close

SimulationCraft 540-5

for World of Warcraft 5.4.0 Live (build level 17345)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 movement,players_only=1,first=10,cooldown=10,duration=4
1 adds,count=3,first=45,cooldown=45,duration=10

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T16H_FDCL_DI - - - 7.64 - 5.76 - - - - - 5.07 5.24 4.47 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_PI - - - 7.84 - 5.80 - - - - - 5.27 5.58 4.59 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_FDCL_ToF - - - 7.88 - 5.83 - - - - - 5.22 5.93 4.44 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_DI - - - 7.63 - 5.59 - - - - - 5.12 5.73 4.64 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_PI - - - 7.80 - 5.79 - - - - - 5.31 6.77 4.33 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MB_ToF - - - 7.98 - 5.97 - - - - - 5.38 5.26 4.47 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_DI - - - 7.79 - 5.77 - - - - - 5.16 5.13 4.89 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_PI - - - 7.77 - 5.74 - - - - - 5.33 4.77 4.57 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T16H_MFI_ToF - - - 7.74 - 5.65 - - - - - 5.28 4.18 4.66 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T16H_FDCL_DI : 300203 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
300202.5 300202.5 134.37 / 0.04% 17841 / 5.9% 45.4 6401.7 5039.5 Mana 0.52% 54.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.64 5.76 0.00 5.07 5.24 4.47
Normalized 1.00 0.75 0.00 0.66 0.69 0.59
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.19 0.19 0.00 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > SP > Haste ~= Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.64, SpellDamage=5.76, CritRating=5.07, HasteRating=5.24, MasteryRating=4.47 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_DI": Intellect=7.64, SpellDamage=5.76, CritRating=5.07, HasteRating=5.24, MasteryRating=4.47 )

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:879802|460879|335560|281420|259170|220485|192219|107712|77713&chds=0,1759604&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++879802++devouring_plague,9482C9,0,0,15|t++460879++halo,9482C9,1,0,15|t++335560++vampiric_touch,9482C9,2,0,15|t++281420++shadow_word_pain,9482C9,3,0,15|t++259170++shadow_word_death,9482C9,4,0,15|t++220485++mind_blast,9482C9,5,0,15|t++192219++mind_spike,4A79D3,6,0,15|t++107712++mind_flay,9482C9,7,0,15|t++77713++mind_sear,9482C9,8,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,10,9,8,8,8,7,6,5,4,4,4,4,3,3,3,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|mind_blast|shadowy_apparition|mind_spike|essence_of_yulon|vampiric_touch|devouring_plague_tick|shadow_word_pain_mastery|mind_flay|devouring_plague|halo_damage|multistrike_spell|vampiric_touch_mastery|devouring_plague_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.64,5.76,5.24,5.07,4.47|7.45,5.57,5.05,4.88,4.28|7.83,5.95,5.43,5.26,4.66&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.64++Int,FFFFFF,0,0,15,0.1,e|t++++5.76++SP,FFFFFF,0,1,15,0.1,e|t++++5.24++Haste,FFFFFF,0,2,15,0.1,e|t++++5.07++Crit,FFFFFF,0,3,15,0.1,e|t++++4.47++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.178& http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fikmptvy13576867542zyxxwvsrqqponmmlkjjiikmpqrsssssrrrrqqpponlifdcccbbbbbbbbbaabbbbbddeefghijjkkkkkkkkkkiihhgfddcbbbbbccccddddeeffgjmprttuuuvvvvvvvvuutroliggfeeedddddcccccbccdeefgikmnopqqqqqqqqqponmljhfedcbbbbbbbbbbbbbbbbdfhjkkklllllllllmmmmljhfeeeeeeffffffgggggggijjkklnoppqqqqppppppnmllkigfeedcccccdddcdcdddddfhjlmmmmmmmmmmnnnnnmljhfeeeeddddddddddddddefghikmoqsuvwxxxyyzzzyyxwvtrqomlllkkkkkkkkkkkkkklmoqsssssssssssssssrqpnkjjiiiiiiiihhhhhhhhhijkklmnnoopppppppqqqppoonmmllkjjjjkkkkkkklllmnnopruwwxxyyyzzzzzzzzzyxvsrrqpppooooonnmmmllllmnnopqrrtsssqomkjhgdbY&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6202,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=300203|max=484068&chxp=1,1,62,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,1,4,4,23,39,59,117,186,290,435,548,711,926,1104,1284,1491,1594,1755,1715,1787,1674,1567,1426,1269,1043,870,721,602,481,352,251,197,136,119,65,54,29,21,17,7,2,4,3,2,2,0,0,0,1&chds=0,1787&chbh=5&chxt=x&chxl=0:|min=261752|avg=300203|max=356479&chxp=0,1,41,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:28.4,20.4,13.5,12.8,9.9,4.9,3.8,2.5,0.7,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 128.2s|mind_flay 92.0s|mind_blast 61.0s|mind_spike 57.8s|vampiric_touch 44.8s|devouring_plague 21.9s|shadow_word_death 16.9s|halo 11.3s|shadowfiend 3.3s|mind_sear 0.1s|waiting 2.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_DI 300203
devouring_plague 12705 (42772) 4.2% (14.3%) 20.3 21.83sec 948349 879802 192052 416153 281725 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 0.00 0.00 1.0779 0.0000 5725122.04 5725122.04 0.00 879801.98 879801.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.16 59.81% 192051.63 169721 307820 192035.34 169721 232144 2334405 2334405 0.00
crit 8.15 40.09% 416153.36 353627 769642 416287.34 0 580623 3390717 3390717 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9890 3.3% 84.2 5.08sec 52941 0 32177 84085 53011 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.16 84.05 0.00 0.00 0.0000 0.0000 4455638.28 4455638.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.18 59.71% 32177.17 28287 51304 32183.79 28992 37165 1614773 1614773 0.00
crit 33.79 40.20% 84085.12 71200 159064 84080.72 72819 102899 2840866 2840866 0.00
miss 0.08 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20176 6.7% 20.3 21.83sec 447369 0 0 0 0 0.0% 0.0% 0.0% 0.0% 192.6 32214 69539 47215 40.2% 0.0% 27.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 192.55 192.55 0.0000 0.6495 9091302.07 9091302.07 0.00 72698.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.2 59.81% 32214.01 28287 139727 32221.17 28943 77240 3709836 3709836 0.00
crit 77.4 40.19% 69538.81 58939 291132 69513.51 60791 166134 5381466 5381466 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 23961 8.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 174.6 25413 55362 37481 40.3% 0.1% 30.7%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.05 174.56 287.91 0.0000 0.7935 10790854.71 10790854.71 0.00 77909.50 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.6 59.59% 25412.71 21101 40897 25423.80 22983 29348 4360022 4360022 0.00
crit 116.2 40.35% 55362.38 43965 102254 55360.33 48882 66963 6430833 6430833 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (11615) 0.0% (3.9%) 10.5 44.39sec 496076 460879 0 0 0 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 10.54 0.00 0.00 1.0764 0.0000 0.00 0.00 0.00 460878.61 460878.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.26 59.33% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.28 40.56% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 11615 3.9% 10.5 44.39sec 496076 0 176894 382888 259817 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 20.13 0.00 0.00 0.0000 0.0000 5230972.21 5230972.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.01 59.66% 176894.43 153853 275756 177575.90 0 239627 2124701 2124701 0.00
crit 8.11 40.30% 382887.75 320566 689472 383385.46 0 574560 3106271 3106271 0.00
miss 0.01 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 29851 9.9% 55.6 8.12sec 241653 220485 165073 357124 241654 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.63 55.63 0.00 0.00 1.0960 0.0000 13443639.72 13443639.72 0.00 220485.13 220485.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.34 59.93% 165072.95 135799 396163 165031.15 141538 196377 5503632 5503632 0.00
crit 22.23 39.97% 357124.38 282948 990526 357081.24 294792 468958 7940008 7940008 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14784 (22045) 4.9% (7.3%) 65.4 6.68sec 151548 107712 0 0 0 0.0% 0.1% 0.0% 0.0% 108.8 41287 90244 61086 40.4% 0.0% 15.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.40 65.40 108.81 108.81 1.4070 0.6312 6647093.14 6647093.14 0.00 107712.42 107712.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.33 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.8 59.56% 41286.70 35993 65277 41304.11 37550 46716 2675695 2675695 0.00
crit 44.0 40.44% 90244.17 74995 163211 90296.77 79069 111027 3971398 3971398 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7261 2.4% 47.5 8.89sec 68693 0 41231 109315 68720 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.51 47.49 0.00 0.00 0.0000 0.0000 3263742.13 3263742.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.24 59.47% 41230.65 35993 65277 41250.85 36495 50868 1164528 1164528 0.00
crit 19.20 40.43% 109315.16 90596 202384 109379.25 90596 146676 2099214 2099214 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 21 0.0% 0.1 124.80sec 86146 77713 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 23519 51479 34499 39.3% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.11 0.11 0.07 0.27 1.1152 0.6308 9403.22 9403.22 0.00 77712.55 77712.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.11 99.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 60.73% 23519.29 21183 36670 1101.66 0 36670 3893 3893 0.00
crit 0.1 39.27% 51478.85 44137 91686 2194.08 0 91686 5510 5510 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 10 0.0% 0.1 9.70sec 39007 0 23651 62173 39007 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.12 0.12 0.00 0.00 0.0000 0.0000 4618.30 4618.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.07 59.92% 23650.59 21183 36670 903.50 0 36670 1678 1678 0.00
crit 0.05 39.95% 62172.68 53319 113692 1893.03 0 113692 2940 2940 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (10) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 24658 8.2% 53.7 8.14sec 206693 192219 140464 305480 206691 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.73 53.73 0.00 0.00 1.0753 0.0000 11105265.31 11105265.31 0.00 192219.08 192219.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.07 59.68% 140463.73 110446 323346 140576.14 116932 173145 4504349 4504349 0.00
crit 21.61 40.22% 305480.15 230124 808460 305704.94 237061 418182 6600916 6600916 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11494 3.8% 235.5 1.96sec 21983 0 21983 0 21983 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.46 235.46 0.00 0.00 0.0000 0.0000 5176096.84 5176096.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.46 100.00% 21983.01 7034 371987 21996.80 16938 31220 5176097 5176097 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:176480.08
  • base_dd_max:176480.08
shadow_word_death 9748 3.2% 15.7 4.68sec 280196 259170 190670 412014 280199 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 0.00 0.00 1.0812 0.0000 4389824.26 4389824.26 0.00 259170.17 259170.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.31 59.41% 190669.52 152630 446332 191028.81 152630 281272 1774618 1774618 0.00
crit 6.35 40.51% 412013.71 318016 1115962 412986.76 0 1056039 2615206 2615206 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 36454 (80065) 12.2% (26.7%) 119.0 3.76sec 303025 281420 0 0 0 0.0% 0.1% 0.0% 0.0% 447.1 25006 54198 36730 40.2% 0.0% 141.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.03 119.03 447.10 447.10 1.0768 1.4213 16421827.50 16421827.50 0.00 47232.56 281419.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.94 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.09 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 267.5 59.84% 25005.72 21342 40629 25012.17 23557 27399 6689940 6689940 0.00
crit 179.6 40.16% 54197.63 44467 101583 54208.90 50108 60398 9731887 9731887 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18182 6.1% 195.3 2.28sec 41938 0 25385 66716 41973 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.30 195.14 0.00 0.00 0.0000 0.0000 8190510.51 8190510.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.52 59.71% 25385.36 22409 40629 25390.25 23643 27716 2957948 2957948 0.00
crit 78.43 40.19% 66716.34 56403 125965 66734.68 60745 75167 5232562 5232562 0.00
miss 0.19 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 25428 8.5% 258.0 1.73sec 44404 0 30385 66123 44832 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 257.98 255.52 0.00 0.00 0.0000 0.0000 11455534.76 11455534.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.23 59.58% 30385.30 26478 48441 30388.07 28483 33476 4625686 4625686 0.00
crit 103.29 40.42% 66123.28 55169 121116 66127.56 60907 75989 6829849 6829849 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1285 0.4% 3.1 89.87sec 182969 0 110793 276828 182967 43.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.11 3.11 0.00 0.00 0.0000 0.0000 569370.58 569370.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.75 56.34% 110793.20 83080 153360 92952.11 0 153360 194261 194261 0.00
crit 1.36 43.54% 276827.58 173104 383445 207832.58 0 383445 375109 375109 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22423 (33382) 7.5% (11.1%) 37.6 11.93sec 399442 335560 0 0 0 0.0% 0.1% 0.0% 0.0% 207.2 33018 71864 48711 40.4% 0.0% 88.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.62 37.62 207.23 207.23 1.1904 1.9320 10094217.08 10094217.08 0.00 33758.65 335560.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.59 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.5 59.60% 33017.99 27457 53135 33033.35 30225 36867 4078054 4078054 0.00
crit 83.7 40.40% 71864.48 57209 132854 71882.26 64718 82508 6016164 6016164 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10958 3.7% 90.5 4.88sec 54496 0 32912 86787 54536 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.52 90.46 0.00 0.00 0.0000 0.0000 4933174.90 4933174.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.00 59.70% 32911.90 28830 53135 32919.54 29959 37629 1777249 1777249 0.00
crit 36.36 40.20% 86787.49 72566 164741 86824.69 74829 103156 3155926 3155926 0.00
miss 0.09 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 116447 / 9296
melee 116051 3.1% 35.6 11.06sec 115928 124020 76896 180316 115927 41.9% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.56 35.56 0.00 0.00 0.9348 0.0000 4122556.63 4122556.63 0.00 124020.23 124020.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.11 34.05% 76895.73 57590 120110 77077.72 62141 117714 931152 931152 0.00
crit 14.90 41.90% 180315.92 115181 288264 179939.90 131334 250815 2686690 2686690 0.00
glance 8.52 23.95% 59256.37 43193 90083 59274.30 0 90083 504714 504714 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0757 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 396 0.0% 1.4 1.71sec 9968 0 5889 14493 9968 47.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.41 0.00 0.00 0.0000 0.0000 14011.21 14011.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.37% 5888.95 4377 7078 3179.79 0 7078 4335 4335 0.00
crit 0.67 47.50% 14492.91 10506 16987 7274.18 0 16987 9676 9676 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4169.46
  • base_dd_max:4169.46

