460.84 27493 34130 2800624 2800624 0.00
crit 62.09 40.31% 65876.28 55169 127172 65856.90 59055 74714 4090143 4090143 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 3103 1.0% 5.7 54.26sec 199038 0 118608 299723 199038 44.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.70 5.70 0.00 0.00 0.0000 0.0000 1135267.19 1135267.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.16 55.39% 118607.53 83080 161028 114672.91 0 161028 374747 374747 0.00
crit 2.54 44.49% 299723.34 173104 402617 277807.02 0 402617 760520 760520 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 30602 (45605) 9.6% (14.3%) 33.1 10.97sec 503355 468352 0 0 0 0.0% 0.1% 0.0% 0.0% 229.7 33094 71849 48739 40.4% 0.0% 116.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.15 33.15 229.72 229.72 1.0748 1.8532 11196303.76 11196303.76 0.00 36167.40 468351.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.12 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.0 59.63% 33093.63 27457 55792 33098.02 30288 37200 4533077 4533077 0.00
crit 92.7 40.37% 71848.63 57209 139496 71831.28 64030 82684 6663227 6663227 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15003 4.7% 100.3 3.57sec 54720 0 33140 87105 54757 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.31 100.25 0.00 0.00 0.0000 0.0000 5489202.71 5489202.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.88 59.73% 33139.50 28830 55792 33142.20 29998 37793 1984410 1984410 0.00
crit 40.24 40.14% 87104.54 72566 172978 87093.36 76399 101727 3504793 3504793 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 112580 / 8547
melee 112123 2.7% 28.1 13.75sec 110863 121160 77011 180805 110865 42.0% 7.4% 24.0% 6.6% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.09 28.09 0.00 0.00 0.9150 0.0000 3114528.45 3114528.45 0.00 121159.59 121159.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.95 24.74% 76955.13 57590 120110 77090.13 0 120110 534793 534793 0.00
hit (blocked) 0.52 1.87% 77744.29 57590 120110 31739.42 0 120110 40782 40782 0.00
crit 10.95 38.98% 180628.50 115181 288264 180156.00 130481 268420 1977844 1977844 0.00
crit (blocked) 0.86 3.05% 183063.91 115181 288264 106454.37 0 288264 156830 156830 0.00
glance 6.26 22.29% 59885.93 43193 90083 59838.85 0 90083 375017 375017 0.00
glance (blocked) 0.48 1.72% 60458.02 43193 90083 23374.70 0 90083 29261 29261 0.00
parry 2.03 7.22% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 89.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 4.99 0.00 0.00 1.0746 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 457 0.0% 1.3 1.79sec 9794 0 5827 14325 9794 46.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.30 1.30 0.00 0.00 0.0000 0.0000 12684.54 12684.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.69 53.08% 5826.91 4377 7078 3010.43 0 7078 4006 4006 0.00
crit 0.61 46.78% 14325.45 10506 16987 6721.84 0 16987 8679 8679 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4169.46
  • base_dd_max:4169.46
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MFI_PI 11864
halo_heal 11864 100.0% 8.4 45.45sec 516441 0 45049 48111 46384 43.6% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.41 93.59 0.00 0.00 0.0000 0.0000 4340900.26 32476340.34 86.63 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.78 56.39% 45048.66 -0 350167 44956.55 0 127732 2377411 12252081 80.61
crit 40.81 43.61% 48111.28 -0 632455 47981.85 0 169895 1963489 20224260 90.27
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_PI
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.4 0.0 27.0sec 27.0sec 27.75% 25.18%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 126.1sec 126.1sec 16.58% 16.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.58%

    Trigger Attempt Success

    • trigger_pct:99.82%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.1sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.3sec 23.2sec 41.94% 41.94%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.94%

    Trigger Attempt Success

    • trigger_pct:99.36%
power_infusion 4.0 0.0 120.9sec 120.9sec 16.97% 16.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:16.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 6.5 0.0 10.0sec 10.0sec 14.67% 49.53%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 6.19%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 7.7 1.7 49.0sec 39.1sec 23.22% 43.37%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.22%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.5 0.0 55.1sec 54.9sec 17.58% 17.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.58%

    Trigger Attempt Success

    • trigger_pct:99.90%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.68% 0.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.68%

Trigger Attempt Success

  • trigger_pct:17.65%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.3sec 90.3sec 85.52% 76.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.67% 51.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.74% 20.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 13.4 40.2 3.0 3.0 322609.4
halo Mana 8.4 325935.9 38777.1 38776.9 8.9
mind_blast Mana 36.2 312061.2 8623.4 8623.5 30.5
mind_flay Mana 89.9 255685.6 2844.9 2844.9 69.6
mind_flay_insanity Mana 44.7 131208.0 2937.4 2937.4 119.5
shadow_word_death Mana 12.8 98553.1 7704.9 7705.5 35.4
shadow_word_pain Mana 28.5 364044.4 12793.8 12793.9 59.9
vampiric_touch Mana 33.1 289775.0 8741.7 8741.7 57.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 26.03 116855.22 (6.68%) 4489.79 117386.70 50.11%
Shadow Orbs from Mind Blast Shadow Orb 36.14 35.31 (84.54%) 0.98 0.83 2.30%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.46 6.46 (15.46%) 1.00 0.00 0.00%
Devouring Plague Health Health 186.99 2189128.16 (34.97%) 11707.48 1786990.24 44.94%
Vampiric Touch Mana Mana 329.96 1278979.54 (73.07%) 3876.12 400065.50 23.83%
halo_heal Health 8.41 433510.34 (6.92%) 51575.46 2436724.52 84.90%
external_healing Health 70.48 3351079.57 (53.53%) 47543.40 21367654.27 86.44%
mp5_regen Mana 1462.53 354592.52 (20.26%) 242.45 84166.66 19.18%
vampiric_embrace Health 118.64 286923.52 (4.58%) 2418.40 88961.39 23.67%
pet - shadowfiend
external_healing Health 12.76 138510.45 (97.15%) 10851.85 4839413.81 97.22%
vampiric_embrace Health 1.39 4066.09 (2.85%) 2923.73 969.88 19.26%
Resource RPS-Gain RPS-Loss
Health 17111.43 17486.20
Mana 4784.23 4857.57
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 568625.76 160682.90 708811.00
Mana 271426.33 134700.00 300000.00
Shadow Orb 1.60 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 19.3%
shadowfiend-Mana Cap 19.3%
mindbender-Mana Cap 19.3%