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 29.1 3.0 14.8sec 13.4sec 8.95% 50.29%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.95%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.3 0.0 21.8sec 21.8sec 13.46% 16.09%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:13.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 123.5sec 123.5sec 17.80% 17.80%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.80%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.5sec 23.4sec 41.65% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.65%

    Trigger Attempt Success

    • trigger_pct:99.40%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.77% 49.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.77%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.70%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 42.6 16.9 10.3sec 7.4sec 31.36% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:24.67%
  • surge_of_darkness_2:6.69%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.6sec 39.6sec 22.94% 53.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.94%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.4sec 55.2sec 17.61% 17.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.61%

    Trigger Attempt Success

    • trigger_pct:99.90%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.88% 56.98%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_DI
devouring_plague Shadow Orb 20.3 60.9 3.0 3.0 316310.9
halo Mana 10.5 427057.9 40500.0 40499.8 12.2
mind_blast Mana 55.6 228349.1 4104.7 4104.6 58.9
mind_flay Mana 65.4 196195.1 3000.0 3000.0 50.5
mind_sear Mana 0.1 982.8 9000.0 9003.7 9.6
shadow_word_death Mana 15.7 122210.1 7800.0 7800.5 35.9
shadow_word_pain Mana 119.0 1571126.3 13200.0 13199.8 23.0
vampiric_touch Mana 37.6 338586.8 9000.0 9000.0 44.4
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.53 261719.51 (11.53%) 7366.87 58019.53 18.15%
Shadow Orbs from Mind Blast Shadow Orb 55.57 54.49 (87.34%) 0.98 1.09 1.96%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.90 7.90 (12.66%) 1.00 0.00 0.00%
Devouring Plague Health Health 276.61 0.00 (0.00%) 0.00 5881836.16 100.00%
Vampiric Touch Mana Mana 297.69 1479434.94 (65.15%) 4969.78 35306.94 2.33%
halo_heal Health 10.54 0.00 (0.00%) 0.00 3643646.36 100.00%
external_healing Health 83.48 0.00 (0.00%) 0.00 29341416.46 100.00%
mp5_regen Mana 1801.83 529542.14 (23.32%) 293.89 11006.78 2.04%
pet - shadowfiend
external_healing Health 21.17 0.00 (0.00%) 0.00 7900200.05 100.00%
Resource RPS-Gain RPS-Loss
Mana 5039.47 6401.74
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -315851.12 -907200.00 111600.00
Shadow Orb 1.47 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%
shadowfiend-Mana Cap 2.1%
mindbender-Mana Cap 2.1%

Procs

Count Interval
Shadowy Recall Extra Tick 417.3 1.1sec
Shadowy Apparition Procced 258.0 1.7sec
Divine Insight Mind Blast CD Reset 54.5 13.4sec
FDCL Mind Spike proc 59.5 7.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_DI Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Per Second
Count 24992
Mean 300202.52
Minimum 261751.92
Maximum 356478.78
Spread ( max - min ) 94726.86
Range [ ( max - min ) / 2 * 100% ] 15.78%
Standard Deviation 10838.0567
5th Percentile 282969.89
95th Percentile 318651.55
( 95th Percentile - 5th Percentile ) 35681.66
Mean Distribution
Standard Deviation 68.5569
95.00% Confidence Intervall ( 300068.15 - 300336.89 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5006
0.1 Scale Factor Error with Delta=300 1002735
0.05 Scale Factor Error with Delta=300 4010943
0.01 Scale Factor Error with Delta=300 100273576
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Damage per Second (effective)
Count 24992
Mean 300202.52
Minimum 261751.92
Maximum 356478.78
Spread ( max - min ) 94726.86
Range [ ( max - min ) / 2 * 100% ] 15.78%
Damage
Sample Data Priest_Shadow_T16H_FDCL_DI Damage
Count 24992
Mean 130998207.56
Minimum 94973884.34
Maximum 173813477.89
Spread ( max - min ) 78839593.55
Range [ ( max - min ) / 2 * 100% ] 30.09%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.77 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 3.77 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.54 mind_blast,if=active_enemies<=5&cooldown_react
I 7.90 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.93 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 33.47 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 5.01 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.85 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 16.55 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 9.40 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.54 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.06 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 12.63 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 44.32 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.11 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 65.40 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 84.09 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZXZcXcHXZOWWWWWWHQRXccXZHZccXHMZZHQccccXLHLLHSHGHMZZZNRXcHZOZXcccHQXZZcccHMZZHLLLSMMMHOQRNXZZHZcccXOHZZccccHQZOZcXcHSLLLMcXccHMXZXccccHQXWOHcccXZZWWWWHRHQRXOSZHXLALHLLHMGHRRXMZZWHXNHQXXZOZHXcHXXSZZcccXHLLLMcHQcMZZWHXccHZZORXXccHZSXZcccHMQZZLLLcHMMMOccccHMZWWWWWHQcccZXHSORXccMZHXZcHQcZLLLHXccHMZWWWWWHZcccXZHOQScXcZHZZZcccHMXZZHALLLMMGHXNXcMZWHZSRIFXZHOQccIFHRXZZccHGIFLLLRHXcIFMQWHcSXIFZWH8ZXccIFMHQZcccIFHRXOLLLIFHMMMQNS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_PI : 302986 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
302985.9 302985.9 130.84 / 0.04% 17402 / 5.7% 42.3 6945.8 4961.3 Mana 0.07% 53.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.84 5.80 0.00 5.27 5.58 4.59
Normalized 1.00 0.74 0.00 0.67 0.71 0.59
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.19 0.19 0.00 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > SP > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.84, SpellDamage=5.80, CritRating=5.27, HasteRating=5.58, MasteryRating=4.59 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_PI": Intellect=7.84, SpellDamage=5.80, CritRating=5.27, HasteRating=5.58, MasteryRating=4.59 )