Procs

Count Interval
Shadowy Recall Extra Tick 396.0 0.9sec
Shadowy Apparition Procced 155.4 2.3sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 318317.28
Minimum 279841.43
Maximum 365212.24
Spread ( max - min ) 85370.82
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 10547.2641
5th Percentile 301622.19
95th Percentile 336211.79
( 95th Percentile - 5th Percentile ) 34589.59
Mean Distribution
Standard Deviation 66.7174
95.00% Confidence Intervall ( 318186.52 - 318448.04 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4217
0.1 Scale Factor Error with Delta=300 949649
0.05 Scale Factor Error with Delta=300 3798597
0.01 Scale Factor Error with Delta=300 94964942
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 318317.28
Minimum 279841.43
Maximum 365212.24
Spread ( max - min ) 85370.82
Range [ ( max - min ) / 2 * 100% ] 13.41%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 113335759.03
Minimum 99086435.86
Maximum 130236047.58
Spread ( max - min ) 31149611.72
Range [ ( max - min ) / 2 * 100% ] 13.74%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 11864.31
Minimum 0.00
Maximum 33684.79
Spread ( max - min ) 33684.79
Range [ ( max - min ) / 2 * 100% ] 141.96%
Standard Deviation 5052.2101
5th Percentile 4487.67
95th Percentile 21052.37
( 95th Percentile - 5th Percentile ) 16564.70
Mean Distribution
Standard Deviation 31.9581
95.00% Confidence Intervall ( 11801.67 - 11926.95 )
Normalized 95.00% Confidence Intervall ( 99.47% - 100.53% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 6965
0.1% Error 696584
0.1 Scale Factor Error with Delta=300 217894
0.05 Scale Factor Error with Delta=300 871578
0.01 Scale Factor Error with Delta=300 21789460
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 11864.31
Minimum 0.00
Maximum 33684.79
Spread ( max - min ) 33684.79
Range [ ( max - min ) / 2 * 100% ] 141.96%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 4340900.26
Minimum 0.00
Maximum 12328631.94
Spread ( max - min ) 12328631.94
Range [ ( max - min ) / 2 * 100% ] 142.01%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 10344.10
Minimum 5503.92
Maximum 13039.58
Spread ( max - min ) 7535.67
Range [ ( max - min ) / 2 * 100% ] 36.42%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 3.97 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.34 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 0.80 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 38.61 mind_blast,if=active_enemies<=5&cooldown_react
I 6.46 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 4.90 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 39.77 mind_flay_insanity,interrupt=1,chain=1
L 16.01 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 17.84 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 12.44 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 17.28 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.18 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.61 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.41 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.38 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 4.27 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 89.87 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABHLMSZZZZHZZZZONHQKKKKZWHZLMMZZNHZZZZSOHMLQKKKHLOZZZHZZZZZHMNZZZZWHQKKKKLMHMLSZZZZHZOONZZHLQKKKJBHMZZZZNWHZZZSZMHQKKKKNHLMOZZZHZZZZONHMMQKKKHSAZZONWHZZZZZHQKKKJHLMLMZZZHZZSZOZHLMQKKKHZOZZZBNHZZZZOZHQKKKKNSHZZOZLMZHZZNZZOHOZNZZHQKKIFLMHSZZIFQKHKKMIFLZHQKKI8FJLHMMZIFLQHKKIFMSZHQKKIFJAHLBM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 321416 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
321415.6 321415.6 131.74 / 0.04% 17542 / 5.5% 62.0 12659.0 12659.0 68.87 / 0.54% 9064 / 71.6% 2.5 5050.0 4964.3 Mana 0.35% 45.6 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.85 6.18 8.62 4.89 8.43 5.20
Normalized 1.00 0.79 1.10 0.62 1.07 0.66
Scale Deltas -1000 -1000 -1000 -1000 -1000 -1000
Error 0.18 0.19 0.19 0.18 0.19 0.18
Gear Ranking
Optimizers
Ranking
  • Hit ~= Haste > Int > SP > Mastery > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.85, SpellDamage=6.18, HitRating=8.62, CritRating=4.89, HasteRating=8.43, MasteryRating=5.20 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.85, SpellDamage=6.18, HitRating=0.00, CritRating=4.89, HasteRating=8.43, MasteryRating=5.20 )