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:867655|646909|325230|273867|264022|223531|195780|113480|47306&chds=0,1735311&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++867655++devouring_plague,9482C9,0,0,15|t++646909++halo,9482C9,1,0,15|t++325230++vampiric_touch,9482C9,2,0,15|t++273867++shadow_word_pain,9482C9,3,0,15|t++264022++shadow_word_death,9482C9,4,0,15|t++223531++mind_blast,9482C9,5,0,15|t++195780++mind_spike,4A79D3,6,0,15|t++113480++mind_flay,9482C9,7,0,15|t++47306++mind_sear,9482C9,8,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,9,9,9,8,8,7,6,5,5,4,4,4,3,3,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_spike|essence_of_yulon|mind_blast|vampiric_touch|shadow_word_pain_mastery|devouring_plague_tick|halo_damage|mind_flay|multistrike_spell|vampiric_touch_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.84,5.80,5.58,5.27,4.59|7.66,5.61,5.39,5.08,4.41|8.03,5.98,5.77,5.46,4.78&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.84++Int,FFFFFF,0,0,15,0.1,e|t++++5.80++SP,FFFFFF,0,1,15,0.1,e|t++++5.58++Haste,FFFFFF,0,2,15,0.1,e|t++++5.27++Crit,FFFFFF,0,3,15,0.1,e|t++++4.59++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.422& http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkmoqvy0357777585430zyxxwtrqponmmlljihfehjklmmnnnoopppooonnmifdbaaZYYXWVVVVVWWXXYZZdeffghjjkkkkjiihhggfbbabbbZZaaaabbbccdddefffffflnqsuuwxyzz0000zzyxxrnligfdcaZYXXWWWXXYYZZabcdefhjlmnooonmllkjjihggfecbbaaZZZaaaaaaaaaZZYYZbceffghiijkkllllmmmljhfefeeddddddddefgghhilmnnnoppqqqqponmlkjifeddddbbbbbabbbbbbbbccbbbaacdfghhiijjkklllllllligedccbbaaZZYYYZZaabbbcdegijmpruvxyyyyzzz00zyyxwusqponmlllkkkjjjiihhhghjlmonooppppqqqqqqppomkigggfffeeeeeeeeeffffhhijkkklmmnnnnnnnnnnllkkkjjiihhghhhiijjkklmnooprtwz1233332221110000ywtqponnmlllkkkjjiiiihhijkklnopqsssspnlkihfdbX&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.5930,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=302986|max=510897&chxp=1,1,59,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,3,3,15,17,25,41,80,124,167,265,399,475,616,783,902,1122,1320,1412,1582,1596,1506,1612,1538,1440,1372,1239,1050,913,742,602,499,418,311,226,170,121,87,63,47,28,27,9,8,5,3,0,3,2,1&chds=0,1612&chbh=5&chxt=x&chxl=0:|min=265166|avg=302986|max=350443&chxp=0,1,44,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:31.9,20.1,13.1,10.7,10.5,4.1,3.8,2.5,0.7,0.1,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 143.6s|mind_flay 90.6s|mind_spike 58.9s|mind_blast 48.2s|vampiric_touch 47.4s|devouring_plague 18.4s|shadow_word_death 16.9s|halo 11.2s|shadowfiend 3.3s|mind_sear 0.3s|waiting 0.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_PI 302986
devouring_plague 10514 (35363) 3.5% (11.7%) 17.1 25.99sec 933625 867655 191004 408582 277567 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 0.00 0.00 1.0761 0.0000 4738556.63 4738556.63 0.00 867655.37 867655.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.25 60.03% 191003.52 169721 323211 191005.32 169721 248619 1957575 1957575 0.00
crit 6.81 39.87% 408581.50 353627 808124 408860.96 0 617436 2780981 2780981 0.00
miss 0.02 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8202 2.7% 70.7 5.99sec 52259 0 32014 82851 52346 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.74 70.62 0.00 0.00 0.0000 0.0000 3696689.68 3696689.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.28 59.86% 32013.84 28287 53869 32024.89 28436 37561 1353389 1353389 0.00
crit 28.28 40.05% 82851.28 71200 167017 82856.76 72086 107833 2343300 2343300 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16647 5.5% 17.1 25.99sec 439526 0 0 0 0 0.0% 0.0% 0.0% 0.0% 161.7 31887 68182 46404 40.0% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 161.70 161.70 0.0000 0.6457 7503582.82 7503582.82 0.00 71867.20 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.0 60.00% 31887.12 28287 176467 31899.30 28815 48169 3093961 3093961 0.00
crit 64.7 40.00% 68182.21 58939 367683 68183.03 59636 104776 4409622 4409622 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25516 8.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 180.8 25807 56517 38207 40.4% 0.1% 31.8%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 37.28 180.75 300.71 0.0000 0.7938 11489118.30 11489118.30 0.00 80079.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.0 59.52% 25806.56 21101 42942 25816.94 23382 29604 4618856 4618856 0.00
crit 121.6 40.43% 56516.61 43965 107367 56516.76 50047 67625 6870262 6870262 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (16017) 0.0% (5.3%) 10.4 44.81sec 691150 646909 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.44 10.44 0.00 0.00 1.0685 0.0000 0.00 0.00 0.00 646909.50 646909.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.20 59.36% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.23 40.54% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 16017 5.3% 10.4 44.81sec 691150 0 177186 384760 260718 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.44 27.69 0.00 0.00 0.0000 0.0000 7218216.19 7218216.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.53 59.69% 177186.21 153853 289544 177286.42 153853 218119 2928173 2928173 0.00
crit 11.15 40.27% 384760.19 320566 723945 384042.87 0 599151 4290043 4290043 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 23919 7.9% 45.1 10.08sec 239151 223531 163491 353069 239150 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 1.0699 0.0000 10776439.32 10776439.32 0.00 223531.20 223531.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.00 59.93% 163490.84 135799 415972 163466.72 141790 191379 4414901 4414901 0.00
crit 18.02 39.98% 353068.63 282948 1040052 353232.31 287508 445973 6361538 6361538 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 15328 (22890) 5.0% (7.5%) 65.6 6.64sec 156829 113480 0 0 0 0.0% 0.1% 0.0% 0.0% 110.0 42165 92534 62629 40.6% 0.0% 14.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.58 65.58 109.96 109.96 1.3820 0.6019 6886806.02 6886806.02 0.00 113479.79 113479.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.52 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.3 59.37% 42164.78 35993 68540 42187.92 37780 48040 2752709 2752709 0.00
crit 44.7 40.63% 92534.17 74995 171371 92593.46 79828 113339 4134097 4134097 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7563 2.5% 48.0 8.69sec 70751 0 42242 112529 70771 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.02 48.01 0.00 0.00 0.0000 0.0000 3397526.54 3397526.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.45 59.26% 42241.50 35993 68540 42266.00 36775 52196 1201808 1201808 0.00
crit 19.51 40.64% 112529.50 90596 212503 112613.39 91317 153358 2195718 2195718 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 27 0.0% 0.2 150.31sec 51472 47306 0 0 0 0.0% 0.2% 0.0% 0.0% 0.1 23751 52721 35310 39.9% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.24 0.24 0.09 0.35 1.0917 0.5890 12252.32 12252.32 0.00 47306.24 47306.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.24 99.85% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 60.08% 23750.80 21183 38503 1412.10 0 38503 4951 4951 0.00
crit 0.1 39.91% 52721.24 44137 96270 2853.13 0 96270 7301 7301 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 13 0.0% 0.2 22.65sec 39884 0 23764 64844 39884 39.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.15 0.15 0.00 0.00 0.0000 0.0000 5994.09 5994.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.09 60.68% 23764.44 21183 38503 1140.65 0 38503 2167 2167 0.00
crit 0.06 39.27% 64844.22 53319 119377 2472.01 0 119377 3827 3827 0.00
miss 0.00 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (13) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 25594 8.4% 55.1 7.95sec 209133 195780 141590 309215 209134 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.10 55.10 0.00 0.00 1.0682 0.0000 11523786.33 11523786.33 0.00 195779.66 195779.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.81 59.54% 141590.31 110446 339513 141693.12 119455 173088 4645427 4645427 0.00
crit 22.24 40.37% 309215.43 230124 848883 309469.17 238033 425041 6878360 6878360 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11489 3.8% 237.3 1.95sec 21803 0 21803 0 21803 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.30 237.30 0.00 0.00 0.0000 0.0000 5173859.44 5173859.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 237.30 100.00% 21803.17 7034 390587 21816.65 16202 30358 5173859 5173859 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:59516.37
  • base_dd_max:59516.37
power_infusion 0 0.0% 4.3 120.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9923 3.3% 15.8 4.65sec 283214 264022 192951 416470 283214 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.77 15.77 0.00 0.00 1.0727 0.0000 4465402.28 4465402.28 0.00 264021.89 264021.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.38 59.48% 192950.78 152630 468649 193342.47 0 291292 1809384 1809384 0.00
crit 6.38 40.45% 416469.94 318016 1171761 417584.99 0 859420 2656018 2656018 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 39692 (87295) 13.1% (28.8%) 134.4 3.34sec 292748 273867 0 0 0 0.0% 0.1% 0.0% 0.0% 479.3 25362 55074 37310 40.2% 0.0% 143.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.35 134.35 479.31 479.31 1.0689 1.3451 17882957.33 17882957.33 0.00 49891.74 273867.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.25 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.6 59.79% 25361.77 21342 42660 25367.32 23848 28175 7267709 7267709 0.00
crit 192.7 40.21% 55074.33 44467 106663 55086.12 50797 61814 10615249 10615249 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19827 6.6% 209.4 2.13sec 42653 0 25765 67917 42688 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 209.44 209.27 0.00 0.00 0.0000 0.0000 8933154.13 8933154.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.94 59.70% 25764.88 22409 42660 25770.04 24148 28834 3219109 3219109 0.00
crit 84.13 40.20% 67917.36 56403 132264 67937.17 61369 80388 5714045 5714045 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 27775 9.2% 276.9 1.61sec 45202 0 30871 67376 45656 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.87 274.11 0.00 0.00 0.0000 0.0000 12514797.03 12514797.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.09 59.50% 30870.55 26478 50863 30873.70 28906 34037 5034691 5034691 0.00
crit 111.02 40.50% 67376.46 55169 127172 67379.51 61109 76809 7480106 7480106 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1373 0.4% 3.2 88.07sec 191872 0 115226 290934 191878 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.17 3.17 0.00 0.00 0.0000 0.0000 608628.38 608628.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.78 56.21% 115226.41 83080 161028 98072.50 0 161028 205438 205438 0.00
crit 1.39 43.69% 290933.84 173104 402617 222112.37 0 402617 403191 403191 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 23032 (34276) 7.6% (11.3%) 38.2 11.71sec 403368 325230 0 0 0 0.0% 0.1% 0.0% 0.0% 207.4 33699 73810 49958 40.5% 0.0% 85.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.23 38.23 207.43 207.43 1.2403 1.8493 10362837.59 10362837.59 0.00 35781.97 325230.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.21 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.3 59.46% 33698.62 27457 55792 33721.62 30919 38728 4156591 4156591 0.00
crit 84.1 40.54% 73809.50 57209 139496 73841.83 65561 86121 6206247 6206247 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11245 3.7% 90.5 4.90sec 55892 0 33519 89008 55932 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.53 90.47 0.00 0.00 0.0000 0.0000 5059907.67 5059907.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.79 59.46% 33519.21 28830 55792 33531.33 30090 38023 1803015 1803015 0.00
crit 36.59 40.45% 89007.55 72566 172978 89040.00 76003 106814 3256893 3256893 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 116359 / 9289
melee 115967 3.0% 35.6 11.07sec 115845 123933 76899 180401 115847 41.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.56 35.56 0.00 0.00 0.9348 0.0000 4119530.43 4119530.43 0.00 123932.93 123932.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.11 34.06% 76898.93 57590 120110 77084.21 61524 112277 931292 931292 0.00
crit 14.86 41.80% 180401.19 115181 288264 180037.32 136164 254537 2681421 2681421 0.00
glance 8.55 24.04% 59280.67 43193 90083 59294.08 0 90083 506818 506818 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0685 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 392 0.0% 1.4 1.73sec 9893 0 5888 14459 9893 46.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.40 0.00 0.00 0.0000 0.0000 13830.69 13830.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 53.03% 5887.90 4377 7078 3198.52 0 7078 4365 4365 0.00
crit 0.65 46.83% 14459.30 10506 16987 7258.93 0 16987 9465 9465 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.05%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.1 0.0 26.0sec 26.0sec 14.82% 14.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:14.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 123.3sec 123.3sec 17.85% 17.85%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.85%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.63% 41.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.63%

    Trigger Attempt Success

    • trigger_pct:99.36%
power_infusion 4.3 0.0 120.6sec 120.6sec 18.65% 18.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 9.8sec 9.8sec 14.89% 49.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.89%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.81%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 43.6 16.0 10.1sec 7.4sec 28.63% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:23.27%
  • surge_of_darkness_2:5.36%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.6sec 39.6sec 22.96% 43.71%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.96%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.1sec 54.9sec 17.69% 17.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.69%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.94% 57.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_PI
devouring_plague Shadow Orb 17.1 51.2 3.0 3.0 311412.5
halo Mana 10.4 399208.2 38224.9 38224.5 18.1
mind_blast Mana 45.1 390300.4 8661.6 8661.6 27.6
mind_flay Mana 65.6 188089.5 2868.2 2868.2 54.7
mind_sear Mana 0.2 2094.1 8800.3 8797.5 5.9
shadow_word_death Mana 15.8 118371.6 7507.0 7507.6 37.7
shadow_word_pain Mana 134.3 1701357.8 12663.8 12663.6 23.1
vampiric_touch Mana 38.2 330226.3 8636.8 8636.8 46.7
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.52 246126.96 (11.01%) 6928.42 73591.20 23.02%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.58 (84.86%) 0.99 0.44 0.98%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.95 7.95 (15.14%) 1.00 0.00 0.00%
Devouring Plague Health Health 232.33 0.00 (0.00%) 0.00 4940276.29 100.00%
Vampiric Touch Mana Mana 297.90 1462933.42 (65.44%) 4910.86 53056.58 3.50%
halo_heal Health 10.44 0.00 (0.00%) 0.00 3615330.63 100.00%
external_healing Health 83.58 0.00 (0.00%) 0.00 29387177.23 100.00%
mp5_regen Mana 1801.83 526428.36 (23.55%) 292.16 14120.57 2.61%
pet - shadowfiend
external_healing Health 21.20 0.00 (0.00%) 0.00 7915256.29 100.00%
Resource RPS-Gain RPS-Loss
Mana 4961.34 6945.79
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -595279.80 -1327740.00 -101400.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
mindbender-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 418.5 1.1sec
Shadowy Apparition Procced 276.9 1.6sec
FDCL Mind Spike proc 59.6 7.4sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_PI Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Per Second
Count 24992
Mean 302985.86
Minimum 265166.44
Maximum 350442.50
Spread ( max - min ) 85276.06
Range [ ( max - min ) / 2 * 100% ] 14.07%
Standard Deviation 10553.0661
5th Percentile 286040.38
95th Percentile 320844.51
( 95th Percentile - 5th Percentile ) 34804.13
Mean Distribution
Standard Deviation 66.7541
95.00% Confidence Intervall ( 302855.03 - 303116.70 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4660
0.1 Scale Factor Error with Delta=300 950694
0.05 Scale Factor Error with Delta=300 3802778
0.01 Scale Factor Error with Delta=300 95069451
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Damage per Second (effective)
Count 24992
Mean 302985.86
Minimum 265166.44
Maximum 350442.50
Spread ( max - min ) 85276.06
Range [ ( max - min ) / 2 * 100% ] 14.07%
Damage
Sample Data Priest_Shadow_T16H_FDCL_PI Damage
Count 24992
Mean 132250512.08
Minimum 94983011.69
Maximum 176770644.50
Spread ( max - min ) 81787632.80
Range [ ( max - min ) / 2 * 100% ] 30.92%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.82 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.74 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.95 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.65 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.74 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 4.17 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.33 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.33 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 8.92 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.44 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.96 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.21 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 46.19 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.24 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 65.58 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 100.53 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABHLMSZZZXccccHXOZXccXcHQZXZccXcHMZZZXcccHLLLMMSRXHMQZZNccXHZZOccccHMZZXcccHQZZOLLLHMMMMRSRNXHZXOXcXcHQXZZXBcccHMXZZccccHLLLMMRSRXHMQZXcXccHZXOZccccHXZZccccHMQZXALLLHMMMORSNXHXZZZccccHMQXZXcXcHZZZOXcXcHLLLMMcScHQXZRRXBccHMZZZccXcHXZZZccXHMQZXLLLSHMMMONRXcHMZZccXcHQZXOccccHMZZccXcHLLLMMSccHMQZXccXcHXZOZcccHZZZccXcHMQXZLALBLHMMMSORNXcHMZZZccIFHQRORRXIFHZZNXXIFHLLLMQSIFHMZNZcIFHQZX8OXIFXHMZZNIFQHRXZOIFLHLLMMGIFL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_FDCL_ToF : 305007 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
305007.1 305007.1 130.26 / 0.04% 17344 / 5.7% 40.8 7242.6 4933.4 Mana 0.09% 52.8 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: From Darkness, Comes Light
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.88 5.83 0.00 5.22 5.93 4.44
Normalized 1.00 0.74 0.00 0.66 0.75 0.56
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.19 0.19 0.00 0.19 0.19 0.18
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.88, SpellDamage=5.83, CritRating=5.22, HasteRating=5.93, MasteryRating=4.44 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_FDCL_ToF": Intellect=7.88, SpellDamage=5.83, CritRating=5.22, HasteRating=5.93, MasteryRating=4.44 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:911247|664527|314566|298042|271937|230641|199752|109136|43668&chds=0,1822495&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++911247++devouring_plague,9482C9,0,0,15|t++664527++halo,9482C9,1,0,15|t++314566++vampiric_touch,9482C9,2,0,15|t++298042++shadow_word_death,9482C9,3,0,15|t++271937++shadow_word_pain,9482C9,4,0,15|t++230641++mind_blast,9482C9,5,0,15|t++199752++mind_spike,4A79D3,6,0,15|t++109136++mind_flay,9482C9,7,0,15|t++43668++mind_sear,9482C9,8,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,9,9,8,8,8,7,6,6,5,4,4,4,4,3,3,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,7BC29D,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|shadowy_apparition|essence_of_yulon|mind_spike|mind_blast|vampiric_touch|shadow_word_pain_mastery|devouring_plague_tick|halo_damage|mind_flay|multistrike_spell|shadow_word_death|devouring_plague|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.88,5.93,5.83,5.22,4.44|7.69,5.75,5.65,5.04,4.25|8.07,6.12,6.02,5.41,4.62&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.88++Int,FFFFFF,0,0,15,0.1,e|t++++5.93++Haste,FFFFFF,0,1,15,0.1,e|t++++5.83++SP,FFFFFF,0,2,15,0.1,e|t++++5.22++Crit,FFFFFF,0,3,15,0.1,e|t++++4.44++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.466& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gikmotvx02343414210yxxwwusrqqppoonnlkjhgjmooppqrrrssttssrrrqlifeddbbaZYXXXXXYYZaabbghiijkmmnnoonmlkkjjiedddddccccccccdddddeeeeeeeeilnoqrstvwxxyyyyyxxxsomkihgedcbaZZYZZaabbcddeghiknpqrssrqppoonmlkkjjifeddcccccccccccccbbaabdfhiijklmmnoooooooomjhfeeddccbbaaabddegghimnopqruuvvwwvutsrqppkjjjjiggggffffggggggggggffehjlmnnopqqrssstssssspnljiihggffeeeeeffghhhijkmoqsvxz122322222221000zyvutsrrrrrrrrrrrrqqqppqsvxzyzz000111111000ywtrppoonnmmmmmmmmmnnnnpqrsttuuvwxxxxxxxxxxvuutttsrrqppppppppqqqqrssstuwz244566777777777787530zzyxwwvvuuutssssrrrrstuvwyz01220xusqomkhfa&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6507,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=305007|max=468761&chxp=1,1,65,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,5,10,16,23,29,53,70,155,233,323,436,472,704,850,1040,1215,1318,1457,1602,1650,1640,1629,1461,1385,1322,1129,971,858,698,523,426,359,249,193,149,102,85,46,32,13,27,7,14,5,2,2,0,0,1&chds=0,1650&chbh=5&chxt=x&chxl=0:|min=267927|avg=305007|max=353431&chxp=0,1,43,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_FDCL_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:32.1,20.1,12.5,10.8,10.6,4.1,3.8,2.5,0.7,0.1,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 144.4s|mind_flay 90.7s|mind_spike 56.5s|mind_blast 48.6s|vampiric_touch 47.6s|devouring_plague 18.4s|shadow_word_death 17.0s|halo 11.2s|shadowfiend 3.3s|mind_sear 0.3s|waiting 0.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_FDCL_ToF 305007
devouring_plague 11131 (37165) 3.7% (12.2%) 17.0 26.03sec 982908 911247 202386 433355 294330 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.04 17.04 0.00 0.00 1.0787 0.0000 5016695.46 5016695.46 0.00 911247.40 911247.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.23 60.03% 202385.53 169721 353993 202357.10 171073 261639 2070720 2070720 0.00
crit 6.80 39.88% 433355.41 353627 885088 433598.75 0 721385 2945976 2945976 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8598 2.8% 70.1 6.07sec 55296 0 33884 87634 55384 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.10 69.98 0.00 0.00 0.0000 0.0000 3876021.41 3876021.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.89 59.86% 33884.20 28287 59000 33896.46 29825 40438 1419446 1419446 0.00
crit 28.03 40.05% 87634.39 71200 182923 87637.98 73827 111127 2456575 2456575 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17436 5.7% 17.0 26.03sec 461176 0 0 0 0 0.0% 0.0% 0.0% 0.0% 160.4 33696 72016 49019 40.0% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.04 17.04 160.36 160.36 0.0000 0.6525 7860566.63 7860566.63 0.00 75129.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.2 60.01% 33695.66 28287 115165 33705.33 30201 45079 3242721 3242721 0.00
crit 64.1 39.99% 72015.72 58939 239956 72013.02 62313 96160 4617846 4617846 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25395 8.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 175.0 26618 58073 39284 40.3% 0.1% 30.8%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 36.01 174.99 291.10 0.0000 0.7942 11435475.51 11435475.51 0.00 82282.63 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.6 59.63% 26618.31 21101 47031 26628.64 24121 30806 4620567 4620567 0.00
crit 117.4 40.31% 58072.80 43965 117592 58066.02 51193 70043 6814909 6814909 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (16569) 0.0% (5.4%) 10.4 44.95sec 715748 664527 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 10.42 0.00 0.00 1.0771 0.0000 0.00 0.00 0.00 664527.50 664527.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.20 59.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.20 40.33% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 16569 5.4% 10.4 44.95sec 715748 0 182041 393789 267104 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 27.91 0.00 0.00 0.0000 0.0000 7454669.46 7454669.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.68 59.76% 182040.66 153853 317120 182021.73 157150 225424 3036126 3036126 0.00
crit 11.22 40.20% 393788.51 320566 792892 392894.01 0 574560 4418544 4418544 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 24855 8.2% 45.1 10.08sec 248526 230641 170041 367039 248527 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 1.0776 0.0000 11197607.39 11197607.39 0.00 230640.73 230640.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.03 59.99% 170040.64 135799 455588 170038.14 146390 203080 4596089 4596089 0.00
crit 17.99 39.92% 367038.54 282948 1139104 367194.75 297514 466310 6601519 6601519 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14752 (22029) 4.8% (7.2%) 65.4 6.64sec 151470 109136 0 0 0 0.0% 0.1% 0.0% 0.0% 105.1 42669 93159 63107 40.5% 0.0% 14.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.36 65.36 105.06 105.06 1.3879 0.6292 6629964.53 6629964.53 0.00 109135.82 109135.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.30 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.5 59.52% 42668.60 35993 75068 42678.08 38570 49546 2668131 2668131 0.00
crit 42.5 40.48% 93158.75 74995 187692 93188.91 79591 112503 3961834 3961834 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7277 2.4% 45.9 9.07sec 71263 0 42751 113183 71281 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.88 45.87 0.00 0.00 0.0000 0.0000 3269745.89 3269745.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.22 59.34% 42751.12 35993 75068 42759.69 36927 50543 1163703 1163703 0.00
crit 18.61 40.56% 113183.45 90596 227634 113258.43 90596 147932 2106043 2106043 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 27 0.0% 0.2 153.48sec 47489 43668 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 24264 52579 35349 39.2% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.25 0.25 0.08 0.33 1.0878 0.6027 11790.47 11790.47 0.00 43668.39 43668.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.25 99.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 60.78% 24263.67 21183 42170 1466.24 0 42170 4919 4919 0.00
crit 0.1 39.18% 52579.09 44137 102966 2888.94 0 102966 6871 6871 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 13 0.0% 0.1 8.70sec 39201 0 24118 63933 39201 37.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.15 0.15 0.00 0.00 0.0000 0.0000 5720.42 5720.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.09 61.94% 24117.59 21183 42170 1170.09 0 42170 2180 2180 0.00
crit 0.06 37.95% 63932.95 53319 127680 2362.51 0 127680 3540 3540 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (13) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_spike 25080 8.2% 52.6 8.32sec 214755 199752 145856 317125 214755 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.59 52.59 0.00 0.00 1.0751 0.0000 11293167.72 11293167.72 0.00 199751.80 199751.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.34 59.60% 145856.36 110446 371848 145984.40 120773 177436 4571106 4571106 0.00
crit 21.20 40.31% 317124.63 230124 929729 317385.42 247780 438517 6722062 6722062 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=19853 to 19926} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
multistrike_spell 11618 3.8% 230.6 2.01sec 22681 0 22681 0 22681 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 230.64 230.64 0.00 0.00 0.0000 0.0000 5231236.26 5231236.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 230.64 100.00% 22681.21 7034 427786 22700.40 16268 31704 5231236 5231236 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:69080.41
  • base_dd_max:69080.41
shadow_word_death 11258 3.7% 15.7 4.67sec 322228 298042 219445 473897 322230 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.73 15.73 0.00 0.00 1.0812 0.0000 5067899.80 5067899.80 0.00 298041.63 298041.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.35 59.47% 219445.05 175524 513282 219876.72 175524 381123 2052358 2052358 0.00
crit 6.36 40.46% 473896.99 365719 1283357 475043.40 0 810452 3015542 3015542 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 39690 (87188) 13.0% (28.6%) 134.2 3.34sec 292775 271937 0 0 0 0.0% 0.1% 0.0% 0.0% 466.0 26133 56617 38370 40.1% 0.0% 142.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.15 134.15 466.00 466.00 1.0766 1.3805 17880344.62 17880344.62 0.00 49858.04 271936.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.06 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.9 59.86% 26133.38 21342 46723 26139.85 24513 28650 7289785 7289785 0.00
crit 187.1 40.14% 56617.12 44467 116821 56629.73 52381 61899 10590560 10590560 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19820 6.5% 203.5 2.19sec 43874 0 26569 69787 43910 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.48 203.31 0.00 0.00 0.0000 0.0000 8927486.53 8927486.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.44 59.73% 26568.76 22409 46723 26575.53 24836 29752 3226403 3226403 0.00
crit 81.69 40.18% 69786.66 56403 144860 69805.58 62860 80116 5701084 5701084 0.00
miss 0.18 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 27678 9.1% 268.7 1.66sec 46398 0 31782 69115 46860 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 268.74 266.09 0.00 0.00 0.0000 0.0000 12468837.61 12468837.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 158.62 59.61% 31782.21 26478 55707 31786.64 29431 35026 5041409 5041409 0.00
crit 107.47 40.39% 69114.93 55169 139283 69120.62 62849 78264 7427429 7427429 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1266 0.4% 3.0 90.86sec 186286 0 113153 280915 186285 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 559626.73 559626.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.69 56.22% 113153.26 83080 166781 94276.68 0 162825 191125 191125 0.00
crit 1.31 43.67% 280914.99 173104 383445 207603.15 0 383445 368502 368502 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:118198.80
  • base_dd_max:118198.80
vampiric_touch 22332 (33298) 7.3% (10.9%) 38.3 11.70sec 391701 314566 0 0 0 0.0% 0.1% 0.0% 0.0% 198.2 34379 74821 50714 40.4% 0.0% 85.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.26 38.26 198.18 198.18 1.2452 1.9318 10050221.00 10050221.00 0.00 34810.61 314565.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.23 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.1 59.61% 34379.10 27457 61105 34396.32 31421 38767 4061269 4061269 0.00
crit 80.0 40.39% 74821.02 57209 152782 74846.35 66437 86162 5988952 5988952 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10966 3.6% 86.6 5.10sec 56998 0 34386 90738 57040 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.57 86.51 0.00 0.00 0.0000 0.0000 4934424.97 4934424.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.60 59.64% 34386.17 28830 61105 34396.96 31013 39125 1774163 1774163 0.00
crit 34.83 40.26% 90737.77 72566 189452 90778.03 78056 108718 3160262 3160262 0.00
miss 0.09 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115836 / 9246
melee 115445 3.0% 35.6 11.06sec 115301 123351 76538 179609 115300 41.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.56 35.56 0.00 0.00 0.9348 0.0000 4100202.82 4100202.82 0.00 123351.47 123351.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.13 34.11% 76538.31 57590 120110 76734.83 60470 109666 928465 928465 0.00
crit 14.85 41.76% 179609.01 115181 288264 179240.38 130147 255256 2667120 2667120 0.00
glance 8.54 24.03% 59059.78 43193 90083 59075.46 43193 90083 504618 504618 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0758 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 391 0.0% 1.4 1.69sec 9889 0 5872 14443 9889 47.0% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.39 0.00 0.00 0.0000 0.0000 13793.75 13793.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.81% 5871.83 4377 7078 3165.59 0 7078 4326 4326 0.00
crit 0.66 47.00% 14442.79 10506 16987 7079.94 0 16987 9468 9468 0.00
miss 0.00 0.19% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6741.11
  • base_dd_max:6741.11

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.32%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.0sec 26.0sec 15.12% 14.94%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:15.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.0sec 124.0sec 17.69% 17.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.69%

    Trigger Attempt Success

    • trigger_pct:99.90%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.59% 41.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.59%

    Trigger Attempt Success

    • trigger_pct:99.42%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.85% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.85%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.35%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 42.1 14.8 10.5sec 7.7sec 27.96% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:22.77%
  • surge_of_darkness_2:5.19%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 20% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 9.3 2.1 49.5sec 39.7sec 22.94% 52.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.94%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.4sec 55.1sec 17.65% 17.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.65%