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:923547|712222|459718|325823|288744|253906|231420|127537&chds=0,1847094&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++923547++devouring_plague,9482C9,0,0,15|t++712222++shadow_word_pain,9482C9,1,0,15|t++459718++vampiric_touch,9482C9,2,0,15|t++325823++halo,9482C9,3,0,15|t++288744++shadow_word_death,9482C9,4,0,15|t++253906++mind_blast,9482C9,5,0,15|t++231420++mind_flay_insanity,9482C9,6,0,15|t++127537++mind_flay,9482C9,7,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:10,10,10,9,9,6,6,6,5,5,4,4,4,4,3,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mind_flay_insanity|vampiric_touch|mind_blast|shadow_word_pain|essence_of_yulon|shadowy_apparition|devouring_plague_tick|vampiric_touch_mastery|mind_flay_mastery|shadow_word_pain_mastery|mind_flay_insanity_mastery|multistrike_spell|devouring_plague|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|halo_damage|stormlash|shadowfiend: stormlash& DPS Taken Timeline Chart
http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x240&chd=t1:8.62,8.43,7.85,6.18,5.20,4.89|8.43,8.25,7.67,5.99,5.02,4.71|8.81,8.62,8.04,6.36,5.39,5.08&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++8.62++Hit,FFFFFF,0,0,15,0.1,e|t++++8.43++Haste,FFFFFF,0,1,15,0.1,e|t++++7.85++Int,FFFFFF,0,2,15,0.1,e|t++++6.18++SP,FFFFFF,0,3,15,0.1,e|t++++5.20++Mastery,FFFFFF,0,4,15,0.1,e|t++++4.89++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,10.353& http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dgjmprtuwyz2255876531zywvvvwxxxwwvtronmlllnooopnmmkjihfffffedcbZYXVWXWXXZZabcdddddddcddeeeffffeeedddeefhhhiiihgeedddddddccbabaZZZZabcdfghhiijiiiijklllllkkjjiiiiiiijjkkjjihffffefffffghgggffgghijjjiihhggfeedddddddddeeeeeedeefffgggggfffedddcddddddddeeeffghhijkklmllllllllmmnnoopooopppqqrrqqqqpoonmlllllllmmnnmmmnnnnnnnnoooooonnmooooppqpqrssttuuuuvvvvvvvtttttsqnligebZXU&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6079,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=321416|max=528753&chxp=1,1,61,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,3,10,17,25,43,70,115,192,282,386,556,715,856,1041,1234,1416,1500,1652,1615,1691,1589,1534,1486,1229,1118,1004,763,643,547,412,342,285,191,139,89,71,36,32,17,13,8,7,4,6,3,0,0,0,1&chds=0,1691&chbh=5&chxt=x&chxl=0:|min=284825|avg=321416|max=373365&chxp=0,1,41,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:35.8,19.0,10.8,9.9,8.4,4.0,3.8,2.5,0.9,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 131.0s|mind_flay_insanity 69.7s|mind_blast 39.7s|vampiric_touch 36.2s|shadow_word_pain 30.6s|devouring_plague 14.7s|shadow_word_death 13.9s|halo 9.1s|shadowfiend 3.2s|waiting 1.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 321416
devouring_plague 11040 (37049) 3.4% (11.5%) 13.6 26.38sec 996998 923547 203988 436465 297084 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.60 13.60 0.00 0.00 1.0796 0.0000 4039056.86 4039056.86 0.00 923547.19 923547.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.12 59.71% 203988.41 169721 353993 203910.78 169721 282013 1655859 1655859 0.00
crit 5.46 40.16% 436465.13 353627 737573 436095.64 0 682141 2383198 2383198 0.00
miss 0.02 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8489 2.6% 56.3 6.05sec 55135 0 33844 87278 55191 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.33 56.27 0.00 0.00 0.0000 0.0000 3105807.01 3105807.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.67 59.84% 33843.58 28287 59000 33848.99 29563 41883 1139579 1139579 0.00
crit 22.53 40.03% 87278.25 71200 150602 87232.79 72686 112606 1966228 1966228 0.00
miss 0.07 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17520 5.5% 13.6 26.38sec 471475 0 0 0 0 0.0% 0.0% 0.0% 0.0% 129.1 34064 72774 49651 40.3% 0.0% 22.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.60 13.60 129.10 129.10 0.0000 0.6494 6410038.19 6410038.19 0.00 76457.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.1 59.73% 34064.39 28287 83466 34070.65 30044 40235 2626946 2626946 0.00
crit 52.0 40.27% 72774.15 58939 173908 72722.99 62075 88688 3783092 3783092 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 19703 6.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.9 26574 57414 38973 40.3% 0.1% 30.4%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.59 139.91 184.97 0.0000 0.7956 7208910.64 7208910.64 0.00 64759.61 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.3 59.62% 26573.86 21101 47031 26579.67 24178 30353 2930362 2930362 0.00
crit 74.5 40.29% 57413.98 43965 102254 57404.09 50574 67151 4278549 4278549 0.00
miss 0.2 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (8099) 0.0% (2.5%) 8.4 45.39sec 350875 325823 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 8.45 0.00 0.00 1.0769 0.0000 0.00 0.00 0.00 325822.67 325822.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.04 59.62% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.40 40.25% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 8099 2.5% 8.4 45.39sec 350875 0 186621 400678 272513 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 10.87 0.00 0.00 0.0000 0.0000 2963357.20 2963357.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.49 59.66% 186620.93 153853 317120 186562.28 0 262820 1210585 1210585 0.00
crit 4.37 40.23% 400677.64 320566 660744 399282.85 0 628295 1752772 1752772 0.00
miss 0.01 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27531 8.6% 36.8 9.98sec 273696 253906 187531 403744 273699 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.80 36.80 0.00 0.00 1.0779 0.0000 10072707.62 10072707.62 0.00 253906.07 253906.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.05 59.93% 187530.97 135799 455588 187478.32 153488 230414 4135876 4135876 0.00
crit 14.70 39.96% 403743.95 282948 949254 403814.09 282948 529951 5936832 5936832 0.00
miss 0.04 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 30581 (45649) 9.5% (14.2%) 87.0 4.07sec 191969 127537 0 0 0 0.0% 0.1% 0.0% 0.0% 174.5 42856 95151 64118 40.7% 0.0% 29.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.00 87.00 174.50 174.50 1.5052 0.6241 11188711.06 11188711.06 0.00 127536.72 127536.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.89 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.6 59.34% 42855.76 35993 75068 42863.98 39139 48298 4437736 4437736 0.00
crit 71.0 40.66% 95150.59 74995 163211 95139.05 82903 110710 6750975 6750975 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 30560 (44056) 9.5% (13.7%) 45.3 7.55sec 355473 231420 0 0 0 0.0% 0.1% 0.0% 0.0% 89.5 85785 183156 124877 40.1% 0.0% 15.9%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.34 45.34 89.54 89.54 1.5361 0.6489 11180891.36 11180891.36 0.00 231420.35 231420.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.28 99.87% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.6 59.85% 85785.26 71987 150136 85814.73 76519 101552 4597248 4597248 0.00
crit 35.9 40.15% 183156.21 149990 312820 183050.74 155561 224157 6583644 6583644 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 13496 4.2% 39.1 8.67sec 126224 0 77373 199786 126331 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.12 39.09 0.00 0.00 0.0000 0.0000 4937767.57 4937767.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.37 59.80% 77373.48 35993 150136 77455.59 57587 101466 1808398 1808398 0.00
crit 15.66 40.07% 199785.82 90596 383238 199818.60 138188 274687 3129370 3129370 0.00
miss 0.05 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 15069 4.7% 76.3 4.55sec 72304 0 42898 115675 72339 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.25 76.22 0.00 0.00 0.0000 0.0000 5513243.30 5513243.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.23 59.34% 42898.39 35993 75068 42908.39 38242 49335 1940163 1940163 0.00
crit 30.89 40.53% 115675.33 90596 202384 115652.33 96520 148438 3573081 3573081 0.00
miss 0.10 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
multistrike_spell 11914 3.7% 190.3 1.92sec 22905 0 22905 0 22905 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 190.30 190.30 0.00 0.00 0.0000 0.0000 4358845.60 4358845.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 190.30 100.00% 22904.90 7034 356488 22907.64 16344 31062 4358846 4358846 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:58413.17
  • base_dd_max:58413.17
shadow_word_death 10935 3.4% 12.8 4.72sec 312670 288744 217431 458832 312669 39.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 0.00 0.00 1.0829 0.0000 4000548.38 4000548.38 0.00 288744.02 288744.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.72 60.32% 217431.29 175524 513282 217517.99 0 325460 1678036 1678036 0.00
crit 5.06 39.56% 458832.29 365719 1069464 457560.16 0 988333 2322512 2322512 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 27204 (59661) 8.5% (18.6%) 28.4 12.84sec 767706 712222 0 0 0 0.0% 0.1% 0.0% 0.0% 262.3 26013 55835 37950 40.0% 0.0% 123.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.43 28.43 262.27 262.27 1.0779 1.7159 9953246.46 9953246.46 0.00 45412.55 712221.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.41 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.3 59.97% 26013.46 21342 46723 26018.75 23892 29510 4091719 4091719 0.00
crit 105.0 40.03% 55835.28 44467 101583 55816.23 50248 63887 5861527 5861527 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 13583 4.2% 114.6 3.15sec 43360 0 26454 68869 43397 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.61 114.52 0.00 0.00 0.0000 0.0000 4969592.18 4969592.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.53 59.84% 26454.17 22409 46723 26457.22 24007 29619 1812798 1812798 0.00
crit 45.84 40.03% 68869.03 56403 125965 68856.92 60149 78979 3156795 3156795 0.00
miss 0.15 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 181.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0853 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 18874 5.9% 150.8 2.39sec 45787 0 31519 67970 46193 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.82 149.49 0.00 0.00 0.0000 0.0000 6905337.43 6905337.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.31 59.74% 31519.36 26478 55707 31516.96 28873 35062 2815056 2815056 0.00
crit 60.18 40.26% 67969.51 55169 121116 67942.81 60928 78715 4090282 4090282 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 2741 0.9% 5.1 60.14sec 194788 0 117625 291622 194790 44.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.15 5.15 0.00 0.00 0.0000 0.0000 1002744.47 1002744.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.85 55.42% 117625.04 91415 166781 112028.59 0 166781 335601 335601 0.00
crit 2.29 44.44% 291622.35 199070 383445 263581.05 0 383445 667144 667144 0.00
miss 0.01 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:106984.80
  • base_dd_max:106984.80
vampiric_touch 30470 (45543) 9.5% (14.2%) 33.6 10.83sec 496176 459718 0 0 0 0.0% 0.1% 0.0% 0.0% 223.7 33969 73416 49844 40.2% 0.0% 117.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.58 33.58 223.66 223.66 1.0793 1.9186 11148189.75 11148189.75 0.00 35806.33 459718.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.55 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 133.7 59.76% 33969.38 27457 61105 33975.64 30816 38664 4540042 4540042 0.00
crit 90.0 40.24% 73416.19 57209 132854 73393.46 66019 84282 6608148 6608148 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 15073 4.7% 97.8 3.64sec 56409 0 34259 89610 56444 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.76 97.70 0.00 0.00 0.0000 0.0000 5514749.91 5514749.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.34 59.71% 34259.06 28830 61105 34260.99 30926 38825 1998671 1998671 0.00
crit 39.24 40.16% 89610.23 72566 164741 89600.43 78658 106444 3516079 3516079 0.00
miss 0.13 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 112804 / 8535
melee 112348 2.6% 28.0 13.76sec 111019 121365 76921 180972 111022 42.1% 7.4% 24.0% 6.7% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.02 28.02 0.00 0.00 0.9148 0.0000 3110220.08 3110220.08 0.00 121364.97 121364.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.90 24.64% 76878.43 57590 120110 77022.33 0 120110 530707 530707 0.00
hit (blocked) 0.53 1.89% 77481.71 57590 120110 32082.13 0 120110 41101 41101 0.00
crit 10.94 39.06% 180860.10 115181 288264 180415.03 132441 288264 1979115 1979115 0.00
crit (blocked) 0.85 3.05% 182400.26 115181 288264 105464.47 0 288264 155855 155855 0.00
glance 6.24 22.26% 60017.35 43193 90083 59978.19 0 90083 374236 374236 0.00
glance (blocked) 0.48 1.72% 60586.36 43193 90083 23294.97 0 90083 29207 29207 0.00
parry 2.03 7.25% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.0 89.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 4.99 0.00 0.00 1.0747 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 456 0.0% 1.3 1.76sec 9806 0 5827 14322 9806 46.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.29 1.29 0.00 0.00 0.0000 0.0000 12604.63 12604.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.68 52.91% 5826.78 4377 7078 2983.39 0 7078 3963 3963 0.00
crit 0.60 46.94% 14321.63 10506 16987 6661.02 0 16987 8642 8642 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33
Healing Stats HPS HPS% Count Interval HPE HPET Hit Crit Avg Crit% Ticks T-Hit T-Crit T-Avg T-Crit% Up%
Priest_Shadow_T16H_MFI_ToF 12659
halo_heal 12659 100.0% 8.4 45.39sec 548412 0 47733 49583 48540 43.6% 0.0 0 0 0 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.45 95.42 0.00 0.00 0.0000 0.0000 4631681.19 34374850.60 86.53 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.84 56.43% 47733.43 -0 402692 47534.90 0 142770 2570131 12985339 80.27
crit 41.57 43.57% 49583.49 0 686341 49396.14 0 171974 2061550 21389511 90.36
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_ToF
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
amplified 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.48%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 13.6 0.0 26.5sec 26.5sec 27.44% 26.33%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:27.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 3.1 0.0 126.7sec 126.7sec 16.57% 16.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:16.57%