    Trigger Attempt Success

    • trigger_pct:99.87%
twist_of_fate 1.0 331.9 0.0sec 0.4sec 32.03% 32.03%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.90% 56.92%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_FDCL_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_FDCL_ToF
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 327825.4
halo Mana 10.4 421812.4 40500.0 40499.6 17.7
mind_blast Mana 45.1 405504.0 9000.0 9000.0 27.6
mind_flay Mana 65.4 196076.0 3000.0 3000.0 50.5
mind_sear Mana 0.2 2234.9 9000.0 9001.5 5.3
shadow_word_death Mana 15.7 122685.0 7800.0 7800.6 41.3
shadow_word_pain Mana 134.1 1770771.6 13200.0 13199.6 22.2
vampiric_touch Mana 38.3 344294.3 9000.0 8999.9 43.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.52 262769.90 (11.82%) 7396.87 56950.42 17.81%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.53 (84.88%) 0.99 0.48 1.07%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.93 7.93 (15.12%) 1.00 0.00 0.00%
Devouring Plague Health Health 230.35 0.00 (0.00%) 0.00 4898155.91 100.00%
Vampiric Touch Mana Mana 284.69 1427278.44 (64.21%) 5013.51 21309.60 1.47%
halo_heal Health 10.42 0.00 (0.00%) 0.00 3765545.87 100.00%
external_healing Health 83.61 0.00 (0.00%) 0.00 29218044.18 100.00%
mp5_regen Mana 1801.83 532835.32 (23.97%) 295.72 7713.61 1.43%
pet - shadowfiend
external_healing Health 21.17 0.00 (0.00%) 0.00 7909450.84 100.00%
Resource RPS-Gain RPS-Loss
Mana 4933.36 7242.58
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -741512.71 -1375200.00 -69600.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.5%
shadowfiend-Mana Cap 1.5%
mindbender-Mana Cap 1.5%

Procs

Count Interval
Shadowy Recall Extra Tick 405.8 1.1sec
Shadowy Apparition Procced 268.7 1.7sec
FDCL Mind Spike proc 56.9 7.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_FDCL_ToF Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Per Second
Count 24992
Mean 305007.12
Minimum 267927.48
Maximum 353431.24
Spread ( max - min ) 85503.76
Range [ ( max - min ) / 2 * 100% ] 14.02%
Standard Deviation 10506.3791
5th Percentile 288097.15
95th Percentile 322785.68
( 95th Percentile - 5th Percentile ) 34688.52
Mean Distribution
Standard Deviation 66.4588
95.00% Confidence Intervall ( 304876.86 - 305137.38 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4558
0.1 Scale Factor Error with Delta=300 942301
0.05 Scale Factor Error with Delta=300 3769205
0.01 Scale Factor Error with Delta=300 94230132
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage per Second (effective)
Count 24992
Mean 305007.12
Minimum 267927.48
Maximum 353431.24
Spread ( max - min ) 85503.76
Range [ ( max - min ) / 2 * 100% ] 14.02%
Damage
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage
Count 24992
Mean 133171502.40
Minimum 94831286.28
Maximum 173319833.79
Spread ( max - min ) 78488547.51
Range [ ( max - min ) / 2 * 100% ] 29.47%
DTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_FDCL_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_FDCL_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_FDCL_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.79 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.73 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.93 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.32 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 4.12 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.96 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 8.43 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.42 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.05 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.31 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 44.16 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.25 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 65.36 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 100.41 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZXccccHZOZXccccHQXZZXcccHMZZZccXXHLLLMMSXcHMQXZccccHZZOXcccHZZZccXcHMQZZLLLSHMMMOXXcXHXZZZcXcHMQZZccccHZXOccccHLLLMMSccHQZZZcccHMXZZcXccHZZOccXcHMQZZALLHLMMMORSNXHMZZXcXcHQRXOccccHMZZccccHLLLMMcSRHMQXZXcccHZZOccXcHMZZXcccHQZZOLLLHMMMMSRXNcHXZOXcccXHQZZccccHMZZZcXccHLLLMRSXXHMQZXNXcHZZZccccHMZZZcccXHQZOZLALHLMMMRNSXcHMZZccIFHQZXOcIFcHMZZcIFQHLLLMXIFSHMQXNcIFcHZZZ8OIFQXHMZZIFNXHQXZIFLLLHMMMIFNQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_FDCL_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_DI : 303453 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
303452.9 303452.9 140.03 / 0.05% 18640 / 6.1% 38.9 7189.5 5762.5 Mana 0.47% 53.1 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.63 5.59 0.00 5.12 5.73 4.64
Normalized 1.00 0.73 0.00 0.67 0.75 0.61
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.20 0.20 0.00 0.20 0.20 0.20
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.63, SpellDamage=5.59, CritRating=5.12, HasteRating=5.73, MasteryRating=4.64 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_DI": Intellect=7.63, SpellDamage=5.59, CritRating=5.12, HasteRating=5.73, MasteryRating=4.64 )

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:880439|510619|336634|265985|248259|238722|107192|73284&chds=0,1760878&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++880439++devouring_plague,9482C9,0,0,15|t++510619++halo,9482C9,1,0,15|t++336634++vampiric_touch,9482C9,2,0,15|t++265985++shadow_word_death,9482C9,3,0,15|t++248259++shadow_word_pain,9482C9,4,0,15|t++238722++mind_blast,9482C9,5,0,15|t++107192++mind_flay,9482C9,6,0,15|t++73284++mind_sear,9482C9,7,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,12,10,9,8,8,7,7,7,5,5,4,4,4,4,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|mind_blast|shadowy_apparition|essence_of_yulon|mindbender: melee|vampiric_touch|devouring_plague_tick|shadow_word_pain_mastery|mind_flay|halo_damage|devouring_plague|vampiric_touch_mastery|multistrike_spell|devouring_plague_mastery|shadow_word_death|mind_flay_mastery|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.63,5.73,5.59,5.12,4.64|7.43,5.53,5.39,4.92,4.45|7.83,5.93,5.79,5.31,4.84&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.63++Int,FFFFFF,0,0,15,0.1,e|t++++5.73++Haste,FFFFFF,0,1,15,0.1,e|t++++5.59++SP,FFFFFF,0,2,15,0.1,e|t++++5.12++Crit,FFFFFF,0,3,15,0.1,e|t++++4.64++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.169& http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:egjnquwz146778676430zzxvtrqpoonmmllkjjjjmoqrsstsssrrssrrrrqqnkjhhhhhhghhggfeedddccceeeefgijjkklkkllllkkihggfecbaabbccdefgghijkllmnquwyzzzzzyyxxwvvuuttqmjhffeeddddcccccbbbbbbcdefgikmnpqrrsssssssrqpomligfecbbaaaaaaaaaabbbbdfhjllllllllllmmnnnonlkjijjjjkkkllkkkjjjiiijkkklmopqqrrrqqqqqqqommlkigfedccddeeffgghhijjkkmoqsttssrrqqqpponnmmkigedddddddddddddddddddefgijlnprsuvwxyzzzzzzzyxwusqpomlkkjjjjjjjjjkkklmoqsuuuuuuuuuuuuuuuuusqpoooooooooooponnmmmlmmmmnnoppqrrrrrqrqqqppoonmlkkjjiiijkllmmnooprstuwy123334332211100zyxwurqqppoooooooonnmmmmmnonnopqrrsssrpnljigecZX&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6430,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=303453|max=471916&chxp=1,1,64,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,9,4,17,32,49,67,128,199,280,394,519,598,788,957,1129,1230,1400,1493,1566,1533,1602,1576,1428,1316,1179,1086,877,727,676,494,415,344,225,199,130,85,77,55,33,23,16,11,5,10,4,0,0,3&chds=0,1602&chbh=5&chxt=x&chxl=0:|min=263618|avg=303453|max=353248&chxp=0,1,44,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:34.0,26.1,13.6,9.9,4.9,3.7,2.5,1.9,0.1,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 153.0s|mind_flay 117.5s|mind_blast 61.2s|vampiric_touch 44.6s|devouring_plague 22.0s|shadow_word_death 16.9s|halo 11.5s|mindbender 8.6s|mind_sear 0.6s|waiting 2.1s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_DI 303453
devouring_plague 12755 (42997) 4.2% (14.2%) 20.4 21.71sec 948970 880439 191960 416161 281526 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.41 20.41 0.00 0.00 1.0779 0.0000 5746769.05 5746769.05 0.00 880438.81 880438.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.22 59.86% 191959.81 169721 307820 191952.14 169721 236712 2345792 2345792 0.00
crit 8.17 40.03% 416160.70 353627 769642 416377.62 0 627291 3400977 3400977 0.00
miss 0.02 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9963 3.3% 84.5 5.07sec 53109 0 32225 84250 53179 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.51 84.40 0.00 0.00 0.0000 0.0000 4488361.27 4488361.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.28 59.57% 32225.40 28287 51304 32233.87 28953 38134 1620142 1620142 0.00
crit 34.04 40.34% 84250.30 71200 159064 84247.11 73117 102348 2868219 2868219 0.00
miss 0.08 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20279 6.7% 20.4 21.71sec 447570 0 0 0 0 0.0% 0.0% 0.0% 0.0% 193.4 32224 69546 47232 40.2% 0.0% 27.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.41 20.41 193.44 193.44 0.0000 0.6493 9136284.47 9136284.47 0.00 72742.28 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.7 59.79% 32223.58 28287 131421 32231.34 28622 83733 3726718 3726718 0.00
crit 77.8 40.21% 69545.62 58939 328592 69525.37 60058 169320 5409567 5409567 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 23843 7.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 167.7 25405 55242 37420 40.3% 0.1% 29.6%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.31 167.66 286.93 0.0000 0.7954 10737011.39 10737011.39 0.00 80519.94 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.1 59.63% 25404.50 21101 40897 25413.03 23084 29093 4346291 4346291 0.00
crit 115.7 40.32% 55241.63 43965 102254 55235.67 48837 64831 6390720 6390720 0.00
miss 0.2 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (13004) 0.0% (4.3%) 10.7 43.90sec 549577 510619 0 0 0 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.65 10.65 0.00 0.00 1.0764 0.0000 0.00 0.00 0.00 510618.76 510618.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.33 59.47% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.31 40.42% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 13004 4.3% 10.7 43.90sec 549577 0 176635 381921 259438 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.65 22.56 0.00 0.00 0.0000 0.0000 5853222.84 5853222.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.44 59.58% 176634.55 153853 275756 177312.83 155135 242422 2374282 2374282 0.00
crit 9.11 40.38% 381921.37 320566 689472 382401.73 0 608098 3478940 3478940 0.00
miss 0.01 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 32452 10.7% 55.8 8.09sec 261706 238722 178975 386724 261710 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.85 55.85 0.00 0.00 1.0963 0.0000 14615974.49 14615974.49 0.00 238721.69 238721.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.50 59.98% 178974.52 135799 396163 178946.36 149159 209576 5995815 5995815 0.00
crit 22.29 39.91% 386723.83 282948 990526 386802.93 297209 489477 8620160 8620160 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18781 (28021) 6.2% (9.2%) 83.5 5.28sec 150866 107192 0 0 0 0.0% 0.1% 0.0% 0.0% 138.5 41200 89963 60927 40.5% 0.0% 19.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.46 83.46 138.51 138.51 1.4074 0.6312 8439222.93 8439222.93 0.00 107191.86 107191.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.37 99.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.09 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.5 59.55% 41200.05 35993 65277 41215.96 38021 45642 3398111 3398111 0.00
crit 56.0 40.45% 89962.62 74995 163211 90015.26 80226 103542 5041112 5041112 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9240 3.0% 60.5 7.09sec 68575 0 41195 109082 68603 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.55 60.52 0.00 0.00 0.0000 0.0000 4151961.39 4151961.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.00 59.47% 41195.22 35993 65277 41211.56 36665 50240 1482836 1482836 0.00
crit 24.47 40.43% 109082.25 90596 202384 109154.06 91020 140594 2669125 2669125 0.00
miss 0.06 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 99 0.0% 0.5 119.45sec 81116 73284 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 23836 52264 35166 39.9% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.54 0.54 0.31 1.25 1.1084 0.6260 44043.63 44043.63 0.00 73283.91 73283.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.54 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 60.10% 23836.42 21183 36670 4572.69 0 36670 17941 17941 0.00
crit 0.5 39.88% 52263.99 44137 91686 9282.97 0 91686 26103 26103 0.00
miss 0.0 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 48 0.0% 0.5 29.63sec 39362 0 23866 63304 39363 39.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.55 0.55 0.00 0.00 0.0000 0.0000 21553.53 21553.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.33 60.63% 23865.82 21183 36670 3795.48 0 36670 7923 7923 0.00
crit 0.22 39.32% 63304.44 53319 113692 8019.81 0 113692 13630 13630 0.00
miss 0.00 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (48) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 1.0829 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10685 3.5% 235.8 1.96sec 20402 0 20402 0 20402 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.82 235.82 0.00 0.00 0.0000 0.0000 4811172.45 4811172.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.82 100.00% 20402.02 7034 371987 20409.78 15000 28444 4811172 4811172 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:28564.48
  • base_dd_max:28564.48
shadow_word_death 9955 3.3% 15.6 4.70sec 287555 265985 196071 422453 287554 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.59 15.59 0.00 0.00 1.0811 0.0000 4483437.17 4483437.17 0.00 265984.64 265984.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.27 59.45% 196071.46 152630 446332 196363.38 152630 319426 1817520 1817520 0.00
crit 6.31 40.47% 422453.02 318016 1115962 423149.60 0 909365 2665918 2665918 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 38370 (84323) 12.7% (27.8%) 142.1 3.15sec 267266 248259 0 0 0 0.0% 0.1% 0.0% 0.0% 471.2 24984 54136 36685 40.1% 0.0% 141.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.14 142.14 471.20 471.20 1.0766 1.3566 17285789.89 17285789.89 0.00 47950.75 248259.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 142.02 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 282.1 59.86% 24983.55 21342 40629 24989.97 23642 27229 7047009 7047009 0.00
crit 189.1 40.14% 54136.10 44467 101583 54149.80 50074 60150 10238781 10238781 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 19162 6.3% 205.9 2.16sec 41916 0 25379 66693 41949 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.94 205.78 0.00 0.00 0.0000 0.0000 8632465.92 8632465.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.91 59.73% 25378.58 22409 40629 25384.31 23604 27810 3119340 3119340 0.00
crit 82.66 40.17% 66692.72 56403 125965 66712.15 61210 76077 5513126 5513126 0.00
miss 0.21 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 26791 8.8% 271.8 1.64sec 44411 0 30388 66108 44847 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 271.79 269.14 0.00 0.00 0.0000 0.0000 12070153.85 12070153.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.19 59.52% 30387.58 26478 48441 30392.28 28269 33363 4867864 4867864 0.00
crit 108.95 40.48% 66107.77 55169 121116 66114.86 59765 75529 7202290 7202290 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1233 0.4% 3.0 91.19sec 183987 0 110858 277788 183989 43.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 0.0000 0.0000 546313.93 546313.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.66 56.02% 110857.66 83080 153360 91584.43 0 153360 184405 184405 0.00
crit 1.30 43.88% 277788.21 173104 383445 205707.72 0 383445 361909 361909 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22420 (33324) 7.4% (11.0%) 37.5 11.98sec 400254 336634 0 0 0 0.0% 0.1% 0.0% 0.0% 206.8 33076 71979 48800 40.4% 0.0% 88.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.47 37.47 206.78 206.78 1.1890 1.9326 10090814.86 10090814.86 0.00 33767.88 336634.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.45 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.2 59.58% 33076.12 27457 53135 33092.26 30357 37399 4075110 4075110 0.00
crit 83.6 40.42% 71979.04 57209 132854 72003.79 64537 84127 6015705 6015705 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10904 3.6% 90.3 4.89sec 54350 0 32842 86577 54391 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.30 90.23 0.00 0.00 0.0000 0.0000 4907933.46 4907933.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.90 59.74% 32841.89 28830 53135 32852.01 29917 36470 1770229 1770229 0.00
crit 36.24 40.16% 86577.10 72566 164741 86612.13 76131 104157 3137704 3137704 0.00
miss 0.09 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 90196 / 23470
melee 89912 7.7% 113.2 3.88sec 92863 95006 64789 142864 92864 40.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.22 113.22 0.00 0.00 0.9774 0.0000 10513677.06 10513677.06 0.00 95006.25 95006.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.81 35.17% 64789.15 50679 105697 64912.19 56378 80562 2579438 2579438 0.00
crit 46.08 40.70% 142863.61 101359 253672 142796.24 118795 177344 6583435 6583435 0.00
glance 27.21 24.03% 49646.59 38010 79273 49671.78 41668 61988 1350804 1350804 0.00
dodge 0.06 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.48 23.48 0.00 0.00 1.0780 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 284 0.0% 4.2 77.42sec 7844 0 4940 11686 7844 43.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.18 0.00 0.00 0.0000 0.0000 32765.66 32765.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.37 56.79% 4939.72 3835 7078 4548.90 0 7078 11718 11718 0.00
crit 1.80 43.11% 11686.31 7669 16987 9898.13 0 16987 21048 21048 0.00
miss 0.00 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3651.90
  • base_dd_max:3651.90

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.24%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 30.6 3.2 14.2sec 12.8sec 9.34% 52.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.34%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.4 0.0 21.7sec 21.7sec 25.51% 27.23%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.2sec 125.2sec 17.49% 17.49%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.49%

    Trigger Attempt Success

    • trigger_pct:99.87%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.63% 41.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.63%

    Trigger Attempt Success

    • trigger_pct:99.43%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.9sec 9.9sec 14.71% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.71%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.5sec 39.6sec 22.97% 53.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.97%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.9 0.0 56.6sec 56.4sec 17.30% 17.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.30%

    Trigger Attempt Success

    • trigger_pct:99.89%
mindbender-shadowcrawl 23.5 0.0 19.2sec 19.2sec 85.38% 75.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.09% 28.88%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.25% 16.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_DI
devouring_plague Shadow Orb 20.4 61.2 3.0 3.0 316531.6
halo Mana 10.7 431338.0 40500.0 40499.7 13.6
mind_blast Mana 55.8 217808.3 3899.9 3900.0 67.1
mind_flay Mana 83.5 250381.2 3000.0 3000.0 50.3
mind_sear Mana 0.5 4885.9 9000.0 8998.4 9.0
shadow_word_death Mana 15.6 121623.8 7800.0 7800.6 36.9
shadow_word_pain Mana 142.1 1876180.9 13200.0 13199.8 20.2
vampiric_touch Mana 37.5 337255.2 9000.0 8999.9 44.5
Resource Gains Type Count Total Average Overflow
mindbender Mana 113.10 569389.03 (21.93%) 5034.18 23063.64 3.89%
Shadow Orbs from Mind Blast Shadow Orb 55.79 54.79 (87.45%) 0.98 1.01 1.80%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.86 7.86 (12.55%) 1.00 0.00 0.00%
Devouring Plague Health Health 277.84 0.00 (0.00%) 0.00 5908152.04 100.00%
Vampiric Touch Mana Mana 297.01 1493126.83 (57.51%) 5027.11 18258.29 1.21%
halo_heal Health 10.65 0.00 (0.00%) 0.00 3678930.08 100.00%
external_healing Health 83.38 0.00 (0.00%) 0.00 29315906.89 100.00%
mp5_regen Mana 1801.83 533957.05 (20.56%) 296.34 6591.87 1.22%
pet - mindbender
external_healing Health 26.94 0.00 (0.00%) 0.00 9952156.36 100.00%
Resource RPS-Gain RPS-Loss
Mana 5762.49 7189.53
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -343950.36 -869695.24 73933.33
Shadow Orb 1.43 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%
shadowfiend-Mana Cap 1.3%
mindbender-Mana Cap 1.3%