    Trigger Attempt Success

    • trigger_pct:99.86%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 339.1sec 0.0sec 11.95% 11.95%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:11.95%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 10.4 5.4 36.4sec 23.2sec 41.85% 41.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.85%

    Trigger Attempt Success

    • trigger_pct:99.43%
shadow_word_death_reset_cooldown 6.5 0.0 10.0sec 10.0sec 14.67% 49.48%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 2.0 0.0 180.0sec 180.0sec 5.47% 5.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 5.47% 5.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:5.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.83%
tempus_repit 7.7 1.7 49.0sec 39.0sec 23.23% 52.62%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:23.23%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 6.6 0.0 54.5sec 54.3sec 17.72% 17.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.72%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 253.6 54.0sec 0.5sec 31.88% 31.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:31.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace 0.2 0.0 0.0sec 0.0sec 0.76% 0.86%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_vampiric_embrace
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vampiric_embrace_1:0.76%

Trigger Attempt Success

  • trigger_pct:19.32%

Spelldata details

  • id:15286
  • name:Vampiric Embrace
  • tooltip:{$15286s1=50}% of any single-target Shadow spell damage you deal heals you and your allies, split evenly between them.
  • description:Fills you with the embrace of Shadow energy, causing you and your allies to be healed for {$15286s1=50}% of any single-target Shadow spell damage you deal, split evenly between them. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.0 0.0 90.4sec 90.4sec 85.47% 76.92%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 2.0 0.0 180.0sec 180.0sec 45.99% 52.22%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:45.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 20.81% 20.81%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:20.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 13.6 40.8 3.0 3.0 332620.0
halo Mana 8.4 342045.2 40500.0 40499.7 8.7
mind_blast Mana 36.8 331225.2 9000.0 9000.1 30.4
mind_flay Mana 87.0 261006.2 3000.0 3000.0 64.0
mind_flay_insanity Mana 45.3 136034.0 3000.0 3000.0 118.5
shadow_word_death Mana 12.8 99807.2 7800.0 7800.6 40.1
shadow_word_pain Mana 28.4 375314.0 13200.0 13200.0 58.2
vampiric_touch Mana 33.6 302243.8 9000.0 9000.0 55.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 25.95 127015.31 (6.99%) 4894.92 106520.29 45.61%
Shadow Orbs from Mind Blast Shadow Orb 36.76 35.88 (84.73%) 0.98 0.88 2.40%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.46 6.46 (15.27%) 1.00 0.00 0.00%
Devouring Plague Health Health 185.38 2225005.32 (35.53%) 12002.46 1716956.62 43.56%
Vampiric Touch Mana Mana 321.36 1318810.57 (72.61%) 4103.83 316249.19 19.34%
halo_heal Health 8.45 450902.74 (7.20%) 53389.32 2562878.82 85.04%
external_healing Health 70.44 3298920.83 (52.67%) 46830.11 21284637.31 86.58%
mp5_regen Mana 1462.53 370500.97 (20.40%) 253.33 68258.21 15.56%
vampiric_embrace Health 118.64 288279.06 (4.60%) 2429.83 87605.86 23.31%
pet - shadowfiend
external_healing Health 12.74 137413.03 (97.17%) 10785.65 4829924.50 97.23%
vampiric_embrace Health 1.37 3995.93 (2.83%) 2913.76 975.65 19.62%
Resource RPS-Gain RPS-Loss
Health 17118.17 17486.20
Mana 4964.34 5050.02
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 572604.59 140438.38 708811.00
Mana 267606.82 156900.00 300000.00
Shadow Orb 1.57 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.6%
shadowfiend-Mana Cap 15.6%
mindbender-Mana Cap 15.6%

Procs

Count Interval
Shadowy Recall Extra Tick 383.8 0.9sec
Shadowy Apparition Procced 150.8 2.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 321415.64
Minimum 284825.29
Maximum 373364.85
Spread ( max - min ) 88539.56
Range [ ( max - min ) / 2 * 100% ] 13.77%
Standard Deviation 10626.2611
5th Percentile 304606.86
95th Percentile 339691.08
( 95th Percentile - 5th Percentile ) 35084.21
Mean Distribution
Standard Deviation 67.2171
95.00% Confidence Intervall ( 321283.90 - 321547.38 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4198
0.1 Scale Factor Error with Delta=300 963928
0.05 Scale Factor Error with Delta=300 3855712
0.01 Scale Factor Error with Delta=300 96392808
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 321415.64
Minimum 284825.29
Maximum 373364.85
Spread ( max - min ) 88539.56
Range [ ( max - min ) / 2 * 100% ] 13.77%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 114473745.00
Minimum 100458745.90
Maximum 133451919.06
Spread ( max - min ) 32993173.16
Range [ ( max - min ) / 2 * 100% ] 14.41%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 17486.13
Minimum 16532.18
Maximum 17538.76
Spread ( max - min ) 1006.59
Range [ ( max - min ) / 2 * 100% ] 2.88%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 12658.96
Minimum 0.00
Maximum 37281.51
Spread ( max - min ) 37281.51
Range [ ( max - min ) / 2 * 100% ] 147.25%
Standard Deviation 5554.6579
5th Percentile 4650.62
95th Percentile 22778.37
( 95th Percentile - 5th Percentile ) 18127.74
Mean Distribution
Standard Deviation 35.1364
95.00% Confidence Intervall ( 12590.09 - 12727.82 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7396
0.1% Error 739630
0.1 Scale Factor Error with Delta=300 263389
0.05 Scale Factor Error with Delta=300 1053557
0.01 Scale Factor Error with Delta=300 26338940
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 12658.96
Minimum 0.00
Maximum 37281.51
Spread ( max - min ) 37281.51
Range [ ( max - min ) / 2 * 100% ] 147.25%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 4631681.19
Minimum 0.00
Maximum 13645032.35
Spread ( max - min ) 13645032.35
Range [ ( max - min ) / 2 * 100% ] 147.30%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 10249.08
Minimum 5546.87
Maximum 13037.21
Spread ( max - min ) 7490.34
Range [ ( max - min ) / 2 * 100% ] 36.54%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 2.99 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 6.33 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 0.76 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 38.28 mind_blast,if=active_enemies<=5&cooldown_react
I 6.46 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 5.26 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 40.09 mind_flay_insanity,interrupt=1,chain=1
L 16.64 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 18.49 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 11.79 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 17.32 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.19 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 12.84 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 8.45 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.38 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 3.99 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 87.00 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 0.00 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZZHZZZZOZNHQKKKKZWHLMMZZZNHZZZSONHMQKKKJHLZOZZZHZZZZONHQKKKJHSLMMZNZHZZZOOZHNQKKKKHLZOZZZWHZSZZZHLMQKKKHZZZLMMHNZZZZZHOMNQKKKHJLSZAOWHZZZZZHNQKKKJHMZZZLMHNZZOSZHQKKKZHNMZZZZHZZZOZNHQKKKKZSHOZZZNLHMZZOZZHQKKKMLHOZZZIFHQKKKIFHLMSZZIFHQKKKI8FHLLMMZIFHPQKKKIFHLLMZSIFHQKAKJ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 352 - 366 ( 365.9 )

Performance:

Total Events Processed: 809034607
Max Event Queue: 227
Sim Seconds: 9146869
CPU Seconds: 1067.8100
Physical Seconds: 139.9400
Speed Up: 8566