Procs

Count Interval
Shadowy Recall Extra Tick 441.5 1.0sec
Shadowy Apparition Procced 271.8 1.6sec
Divine Insight Mind Blast CD Reset 57.4 12.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_DI Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Per Second
Count 24992
Mean 303452.89
Minimum 263617.86
Maximum 353248.14
Spread ( max - min ) 89630.28
Range [ ( max - min ) / 2 * 100% ] 14.77%
Standard Deviation 11295.0141
5th Percentile 285334.50
95th Percentile 322613.54
( 95th Percentile - 5th Percentile ) 37279.03
Mean Distribution
Standard Deviation 71.4474
95.00% Confidence Intervall ( 303312.86 - 303592.93 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5322
0.1 Scale Factor Error with Delta=300 1089073
0.05 Scale Factor Error with Delta=300 4356294
0.01 Scale Factor Error with Delta=300 108907358
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Damage per Second (effective)
Count 24992
Mean 303452.89
Minimum 263617.86
Maximum 353248.14
Spread ( max - min ) 89630.28
Range [ ( max - min ) / 2 * 100% ] 14.77%
Damage
Sample Data Priest_Shadow_T16H_MB_DI Damage
Count 24992
Mean 126062486.53
Minimum 90152370.00
Maximum 168725860.94
Spread ( max - min ) 78573490.93
Range [ ( max - min ) / 2 * 100% ] 31.16%
DTPS
Sample Data Priest_Shadow_T16H_MB_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.94 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.73 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 3.80 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.88 mind_blast,if=active_enemies<=5&cooldown_react
I 7.86 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.68 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 33.43 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 2.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.76 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 16.61 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.65 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.04 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 12.06 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.54 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 83.46 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 109.83 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9HLMSZZZZccccHZOZZccccHQZZZcccHMZZZccccHLLLHMGHScMZZWHZ9ccZZHOQcccZZHZccHcMZZZLLLHMMGHMMNScMZHZZccccZHOZZc9cZHQZZccccHLLLMMccHMSZZZcccHMQZZcccHZZZOccccHMZZHLL9LMMGHMNScMZZHZcccZZHOQccccZHZZcccHMLLLMccSHMQZOZcc9HZZZccccHMZZZcccHQZZOLLLSHMMMYccHcHMQZZcccHZZOZccc9HZZZcHQOLHLLMSccHZZOZccHQZZZccccHMZZccHcZZZZOLLLH9MMGHScccWWWHZZZcccIFHMQZccIFHZZZccIFHLLLMQSIFHMZZcHGIF9ZZ8OcccHIFQZZccHcIFMHQZLLLIFHMMHQNS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_PI : 305258 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
305257.7 305257.7 134.67 / 0.04% 17884 / 5.9% 36.0 7831.5 5719.7 Mana 0.07% 52.9 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.80 5.79 0.00 5.31 6.77 4.33
Normalized 1.00 0.74 0.00 0.68 0.87 0.55
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.19 0.19 0.00 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > Haste > SP > Crit > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.80, SpellDamage=5.79, CritRating=5.31, HasteRating=6.77, MasteryRating=4.33 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_PI": Intellect=7.80, SpellDamage=5.79, CritRating=5.31, HasteRating=6.77, MasteryRating=4.33 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:868401|682358|327537|268046|248552|241400|112760|47603&chds=0,1736801&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++868401++devouring_plague,9482C9,0,0,15|t++682358++halo,9482C9,1,0,15|t++327537++vampiric_touch,9482C9,2,0,15|t++268046++shadow_word_death,9482C9,3,0,15|t++248552++mind_blast,9482C9,4,0,15|t++241400++shadow_word_pain,9482C9,5,0,15|t++112760++mind_flay,9482C9,6,0,15|t++47603++mind_sear,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,9,9,8,8,7,7,6,6,4,4,4,4,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|mindbender: melee|vampiric_touch|shadow_word_pain_mastery|mind_flay|halo_damage|devouring_plague_tick|vampiric_touch_mastery|multistrike_spell|devouring_plague|shadow_word_death|mind_flay_mastery|devouring_plague_mastery|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.80,6.77,5.79,5.31,4.33|7.61,6.58,5.60,5.11,4.13|7.99,6.95,5.98,5.50,4.52&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.80++Int,FFFFFF,0,0,15,0.1,e|t++++6.77++Haste,FFFFFF,0,1,15,0.1,e|t++++5.79++SP,FFFFFF,0,2,15,0.1,e|t++++5.31++Crit,FFFFFF,0,3,15,0.1,e|t++++4.33++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.369& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gikoqux035666647522zzyxvtspponmmllkiihgfklmmnmnnnooopqqqqqppjihgfgeeddcbaZZZZZZZZZZddefghkkkkkljjiihhggcbabbaYYYZZaccdefghijklmmnnuvxyzz00001110zyxxwvomkigedcaZYXWWWWWXXYYZZabdefgklnnoppoonnmllkjihhgdcbbaZZZZZZZZZZZZZZYYadefgfgghijjkklmmnnomkjjijijjjjiiihhiiiiijjnnoooprrrrrrqponmlkkfeddccaabaaabccdeeffggghhhhklmnnnnmnnnnnmmllkkkgfddbbbaaZZYYYYYZZZaabbcdehjkoqrtuvwxyyyzzzyyywvusrqpnmmlkkjjjjiiiiihhjlmopopppqqqrrrqqrrrpommllllllllkkklkkkjjjikklllllmmnnonnnnnnnnlkkkjjihhhggffghijklmnoqrtuvy0357787766543320zzxvtqponmllkkkkkjjiiiiiilmmmnprstttvurpnlkigdbY&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6116,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=305258|max=499112&chxp=1,1,61,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,0,2,1,6,15,29,34,82,151,187,276,443,489,745,941,1075,1349,1449,1626,1804,1787,1786,1697,1653,1444,1310,1073,894,689,578,410,309,222,148,108,53,39,33,12,20,8,7,2,2,1,0,0,0,1&chds=0,1804&chbh=5&chxt=x&chxl=0:|min=261891|avg=305258|max=360095&chxp=0,1,44,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.2,25.3,10.7,10.5,4.1,3.7,2.5,1.9,0.2,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 172.3s|mind_flay 113.9s|mind_blast 48.2s|vampiric_touch 47.2s|devouring_plague 18.3s|shadow_word_death 16.9s|halo 11.3s|mindbender 8.6s|mind_sear 1.0s|waiting 0.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_PI 305258
devouring_plague 10514 (35337) 3.4% (11.6%) 17.1 26.03sec 934194 868401 191137 408529 277906 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 0.00 0.00 1.0758 0.0000 4738303.10 4738303.10 0.00 868400.60 868400.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 59.92% 191136.52 169721 323211 191106.99 169721 241618 1952862 1952862 0.00
crit 6.82 39.99% 408529.45 353627 808124 408709.61 0 593166 2785442 2785442 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8176 2.7% 70.6 6.02sec 52224 0 31998 82726 52307 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.57 70.46 0.00 0.00 0.0000 0.0000 3685677.09 3685677.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.15 59.82% 31997.96 28287 53869 32007.08 28668 38288 1348835 1348835 0.00
crit 28.25 40.09% 82726.23 71200 167017 82739.69 71973 105972 2336842 2336842 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16646 5.5% 17.1 26.03sec 440125 0 0 0 0 0.0% 0.0% 0.0% 0.0% 161.7 31899 68189 46421 40.0% 0.0% 23.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 161.66 161.66 0.0000 0.6450 7504223.61 7504223.61 0.00 71971.91 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.0 59.98% 31899.48 28287 151858 31910.59 28709 65624 3093217 3093217 0.00
crit 64.7 40.02% 68189.11 58939 379691 68186.18 59802 135714 4411006 4411006 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25467 8.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 175.2 25704 55996 37914 40.4% 0.1% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.70 175.23 302.48 0.0000 0.7963 11468149.76 11468149.76 0.00 82190.69 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 180.3 59.59% 25703.93 21101 42942 25710.99 23516 29409 4633456 4633456 0.00
crit 122.1 40.35% 55996.40 43965 107367 55984.64 49618 65618 6834694 6834694 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (17067) 0.0% (5.6%) 10.5 44.50sec 728570 682358 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 10.54 0.00 0.00 1.0678 0.0000 0.00 0.00 0.00 682358.04 682358.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.26 59.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.27 40.51% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 17067 5.6% 10.5 44.50sec 728570 0 177093 384004 260180 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 29.52 0.00 0.00 0.0000 0.0000 7680622.15 7680622.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.65 59.78% 177093.38 153853 289544 177257.91 155135 219030 3125384 3125384 0.00
crit 11.86 40.18% 384003.64 320566 723945 383162.16 0 554631 4555238 4555238 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26573 8.7% 45.0 10.08sec 265753 248552 182004 392557 265751 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.05 45.05 0.00 0.00 1.0692 0.0000 11971275.06 11971275.06 0.00 248552.34 248552.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.05 60.05% 182004.22 135799 415972 181968.31 154282 216364 4923416 4923416 0.00
crit 17.95 39.86% 392556.58 282948 1040052 392648.25 293711 510046 7047859 7047859 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 19129 (28599) 6.3% (9.3%) 82.4 5.33sec 155790 112760 0 0 0 0.0% 0.1% 0.0% 0.0% 137.5 42063 92207 62445 40.6% 0.0% 18.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.42 82.42 137.55 137.55 1.3816 0.6009 8589136.42 8589136.42 0.00 112760.35 112760.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.34 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.08 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.6 59.35% 42062.66 35993 68540 42086.25 38704 47236 3433936 3433936 0.00
crit 55.9 40.65% 92207.05 74995 171371 92272.31 81687 111075 5155200 5155200 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9469 3.1% 60.1 7.08sec 70714 0 42239 112461 70732 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.11 60.10 0.00 0.00 0.0000 0.0000 4250771.46 4250771.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.62 59.28% 42238.94 35993 68540 42262.86 36860 49692 1504662 1504662 0.00
crit 24.42 40.63% 112461.26 90596 212503 112546.82 93447 150541 2746109 2746109 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 104 0.0% 0.9 145.69sec 51071 47603 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 23838 52942 35546 40.2% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.92 0.92 0.33 1.32 1.0732 0.5873 47079.83 47079.83 0.00 47603.47 47603.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.92 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.8 59.72% 23837.54 21183 38503 5196.67 0 38503 18857 18857 0.00
crit 0.5 40.25% 52941.99 44137 96270 10555.55 0 96270 28223 28223 0.00
miss 0.0 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 52 0.0% 0.6 33.18sec 39974 0 23850 64347 39984 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.58 0.58 0.00 0.00 0.0000 0.0000 23253.06 23253.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.35 60.08% 23849.80 21183 38503 4186.13 0 38503 8334 8334 0.00
crit 0.23 39.86% 64346.67 53319 119377 9091.86 0 119377 14919 14919 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (52) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 1.0823 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10613 3.5% 238.2 1.95sec 20061 0 20061 0 20061 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.18 238.18 0.00 0.00 0.0000 0.0000 4777954.89 4777954.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 238.18 100.00% 20060.82 7034 390587 20071.19 14882 27763 4777955 4777955 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:46236.34
  • base_dd_max:46236.34
power_infusion 0 0.0% 4.3 121.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 10045 3.3% 15.7 4.67sec 287534 268046 196156 423211 287538 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.72 15.72 0.00 0.00 1.0727 0.0000 4521132.56 4521132.56 0.00 268046.04 268046.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.37 59.62% 196155.63 152630 468649 196503.90 152630 308154 1838731 1838731 0.00
crit 6.34 40.31% 423210.94 318016 1171761 424094.13 0 887973 2682401 2682401 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41961 (92304) 13.8% (30.3%) 161.2 2.78sec 258022 241400 0 0 0 0.0% 0.1% 0.0% 0.0% 506.8 25360 55067 37307 40.2% 0.0% 143.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.17 161.17 506.75 506.75 1.0689 1.2776 18905560.31 18905560.31 0.00 50732.18 241400.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 161.05 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 303.0 59.78% 25360.39 21342 42660 25365.57 24003 27804 7683013 7683013 0.00
crit 203.8 40.22% 55066.88 44467 106663 55078.62 51325 61119 11222547 11222547 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20965 6.9% 221.4 2.01sec 42666 0 25760 67881 42701 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.36 221.18 0.00 0.00 0.0000 0.0000 9444365.91 9444365.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.90 59.63% 25760.46 22409 42660 25766.16 23939 28253 3397734 3397734 0.00
crit 89.08 40.27% 67881.49 56403 132264 67900.85 61775 77165 6046632 6046632 0.00
miss 0.20 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 29378 9.6% 292.9 1.52sec 45195 0 30877 67335 45650 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 292.86 289.95 0.00 0.00 0.0000 0.0000 13236101.64 13236101.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.46 59.48% 30876.94 26478 50863 30881.44 28875 34329 5324979 5324979 0.00
crit 117.49 40.52% 67334.58 55169 127172 67339.29 61352 77013 7911123 7911123 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1297 0.4% 3.0 91.51sec 191641 0 114966 289646 191635 44.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 574539.11 574539.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.68 55.94% 114965.54 83080 161028 95505.77 0 161028 192814 192814 0.00
crit 1.32 43.96% 289645.71 173104 402617 215794.72 0 402617 381725 381725 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:82400.40
  • base_dd_max:82400.40
vampiric_touch 23129 (34383) 7.6% (11.3%) 38.3 11.67sec 403376 327537 0 0 0 0.0% 0.1% 0.0% 0.0% 208.4 33683 73735 49928 40.6% 0.0% 85.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.35 38.35 208.40 208.40 1.2316 1.8516 10405257.02 10405257.02 0.00 35716.82 327536.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.33 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.9 59.44% 33683.23 27457 55792 33704.87 30853 38335 4172489 4172489 0.00
crit 84.5 40.56% 73734.94 57209 139496 73768.22 65833 85922 6232768 6232768 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11254 3.7% 91.0 4.85sec 55659 0 33438 88632 55700 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.98 90.92 0.00 0.00 0.0000 0.0000 5063984.20 5063984.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.11 59.52% 33437.95 28830 55792 33449.58 30284 37389 1809342 1809342 0.00
crit 36.72 40.39% 88632.20 72566 172978 88682.55 77321 106333 3254642 3254642 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 89980 / 23417
melee 89699 7.6% 113.2 3.88sec 92650 94787 64726 142484 92649 40.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.24 113.24 0.00 0.00 0.9775 0.0000 10491255.85 10491255.85 0.00 94787.37 94787.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.86 35.20% 64726.06 50679 105697 64845.87 56621 78881 2580135 2580135 0.00
crit 46.06 40.68% 142484.36 101359 253672 142421.91 116367 178915 6563333 6563333 0.00
glance 27.20 24.02% 49550.41 38010 79273 49572.64 41529 62799 1347788 1347788 0.00
dodge 0.06 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.48 23.48 0.00 0.00 1.0657 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 281 0.0% 4.2 77.38sec 7768 0 4912 11586 7769 42.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.18 0.00 0.00 0.0000 0.0000 32455.64 32455.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.38 57.05% 4912.33 3835 7078 4524.67 0 7078 11708 11708 0.00
crit 1.79 42.86% 11586.14 7669 16987 9745.90 0 16987 20748 20748 0.00
miss 0.00 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3803.10
  • base_dd_max:3803.10

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.83%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.0sec 26.0sec 28.66% 27.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 124.9sec 124.9sec 17.51% 17.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.51%

    Trigger Attempt Success

    • trigger_pct:99.88%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.59% 41.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.59%

    Trigger Attempt Success

    • trigger_pct:99.37%
power_infusion 4.3 0.0 121.3sec 121.3sec 18.54% 18.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.85% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.85%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.64%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.6sec 39.7sec 22.94% 43.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.94%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.5sec 55.3sec 17.60% 17.60%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.60%

    Trigger Attempt Success

    • trigger_pct:99.88%
mindbender-shadowcrawl 23.5 0.0 19.2sec 19.2sec 85.38% 75.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.09% 28.76%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.25% 16.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_PI
devouring_plague Shadow Orb 17.1 51.1 3.0 3.0 311578.0
halo Mana 10.5 402239.8 38155.8 38155.7 19.1
mind_blast Mana 45.0 389781.6 8652.8 8652.8 30.7
mind_flay Mana 82.4 236557.9 2870.3 2870.2 54.3
mind_sear Mana 0.9 8149.3 8840.3 8840.1 5.8
shadow_word_death Mana 15.7 118005.2 7504.2 7504.9 38.3
shadow_word_pain Mana 161.2 2042467.6 12672.5 12672.6 20.4
vampiric_touch Mana 38.3 331515.8 8644.8 8644.6 46.7
Resource Gains Type Count Total Average Overflow
mindbender Mana 113.13 560240.48 (21.74%) 4952.35 32325.54 5.46%
Shadow Orbs from Mind Blast Shadow Orb 45.00 44.54 (84.89%) 0.99 0.46 1.02%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.93 7.93 (15.11%) 1.00 0.00 0.00%
Devouring Plague Health Health 232.12 0.00 (0.00%) 0.00 4935909.45 100.00%
Vampiric Touch Mana Mana 299.32 1486278.19 (57.67%) 4965.55 36883.49 2.42%
halo_heal Health 10.54 0.00 (0.00%) 0.00 3640311.29 100.00%
external_healing Health 83.48 0.00 (0.00%) 0.00 29348933.96 100.00%
mp5_regen Mana 1801.83 530687.93 (20.59%) 294.53 9861.00 1.82%
pet - mindbender
external_healing Health 26.89 0.00 (0.00%) 0.00 9943686.40 100.00%
Resource RPS-Gain RPS-Loss
Mana 5719.73 7831.46
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -649987.32 -1135573.33 -174400.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.9%
shadowfiend-Mana Cap 1.9%
mindbender-Mana Cap 1.9%