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
Standard Deviation 0.6801
5th Percentile 365.41
95th Percentile 366.00
( 95th Percentile - 5th Percentile ) 0.59
Mean Distribution
Standard Deviation 0.0043
95.00% Confidence Intervall ( 365.87 - 365.88 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 13
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 4637554 12675 2.72 191603 412125 16.6 16.6 40.1% 0.1% 0.0% 0.0% 21.60sec 4637554 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 3628617 9918 11.33 32040 83194 69.2 69.1 40.1% 0.1% 0.0% 0.0% 4.97sec 3628617 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 7428129 20295 25.95 32119 68990 16.6 158.3 40.2% 0.0% 0.0% 0.0% 21.60sec 7428129 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 7084553 19357 23.61 25362 54819 0.0 144.0 40.3% 0.1% 0.0% 0.0% 0.00sec 7084553 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.46 0 0 8.9 8.9 40.5% 0.1% 0.0% 0.0% 43.37sec 0 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 2968145 8112 1.87 179055 381372 8.9 11.4 40.3% 0.1% 0.0% 0.0% 43.37sec 2968145 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 3635958 9938 15.67 37193 39121 8.9 95.6 43.8% 0.0% 0.0% 0.0% 43.37sec 33624707 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 10887121 29756 7.53 162091 349916 45.9 45.9 40.0% 0.1% 0.0% 0.0% 7.98sec 10887121 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 10115583 27638 26.67 41631 92071 81.8 162.7 40.7% 0.0% 0.0% 0.0% 4.33sec 10115583 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 4958132 13551 11.65 41502 111376 71.1 71.1 40.5% 0.1% 0.0% 0.0% 4.87sec 4958132 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 11702211 31984 9.43 138917 300320 57.5 57.5 40.1% 0.1% 0.0% 0.0% 6.14sec 11702211 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 4405199 12040 31.71 22784 0 193.4 193.4 0.0% 0.0% 0.0% 0.0% 1.90sec 4405199 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 3371357 9215 2.13 180572 381744 13.0 13.0 39.5% 0.1% 0.0% 0.0% 4.64sec 3371357 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 9913091 27085 44.53 24996 53679 30.2 271.6 40.1% 0.0% 0.0% 0.0% 12.19sec 9913091 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 4913420 13429 19.45 25245 65741 118.7 118.6 40.1% 0.1% 0.0% 0.0% 3.04sec 4913420 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 6839177 18693 25.43 30109 64925 156.4 155.1 40.2% 0.0% 0.0% 0.0% 2.31sec 6839177 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.94sec 0 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 912772 2495 0.81 111837 279966 4.9 4.9 43.7% 0.1% 0.0% 0.0% 64.61sec 912772 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 10950820 29920 37.69 32469 70183 35.1 229.9 40.2% 0.0% 0.0% 0.0% 10.34sec 10950820 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 5414392 14798 16.46 32745 85638 100.4 100.4 40.1% 0.1% 0.0% 0.0% 3.56sec 5414392 365.87sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 3124097 112166 60.50 77074 181250 28.1 28.1 42.1% 7.4% 23.9% 6.7% 13.76sec 3124097 27.85sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.75 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 89.81sec 0 27.85sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 12800 460 2.78 5886 14492 1.3 1.3 47.0% 0.1% 0.0% 0.0% 1.70sec 12800 27.85sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 3863855 10561 2.24 193822 415258 13.7 13.7 40.2% 0.1% 0.0% 0.0% 26.39sec 3863855 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 3063685 8374 9.49 32336 83641 58.0 57.9 40.2% 0.1% 0.0% 0.0% 5.92sec 3063685 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 6329314 17293 21.74 32651 70023 13.7 132.6 40.3% 0.0% 0.0% 0.0% 26.39sec 6329314 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 7321823 20005 24.27 25653 55670 0.0 148.0 40.3% 0.1% 0.0% 0.0% 0.00sec 7321823 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 1.47 0 0 9.0 9.0 40.7% 0.1% 0.0% 0.0% 42.92sec 0 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 3072673 8398 1.91 181272 386462 9.0 11.7 40.2% 0.1% 0.0% 0.0% 42.92sec 3072673 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 3882246 10611 15.54 39954 42238 9.0 94.8 44.0% 0.0% 0.0% 0.0% 42.92sec 33464426 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 8632332 23594 6.03 160182 346784 36.8 36.8 40.1% 0.1% 0.0% 0.0% 10.01sec 8632332 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 11434461 31242 29.56 42354 94021 88.0 180.3 40.8% 0.0% 0.0% 0.0% 4.06sec 11434461 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 5614499 15345 12.91 42239 113900 78.8 78.7 40.7% 0.1% 0.0% 0.0% 4.44sec 5614499 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 12568001 34351 10.07 139470 302330 61.4 61.4 40.2% 0.1% 0.0% 0.0% 5.79sec 12568001 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 4382098 11977 31.91 22520 0 194.6 194.6 0.0% 0.0% 0.0% 0.0% 1.89sec 4382098 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.65 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 120.81sec 0 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 3382089 9244 2.15 179069 379184 13.1 13.1 39.6% 0.1% 0.0% 0.0% 4.60sec 3382089 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 10410106 28443 46.03 25345 54554 30.8 280.8 40.2% 0.0% 0.0% 0.0% 11.83sec 10410106 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 5145396 14063 20.11 25505 66608 122.7 122.6 40.1% 0.1% 0.0% 0.0% 2.94sec 5145396 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 7174952 19610 26.34 30433 65774 161.9 160.6 40.3% 0.0% 0.0% 0.0% 2.23sec 7174952 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.95sec 0 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 1031155 2818 0.86 117424 295995 5.3 5.3 44.1% 0.1% 0.0% 0.0% 60.17sec 1031155 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 11688160 31935 39.47 33000 71622 35.5 240.8 40.3% 0.0% 0.0% 0.0% 10.21sec 11688160 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 5753423 15725 17.23 33141 87063 105.2 105.1 40.2% 0.1% 0.0% 0.0% 3.41sec 5753423 365.87sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 3128909 112403 60.63 77088 181331 28.1 28.1 42.1% 7.4% 24.1% 6.7% 13.72sec 3128909 27.84sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.76 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 89.80sec 0 27.84sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 12815 460 2.78 5894 14513 1.3 1.3 47.2% 0.1% 0.0% 0.0% 1.76sec 12815 27.84sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 4066692 11115 2.25 203916 436581 13.7 13.7 40.0% 0.1% 0.0% 0.0% 26.25sec 4066692 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 3129761 8554 9.27 33921 87557 56.6 56.5 40.1% 0.1% 0.0% 0.0% 6.05sec 3129761 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 6431157 17571 21.23 34051 72828 13.7 129.5 40.2% 0.0% 0.0% 0.0% 26.25sec 6431157 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 7367429 20130 23.47 26562 57401 0.0 143.2 40.3% 0.1% 0.0% 0.0% 0.00sec 7367429 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 1.47 0 0 9.0 9.0 40.3% 0.1% 0.0% 0.0% 43.13sec 0 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 3122303 8534 1.88 187170 398380 9.0 11.5 40.1% 0.1% 0.0% 0.0% 43.13sec 3122303 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 3721957 10173 15.54 38738 39975 9.0 94.8 43.8% 0.0% 0.0% 0.0% 43.13sec 34757630 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 8998353 24594 6.07 166164 358486 37.0 37.0 40.1% 0.1% 0.0% 0.0% 9.96sec 8998353 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 11268206 30787 28.85 42942 94776 88.4 176.0 40.7% 0.0% 0.0% 0.0% 4.03sec 11268206 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 5529840 15114 12.60 42867 114722 76.9 76.9 40.5% 0.1% 0.0% 0.0% 4.54sec 5529840 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 12420056 33946 9.62 144605 312380 58.7 58.7 40.1% 0.1% 0.0% 0.0% 6.02sec 12420056 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 4424325 12092 31.02 23389 0 189.2 189.2 0.0% 0.0% 0.0% 0.0% 1.94sec 4424325 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 3855507 10538 2.14 205259 434144 13.1 13.1 39.5% 0.1% 0.0% 0.0% 4.60sec 3855507 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 10354114 28290 44.61 26068 55962 30.6 272.1 40.1% 0.0% 0.0% 0.0% 12.06sec 10354114 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 5151595 14080 19.49 26438 68807 118.9 118.8 40.0% 0.1% 0.0% 0.0% 3.04sec 5151595 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 7165610 19585 25.46 31510 67914 156.6 155.2 40.2% 0.0% 0.0% 0.0% 2.31sec 7165610 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.93sec 0 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 962236 2630 0.82 117187 289632 5.0 5.0 44.2% 0.1% 0.0% 0.0% 64.79sec 962236 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 11463951 31322 37.86 33866 73116 35.6 231.0 40.2% 0.0% 0.0% 0.0% 10.22sec 11463951 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 5690608 15553 16.54 34283 89642 100.9 100.9 40.1% 0.1% 0.0% 0.0% 3.55sec 5690608 365.87sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 3114837 111830 60.53 77058 180821 28.1 28.1 42.0% 7.4% 24.0% 6.7% 13.74sec 3114837 27.85sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.75 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 89.82sec 0 27.85sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 12790 459 2.79 5867 14408 1.3 1.3 47.2% 0.2% 0.0% 0.0% 1.76sec 12790 27.85sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 4600421 12574 2.69 191645 412407 16.4 16.4 40.1% 0.1% 0.0% 0.0% 21.81sec 4600421 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 3610963 9869 11.26 32065 83275 68.8 68.7 40.1% 0.1% 0.0% 0.0% 5.00sec 3610963 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 7393372 20200 25.79 32156 69080 16.4 157.3 40.2% 0.0% 0.0% 0.0% 21.81sec 7393372 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 6934758 18947 23.07 25360 54786 0.0 140.7 40.3% 0.1% 0.0% 0.0% 0.00sec 6934758 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.47 0 0 9.0 9.0 40.5% 0.1% 0.0% 0.0% 42.97sec 0 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 3030330 8282 1.92 178635 380056 9.0 11.7 40.2% 0.1% 0.0% 0.0% 42.97sec 3030330 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 3868871 10574 15.59 39806 41842 9.0 95.0 43.9% 0.0% 0.0% 0.0% 42.97sec 33465816 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 11937898 32628 7.47 179453 386560 45.6 45.6 40.0% 0.1% 0.0% 0.0% 8.04sec 11937898 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 14642719 40007 39.04 41367 90999 120.2 238.2 40.5% 0.0% 0.0% 0.0% 2.99sec 14642719 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 7177673 19618 17.04 41298 110113 104.0 103.9 40.4% 0.1% 0.0% 0.0% 3.43sec 7177673 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.13 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.75sec 0 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 4061569 11101 32.04 20785 0 195.4 195.4 0.0% 0.0% 0.0% 0.0% 1.87sec 4061569 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 3482851 9519 2.08 190670 403250 12.7 12.7 39.6% 0.1% 0.0% 0.0% 4.67sec 3482851 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 9899954 27049 44.47 24994 53668 30.0 271.2 40.1% 0.0% 0.0% 0.0% 12.26sec 9899954 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 4906730 13411 19.42 25252 65748 118.5 118.4 40.0% 0.1% 0.0% 0.0% 3.04sec 4906730 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 6831397 18671 25.39 30116 64940 156.2 154.9 40.2% 0.0% 0.0% 0.0% 2.31sec 6831397 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 959873 2624 0.84 112477 281737 5.1 5.1 44.1% 0.1% 0.0% 0.0% 60.77sec 959873 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 10982511 30007 37.64 32586 70456 34.9 229.6 40.3% 0.0% 0.0% 0.0% 10.37sec 10982511 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 5402756 14767 16.44 32739 85644 100.3 100.2 40.1% 0.1% 0.0% 0.0% 3.56sec 5402756 365.87sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 7761909 84915 57.32 64931 144137 87.3 87.3 40.9% 7.5% 24.0% 6.9% 4.06sec 7761909 91.41sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.40 0 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 20.00sec 0 91.41sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 29230 320 2.38 5042 11984 3.6 3.6 43.7% 0.1% 0.0% 0.0% 84.40sec 29230 91.41sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 3846630 10514 2.23 193530 415243 13.6 13.6 40.2% 0.1% 0.0% 0.0% 26.42sec 3846630 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3065993 8380 9.51 32303 83545 58.1 58.0 40.2% 0.1% 0.0% 0.0% 5.92sec 3065993 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 6333168 17304 21.78 32629 69939 13.6 132.9 40.3% 0.0% 0.0% 0.0% 26.42sec 6333168 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 7082141 19350 23.43 25648 55593 0.0 142.9 40.4% 0.1% 0.0% 0.0% 0.00sec 7082141 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.48 0 0 9.0 9.0 40.5% 0.1% 0.0% 0.0% 42.60sec 0 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 3100124 8473 1.94 180661 384799 9.0 11.8 40.1% 0.1% 0.0% 0.0% 42.60sec 3100124 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 4409492 12052 15.41 45674 48515 9.0 94.0 43.9% 0.0% 0.0% 0.0% 42.60sec 33075889 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 9710342 26540 6.04 180411 389394 36.8 36.8 40.0% 0.1% 0.0% 0.0% 9.99sec 9710342 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 16449549 44944 42.99 42051 92963 128.9 262.2 40.6% 0.0% 0.0% 0.0% 2.80sec 16449549 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 8083443 22093 18.78 42010 112621 114.6 114.5 40.5% 0.1% 0.0% 0.0% 3.13sec 8083443 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.13 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.75sec 0 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 4020263 10988 32.32 20401 0 197.1 197.1 0.0% 0.0% 0.0% 0.0% 1.86sec 4020263 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.60 0 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 121.40sec 0 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 3480331 9512 2.09 189383 400792 12.8 12.8 39.4% 0.1% 0.0% 0.0% 4.64sec 3480331 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 10409695 28442 46.00 25357 54567 30.7 280.6 40.2% 0.0% 0.0% 0.0% 11.86sec 10409695 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 5135030 14035 20.08 25506 66554 122.6 122.5 40.1% 0.1% 0.0% 0.0% 2.95sec 5135030 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 7174478 19609 26.33 30434 65774 161.9 160.6 40.3% 0.0% 0.0% 0.0% 2.23sec 7174478 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 1142437 3122 0.94 118358 298522 5.8 5.8 44.5% 0.1% 0.0% 0.0% 54.27sec 1142437 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 11724975 32035 39.46 33094 71801 35.4 240.7 40.3% 0.0% 0.0% 0.0% 10.22sec 11724975 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 5745576 15704 17.22 33114 86967 105.1 105.0 40.2% 0.1% 0.0% 0.0% 3.41sec 5745576 365.87sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 7718841 84572 57.15 64859 144079 86.9 86.9 40.9% 7.6% 24.0% 6.9% 4.05sec 7718841 91.27sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.41 0 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 19.98sec 0 91.27sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 29173 320 2.38 5046 12011 3.6 3.6 43.4% 0.1% 0.0% 0.0% 85.30sec 29173 91.27sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 4063373 11106 2.24 203861 436311 13.7 13.7 40.2% 0.1% 0.0% 0.0% 26.18sec 4063373 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3142065 8588 9.32 33895 87394 56.9 56.8 40.1% 0.1% 0.0% 0.0% 5.97sec 3142065 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 6464047 17661 21.35 34070 72748 13.7 130.2 40.2% 0.0% 0.0% 0.0% 26.18sec 6464047 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 7178252 19613 22.90 26569 57373 0.0 139.7 40.3% 0.1% 0.0% 0.0% 0.00sec 7178252 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 1.47 0 0 9.0 9.0 40.3% 0.1% 0.0% 0.0% 42.93sec 0 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 3132356 8561 1.90 186549 396867 9.0 11.6 40.0% 0.1% 0.0% 0.0% 42.93sec 3132356 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 3718465 10163 15.42 39127 40103 9.0 94.0 43.8% 0.0% 0.0% 0.0% 42.93sec 34438692 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 10200423 27880 6.09 188070 404969 37.1 37.1 40.0% 0.1% 0.0% 0.0% 9.89sec 10200423 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 15997560 43709 41.24 42841 94059 127.1 251.6 40.5% 0.0% 0.0% 0.0% 2.83sec 15997560 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 7857886 21477 18.01 42822 113991 109.9 109.8 40.4% 0.1% 0.0% 0.0% 3.24sec 7857886 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.14 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.73sec 0 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 4060360 11098 31.36 21231 0 191.2 191.2 0.0% 0.0% 0.0% 0.0% 1.91sec 4060360 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 4010632 10962 2.10 217058 459196 12.8 12.8 39.7% 0.1% 0.0% 0.0% 4.63sec 4010632 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 10342259 28258 44.59 26059 55925 30.4 272.0 40.1% 0.0% 0.0% 0.0% 12.08sec 10342259 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 5148248 14071 19.47 26446 68813 118.8 118.7 40.0% 0.1% 0.0% 0.0% 3.04sec 5148248 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 7163368 19579 25.44 31526 67956 156.5 155.1 40.2% 0.0% 0.0% 0.0% 2.31sec 7163368 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 1022900 2796 0.87 117493 290150 5.3 5.3 44.1% 0.1% 0.0% 0.0% 59.65sec 1022900 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 11512175 31454 37.87 33976 73391 35.5 231.0 40.2% 0.0% 0.0% 0.0% 10.23sec 11512175 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 5695356 15566 16.54 34281 89626 100.9 100.9 40.2% 0.1% 0.0% 0.0% 3.55sec 5695356 365.87sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 7737015 84396 57.40 64521 143188 87.7 87.7 40.8% 7.5% 24.0% 6.9% 4.08sec 7737015 91.68sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.39 0 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 20.06sec 0 91.68sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 29268 319 2.38 5046 12024 3.6 3.6 43.3% 0.1% 0.0% 0.0% 86.13sec 29268 91.68sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 4535863 12397 2.66 191798 412456 16.2 16.2 40.0% 0.1% 0.0% 0.0% 22.15sec 4535863 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 3550153 9703 11.08 32051 83185 67.7 67.6 40.1% 0.1% 0.0% 0.0% 5.08sec 3550153 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 7259735 19835 25.38 32084 68916 16.2 154.8 40.2% 0.0% 0.0% 0.0% 22.15sec 7259735 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 6916738 18898 23.01 25357 54798 0.0 140.4 40.3% 0.1% 0.0% 0.0% 0.00sec 6916738 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 1.35 0 0 8.2 8.2 40.2% 0.1% 0.0% 0.0% 46.54sec 0 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 2754156 7528 1.74 178191 381093 8.2 10.6 40.1% 0.1% 0.0% 0.0% 46.54sec 2754156 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 4146304 11333 14.83 44934 47040 8.2 90.4 43.6% 0.0% 0.0% 0.0% 46.54sec 31517203 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 11739064 32085 7.36 179367 386144 44.9 44.9 39.9% 0.1% 0.0% 0.0% 8.18sec 11739064 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 9359924 25574 24.55 41671 92799 75.1 149.8 40.7% 0.0% 0.0% 0.0% 4.66sec 9359924 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 4605088 12587 10.72 41642 112583 65.4 65.4 40.6% 0.1% 0.0% 0.0% 5.22sec 4605088 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 12447969 34011 17.10 81696 175391 51.5 104.3 40.2% 0.0% 0.0% 0.0% 6.69sec 12447969 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 5467952 14945 7.47 73239 190353 45.6 45.5 40.1% 0.1% 0.0% 0.0% 7.53sec 5467952 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 4355610 11905 31.59 22613 0 192.6 192.6 0.0% 0.0% 0.0% 0.0% 1.90sec 4355610 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 3465529 9472 2.07 190117 401529 12.6 12.6 39.8% 0.1% 0.0% 0.0% 4.75sec 3465529 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 9366000 25590 42.24 24923 53466 27.5 257.7 40.0% 0.0% 0.0% 0.0% 13.34sec 9366000 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 4659911 12736 18.44 25262 65788 112.6 112.5 40.0% 0.1% 0.0% 0.0% 3.20sec 4659911 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 6481221 17714 24.07 30122 64973 148.1 146.8 40.2% 0.0% 0.0% 0.0% 2.44sec 6481221 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 962472 2631 0.84 112702 282357 5.1 5.1 44.3% 0.1% 0.0% 0.0% 60.44sec 962472 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_embrace 15286 0 0 0.02 0 0 0.1 0.1 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 10293973 28126 35.29 32567 70446 31.7 215.3 40.3% 0.0% 0.0% 0.0% 11.43sec 10293973 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 5074034 13868 15.41 32765 85785 94.0 94.0 40.1% 0.1% 0.0% 0.0% 3.78sec 5074034 365.87sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 3116636 112233 60.63 77038 181002 28.1 28.1 42.1% 7.4% 24.0% 6.6% 13.76sec 3116636 27.77sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.78 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 89.82sec 0 27.77sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 12837 462 2.80 5861 14406 1.3 1.3 47.3% 0.1% 0.0% 0.0% 1.75sec 12837 27.77sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 3782767 10339 2.20 193728 414641 13.4 13.4 40.2% 0.1% 0.0% 0.0% 26.85sec 3782767 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 2993627 8182 9.31 32239 83345 56.9 56.8 40.1% 0.1% 0.0% 0.0% 6.01sec 2993627 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 6186129 16902 21.34 32538 69714 13.4 130.2 40.3% 0.0% 0.0% 0.0% 26.85sec 6186129 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 7079013 19342 23.39 25653 55634 0.0 142.6 40.3% 0.1% 0.0% 0.0% 0.00sec 7079013 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 1.38 0 0 8.4 8.4 40.2% 0.1% 0.0% 0.0% 45.45sec 0 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 2896934 7918 1.82 179152 384042 8.4 11.1 40.0% 0.1% 0.0% 0.0% 45.45sec 2896934 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 4340900 11864 15.35 45049 48111 8.4 93.6 43.6% 0.0% 0.0% 0.0% 45.45sec 32476340 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 9514213 26004 5.93 179966 388079 36.2 36.2 40.0% 0.1% 0.0% 0.0% 10.16sec 9514213 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 11922958 32576 30.70 42378 94676 89.9 187.3 40.7% 0.0% 0.0% 0.0% 3.94sec 11922958 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 5884181 16083 13.42 42421 115097 81.8 81.8 40.7% 0.1% 0.0% 0.0% 4.24sec 5884181 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 10876962 29718 14.86 82239 176101 44.7 90.6 40.3% 0.0% 0.0% 0.0% 7.67sec 10876962 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 4798012 13114 6.49 74138 191738 39.6 39.6 40.1% 0.1% 0.0% 0.0% 8.57sec 4798012 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 4281399 11702 32.00 21941 0 195.1 195.1 0.0% 0.0% 0.0% 0.0% 1.87sec 4281399 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.65 0 0 4.0 4.0 0.0% 0.0% 0.0% 0.0% 120.91sec 0 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 3488066 9533 2.10 189468 400294 12.8 12.8 39.6% 0.1% 0.0% 0.0% 4.70sec 3488066 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 9982383 27274 44.17 25316 54518 28.5 269.4 40.2% 0.0% 0.0% 0.0% 12.88sec 9982383 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 4937573 13495 19.27 25536 66723 117.6 117.5 40.1% 0.1% 0.0% 0.0% 3.06sec 4937573 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 6890768 18834 25.26 30462 65876 155.4 154.0 40.3% 0.0% 0.0% 0.0% 2.32sec 6890768 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.97sec 0 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 1135267 3103 0.94 118608 299723 5.7 5.7 44.5% 0.1% 0.0% 0.0% 54.26sec 1135267 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 11196304 30591 37.66 33094 71849 33.1 229.7 40.4% 0.0% 0.0% 0.0% 10.97sec 11196304 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 5489203 15003 16.44 33140 87105 100.3 100.2 40.1% 0.1% 0.0% 0.0% 3.57sec 5489203 365.87sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 3114528 112085 60.66 77011 180805 28.1 28.1 42.0% 7.4% 24.0% 6.6% 13.75sec 3114528 27.79sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.78 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 89.81sec 0 27.79sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 12685 456 2.80 5827 14325 1.3 1.3 46.8% 0.1% 0.0% 0.0% 1.79sec 12685 27.79sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 4039057 11039 2.23 203988 436465 13.6 13.6 40.2% 0.1% 0.0% 0.0% 26.38sec 4039057 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3105807 8489 9.23 33844 87278 56.3 56.3 40.0% 0.1% 0.0% 0.0% 6.05sec 3105807 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 6410038 17514 21.16 34064 72774 13.6 129.1 40.3% 0.0% 0.0% 0.0% 26.38sec 6410038 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 7208911 19696 22.94 26574 57414 0.0 139.9 40.3% 0.1% 0.0% 0.0% 0.00sec 7208911 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 1.39 0 0 8.4 8.4 40.3% 0.1% 0.0% 0.0% 45.39sec 0 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 2963357 8099 1.78 186621 400678 8.4 10.9 40.2% 0.1% 0.0% 0.0% 45.39sec 2963357 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 4631681 12659 15.65 47733 49583 8.4 95.4 43.6% 0.0% 0.0% 0.0% 45.39sec 34374851 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 10072708 27530 6.04 187531 403744 36.8 36.8 40.0% 0.1% 0.0% 0.0% 9.98sec 10072708 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 11188711 30570 28.61 42856 95151 87.0 174.5 40.7% 0.0% 0.0% 0.0% 4.07sec 11188711 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 5513243 15069 12.50 42898 115675 76.3 76.2 40.5% 0.1% 0.0% 0.0% 4.55sec 5513243 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 11180891 30549 14.68 85785 183156 45.3 89.5 40.1% 0.0% 0.0% 0.0% 7.55sec 11180891 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 4937768 13496 6.41 77373 199786 39.1 39.1 40.1% 0.1% 0.0% 0.0% 8.67sec 4937768 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 4358846 11913 31.21 22905 0 190.3 190.3 0.0% 0.0% 0.0% 0.0% 1.92sec 4358846 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 4000548 10934 2.10 217431 458832 12.8 12.8 39.6% 0.1% 0.0% 0.0% 4.72sec 4000548 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 9953246 27195 43.00 26013 55835 28.4 262.3 40.0% 0.0% 0.0% 0.0% 12.84sec 9953246 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 4969592 13583 18.78 26454 68869 114.6 114.5 40.0% 0.1% 0.0% 0.0% 3.15sec 4969592 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 6905337 18874 24.51 31519 67970 150.8 149.5 40.3% 0.0% 0.0% 0.0% 2.39sec 6905337 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.49 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.16 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 1002744 2741 0.84 117625 291622 5.1 5.1 44.4% 0.1% 0.0% 0.0% 60.14sec 1002744 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_embrace 15286 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 0.00sec 0 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 11148190 30460 36.67 33969 73416 33.6 223.7 40.2% 0.0% 0.0% 0.0% 10.83sec 11148190 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 5514750 15073 16.02 34259 89610 97.8 97.7 40.2% 0.1% 0.0% 0.0% 3.64sec 5514750 365.87sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 3110220 112311 60.70 76921 180972 28.0 28.0 42.1% 7.4% 24.0% 6.7% 13.76sec 3110220 27.69sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.81 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 89.81sec 0 27.69sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 12605 455 2.79 5827 14322 1.3 1.3 46.9% 0.1% 0.0% 0.0% 1.76sec 12605 27.69sec

Fluffy_Pillow : 177805 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
177804.6 177804.6 8.56 / 0.00% 429 / 0.2% -1.0 0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18&chs=550x275&chd=t:100&chds=0,100&chdls=ffffff&chco=9482C9&chl=raid_damage_shadow& DPS Taken Timeline Chart
http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:EEJJJJJJLLLLLLOOJJJJLLGGGGJJGGGGJJGGGGJJGGGGJJGGGGJJHHHKKKHHLLLLILLLLLLLLLLLLLLLKKKKKJJJJJJJJJJJJJJJJJJJJJJJJJJJJJMKKKNNLLOOOLPPPPPPPPOOOONNNNMMMMLLLLLLLLLLLLLLLLLLLLLLLLLLLQOOTTQVVVYYYbZZbbZbbWZZUWWRUUPRROQQOQQOQQOQQOQQOQQOQQOQQOQQQQTRUUVVYWZZaadbeeeeddddccbbaaZZZZYYXXXXXXXXXXXXXXXXXXXXXXXaacdghklopstwx014577877765443210zzyxwvvvvvvvvvvvvvvvvvvvvvvvvvxz1zwuspnkigd&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.3700,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=177805|max=480608&chxp=1,1,37,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,0,0,0,1,0,0,0,1,1,3,1,2,5,9,2,12,13,17,19,16,14,13,25,29,27,33,34,18,3,8,45,80,78,16,3,23,112,160,99,29,252,3043,8625,8274,3188,586,67,5&chds=0,8625&chbh=5&chxt=x&chxl=0:|min=167121|avg=177805|max=179087&chxp=0,1,89,100&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 177805
raid_damage_shadow 177805 100.0% 1534.2 2.38sec 42404 0 42404 0 42404 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raid_damage_shadow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1534.16 1534.16 0.00 0.00 0.0000 0.0000 65054627.21 65054627.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1534.16 100.00% 42404.17 41360 44855 42404.15 42367 42418 65054627 65054627 0.00
DPS Timeline Chart

Action details: raid_damage_shadow

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T16H_MFI_DI
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:44000.00
  • base_dd_max:44000.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 6.94% 6.94%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:6.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.43% 9.43%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.88% 10.88%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.78% 10.78%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.51% 11.51%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.27% 11.27%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.23% 11.23%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 12.89% 12.89%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:12.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.89% 8.89%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.19% 6.19%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.19%

Trigger Attempt Success

  • trigger_pct:100.00%
flying 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_flying
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • flying_1:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2652692.47
Combat End Resource Mean Min Max
Health 13813731.28 0.00 68314576.64
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 1643
death count pct 6.57
avg death time 364.06
min death time 351.52
max death time 366.00
dmg taken 970868915.08

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 365.87
Minimum 351.52
Maximum 366.00
Spread ( max - min ) 14.48
Range [ ( max - min ) / 2 * 100% ] 1.98%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 177804.56
Minimum 167120.73
Maximum 179086.61
Spread ( max - min ) 11965.88
Range [ ( max - min ) / 2 * 100% ] 3.36%
Standard Deviation 690.7504
5th Percentile 177474.51
95th Percentile 178332.40
( 95th Percentile - 5th Percentile ) 857.88
Mean Distribution
Standard Deviation 4.3694
95.00% Confidence Intervall ( 177796.00 - 177813.12 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 57
0.1 Scale Factor Error with Delta=300 4073
0.05 Scale Factor Error with Delta=300 16292
0.01 Scale Factor Error with Delta=300 407310
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 177804.56
Minimum 167120.73
Maximum 179086.61
Spread ( max - min ) 11965.88
Range [ ( max - min ) / 2 * 100% ] 3.36%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 65054627.21
Minimum 58745945.70
Maximum 65493931.90
Spread ( max - min ) 6747986.20
Range [ ( max - min ) / 2 * 100% ] 5.19%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 2653582.31
Minimum 2506515.27
Maximum 2823600.11
Spread ( max - min ) 317084.83
Range [ ( max - min ) / 2 * 100% ] 5.97%
Standard Deviation 35996.7492
5th Percentile 2594917.00
95th Percentile 2712418.36
( 95th Percentile - 5th Percentile ) 117501.36
Mean Distribution
Standard Deviation 227.6999
95.00% Confidence Intervall ( 2653136.03 - 2654028.59 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 706
0.1 Scale Factor Error with Delta=300 11061403
0.05 Scale Factor Error with Delta=300 44245613
0.01 Scale Factor Error with Delta=300 1106140343
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 986602327 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
533816.0 0.0 Health 100.00% 0.0 32.8% 100%

Charts

DPS Taken Timeline Chart
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|&chxp=1,1,-nan,100 http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 120.0s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 533815.96
Combat End Resource Mean Min Max
Health 975541207.56 960081030.39 978649371.48

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 120.00
Minimum 120.00
Maximum 120.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 533986.83
Minimum 469173.24
Maximum 615603.54
Spread ( max - min ) 146430.30
Range [ ( max - min ) / 2 * 100% ] 13.71%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 366.00
Vary Combat Length: 0.00

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.