Procs

Count Interval
Shadowy Recall Extra Tick 443.2 1.0sec
Shadowy Apparition Procced 292.9 1.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_PI Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Per Second
Count 24992
Mean 305257.71
Minimum 261891.11
Maximum 360095.34
Spread ( max - min ) 98204.23
Range [ ( max - min ) / 2 * 100% ] 16.09%
Standard Deviation 10862.7251
5th Percentile 287510.41
95th Percentile 323278.20
( 95th Percentile - 5th Percentile ) 35767.78
Mean Distribution
Standard Deviation 68.7129
95.00% Confidence Intervall ( 305123.04 - 305392.39 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4864
0.1 Scale Factor Error with Delta=300 1007305
0.05 Scale Factor Error with Delta=300 4029222
0.01 Scale Factor Error with Delta=300 100730559
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Damage per Second (effective)
Count 24992
Mean 305257.71
Minimum 261891.11
Maximum 360095.34
Spread ( max - min ) 98204.23
Range [ ( max - min ) / 2 * 100% ] 16.09%
Damage
Sample Data Priest_Shadow_T16H_MB_PI Damage
Count 24992
Mean 126887387.18
Minimum 90350005.94
Maximum 166858384.05
Spread ( max - min ) 76508378.11
Range [ ( max - min ) / 2 * 100% ] 30.15%
DTPS
Sample Data Priest_Shadow_T16H_MB_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.94 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 4.30 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.79 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.73 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 7.93 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.51 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.27 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 1.96 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.17 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.54 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.94 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.33 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.92 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 82.42 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 129.70 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9BHLMSZZZZccccHZOZccccHQZZZccccHMZZZccccHLLLMMSccHMQZZc9ccHZZZOccccHMZZZccccHQZZOLLLSHMMMMYNccHZZOZcccHQZZZc9BccHMZZZcccSHLLLMccccHMQZZccccHZZOccccHMZZZccccHQSOZL9LLHMMMYccccHMZZZccccHQZOccccHZZSZcccHLLLMMccccHQZZZc9BcHMZZZccccHZZZScccHMQZZLLLcHMMMOYcccHZZZccccHMQZZS9cHZZZOccccHLLLMMcccHQZZZcccHMZZZcScHZZOZcccHQZZZLL9BHLMMMMccccHZZZccSIFHMQZccIFHZZZccIFHLLLMQcIFHMZZccI9FHQS8OZccIFHZZZccIFOHQZZLIFLHLMMMLIF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MB_ToF : 308246 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
308246.0 308246.0 130.20 / 0.04% 17428 / 5.7% 35.1 8107.6 5682.7 Mana 0.09% 52.0 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Mindbender
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MB_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.98 5.97 0.00 5.38 5.26 4.47
Normalized 1.00 0.75 0.00 0.67 0.66 0.56
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.19 0.19 0.00 0.19 0.19 0.18
Gear Ranking
Optimizers
Ranking
  • Int > SP > Crit ~= Haste > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.98, SpellDamage=5.97, CritRating=5.38, HasteRating=5.26, MasteryRating=4.47 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MB_ToF": Intellect=7.98, SpellDamage=5.97, CritRating=5.38, HasteRating=5.26, MasteryRating=4.47 )

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:910362|730028|316983|302786|255930|241962|108275|38184&chds=0,1820723&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++910362++devouring_plague,9482C9,0,0,15|t++730028++halo,9482C9,1,0,15|t++316983++vampiric_touch,9482C9,2,0,15|t++302786++shadow_word_death,9482C9,3,0,15|t++255930++mind_blast,9482C9,4,0,15|t++241962++shadow_word_pain,9482C9,5,0,15|t++108275++mind_flay,9482C9,6,0,15|t++38184++mind_sear,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,10,10,9,8,8,7,6,6,6,4,4,4,4,3,3,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|mindbender: melee|vampiric_touch|shadow_word_pain_mastery|halo_damage|mind_flay|devouring_plague_tick|shadow_word_death|devouring_plague|vampiric_touch_mastery|multistrike_spell|mind_flay_mastery|devouring_plague_mastery|stormlash|mind_sear|mindbender: stormlash|mind_sear_mastery&
http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MB_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.98,5.97,5.38,5.26,4.47|7.79,5.79,5.20,5.08,4.29|8.17,6.16,5.57,5.45,4.66&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.98++Int,FFFFFF,0,0,15,0.1,e|t++++5.97++SP,FFFFFF,0,1,15,0.1,e|t++++5.38++Crit,FFFFFF,0,2,15,0.1,e|t++++5.26++Haste,FFFFFF,0,3,15,0.1,e|t++++4.47++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.586& http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:cehknqsvxz0100y1zyxvvvtsppnnnmmlllljiigglmnnonpopppqrrrrrrrqkjihghffeddcbaaaaZZaaaaeefghillllmmlkkjiihhdcbbbaYZZaaaccdeffghhijjjjjprstutuvvwwwwwvvvuutnkjhgfdcbaZYXXXXXXYYZZabcefghmnopqrrqqpoonnmlkjiiedccbaaaaaaaaaaaaaZZZcefgihiijkkllmmnnoooljiihhhhggfffeeefffggghllnnoqtttuuutssrqpoojihhgfddddddeffghhiijkkklkkopqrssssssssssrrqqppljhhffeeddcccccccddeffghijlnpsuvwyzz0000000zyyxwvtrrqpooonnnnnnoooooooqsvwyxyyzzz0000zzz00yvtsrrrrrrrqqqqrqqqpppprrssssttuuvvvvvvvvuusrrrqpoonnmmllmmnoopqrrsuvwxz14567787766544432210xvuvuusssssrrrrqqqppqtuttuwyz01121zwusqomhfc&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6370,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=308246|max=483939&chxp=1,1,64,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,11,11,21,27,67,67,120,201,243,337,395,561,726,876,1014,1178,1299,1498,1671,1620,1643,1622,1592,1349,1308,1050,899,821,679,489,412,314,251,192,127,101,78,49,29,14,10,2,6,6,1,3,0,1&chds=0,1671&chbh=5&chxt=x&chxl=0:|min=270049|avg=308246|max=355179&chxp=0,1,45,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MB_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.0,25.2,10.8,10.6,4.1,3.8,2.5,1.9,0.2,0.1&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 171.3s|mind_flay 113.3s|mind_blast 48.5s|vampiric_touch 47.5s|devouring_plague 18.4s|shadow_word_death 17.0s|halo 11.3s|mindbender 8.6s|mind_sear 1.1s|waiting 0.4s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MB_ToF 308246
devouring_plague 11118 (37113) 3.6% (12.1%) 17.0 26.06sec 982032 910362 202281 432720 294158 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 0.00 0.00 1.0788 0.0000 5010904.26 5010904.26 0.00 910361.59 910361.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 59.97% 202281.20 169721 353993 202272.04 171411 270703 2066507 2066507 0.00
crit 6.80 39.94% 432719.60 353627 885088 433022.52 0 721385 2944398 2944398 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8587 2.8% 70.0 6.09sec 55261 0 33879 87634 55349 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.05 69.94 0.00 0.00 0.0000 0.0000 3870924.88 3870924.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.91 59.93% 33879.41 28287 59000 33890.23 29792 39712 1419896 1419896 0.00
crit 27.97 39.99% 87633.88 71200 182923 87646.04 74513 114215 2451028 2451028 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17409 5.7% 17.0 26.06sec 460641 0 0 0 0 0.0% 0.0% 0.0% 0.0% 160.3 33673 71920 48966 40.0% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 160.25 160.25 0.0000 0.6527 7846975.52 7846975.52 0.00 75023.91 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.2 60.02% 33673.21 28287 117843 33683.46 30340 47523 3238527 3238527 0.00
crit 64.1 39.98% 71920.40 58939 245535 71919.00 62697 107851 4608448 4608448 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25597 8.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.5 26556 57740 39098 40.3% 0.1% 30.1%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.69 170.48 294.70 0.0000 0.7965 11522239.89 11522239.89 0.00 84854.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.9 59.68% 26555.89 21101 47031 26562.30 24029 30377 4670724 4670724 0.00
crit 118.7 40.27% 57739.91 43965 117592 57721.86 51059 68566 6851516 6851516 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (18306) 0.0% (5.9%) 10.5 44.77sec 786075 730028 0 0 0 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 10.47 0.00 0.00 1.0768 0.0000 0.00 0.00 0.00 730027.66 730027.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.24 59.62% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.22 40.28% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 18306 5.9% 10.5 44.77sec 786075 0 181822 394179 267540 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 30.77 0.00 0.00 0.0000 0.0000 8233251.97 8233251.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.34 59.58% 181821.64 153853 317120 181835.83 155502 223375 3333984 3333984 0.00
crit 12.43 40.39% 394178.59 320566 792892 393309.83 320566 554252 4899268 4899268 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27567 9.0% 45.0 10.08sec 275774 255930 188917 407289 275774 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.04 45.04 0.00 0.00 1.0775 0.0000 12419793.44 12419793.44 0.00 255930.46 255930.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.05 60.05% 188916.73 135799 455588 188902.41 155323 225279 5109422 5109422 0.00
crit 17.95 39.85% 407289.42 282948 1139104 407364.54 311474 542285 7310372 7310372 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18290 (27324) 5.9% (8.8%) 81.7 5.37sec 150259 108275 0 0 0 0.0% 0.1% 0.0% 0.0% 130.5 42594 92954 62956 40.4% 0.0% 18.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.67 81.67 130.48 130.48 1.3878 0.6284 8214715.01 8214715.01 0.00 108275.46 108275.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.60 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.7 59.57% 42593.82 35993 75068 42601.03 39364 48245 3310673 3310673 0.00
crit 52.8 40.43% 92954.21 74995 187692 92989.50 81930 114689 4904042 4904042 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9034 2.9% 57.0 7.44sec 71198 0 42789 113141 71218 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.98 56.96 0.00 0.00 0.0000 0.0000 4056792.56 4056792.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.86 59.44% 42788.67 35993 75068 42801.42 38006 49416 1448700 1448700 0.00
crit 23.05 40.47% 113140.73 90596 232742 113185.46 94806 147978 2608092 2608092 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 91 0.0% 1.0 150.00sec 40546 38184 0 0 0 0.0% 0.1% 0.0% 0.0% 0.3 24487 53321 35978 39.9% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.99 0.99 0.28 1.12 1.0621 0.6010 40208.24 40208.24 0.00 38184.47 38184.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.99 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.7 60.10% 24487.12 21183 42170 4951.86 0 42170 16445 16445 0.00
crit 0.4 39.88% 53320.73 44137 105439 9707.20 0 105439 23763 23763 0.00
miss 0.0 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 44 0.0% 0.5 38.17sec 40423 0 24498 64683 40418 39.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.49 0.49 0.00 0.00 0.0000 0.0000 19697.12 19697.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.29 60.28% 24498.40 21183 42170 3853.92 0 42170 7196 7196 0.00
crit 0.19 39.66% 64682.93 53319 130746 8082.18 0 130746 12501 12501 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (44) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mindbender 0 0.0% 7.9 60.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 1.0826 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${$m2/$m3}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
multistrike_spell 10792 3.5% 231.3 2.02sec 21008 0 21008 0 21008 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 231.32 231.32 0.00 0.00 0.0000 0.0000 4859507.06 4859507.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 231.32 100.00% 21008.29 7034 427786 21021.60 14480 28752 4859507 4859507 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:90736.54
  • base_dd_max:90736.54
shadow_word_death 11410 3.7% 15.7 4.68sec 327320 302786 223325 481260 327323 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.69 15.69 0.00 0.00 1.0811 0.0000 5135855.92 5135855.92 0.00 302785.99 302785.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.34 59.53% 223324.90 175524 513282 223660.43 175524 362116 2086020 2086020 0.00
crit 6.34 40.39% 481259.99 365719 1283357 482149.41 0 1069464 3049836 3049836 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41866 (92006) 13.6% (29.9%) 159.1 2.81sec 260449 241962 0 0 0 0.0% 0.1% 0.0% 0.0% 491.4 26153 56647 38384 40.1% 0.0% 143.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.15 159.15 491.40 491.40 1.0764 1.3146 18861806.76 18861806.76 0.00 50716.17 241961.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.03 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 294.3 59.89% 26153.10 21342 46723 26158.90 24743 28425 7696938 7696938 0.00
crit 197.1 40.11% 56646.52 44467 116821 56658.52 52926 62099 11164869 11164869 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add2
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20927 6.8% 214.7 2.08sec 43904 0 26588 69844 43939 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.73 214.56 0.00 0.00 0.0000 0.0000 9427309.08 9427309.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.18 59.74% 26588.47 22409 46723 26594.99 24507 30226 3408111 3408111 0.00
crit 86.18 40.17% 69843.83 56403 144860 69863.25 63535 78735 6019198 6019198 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowy_apparition 29213 9.5% 283.3 1.57sec 46462 0 31817 69171 46922 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 283.27 280.49 0.00 0.00 0.0000 0.0000 13161310.95 13161310.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.07 59.56% 31817.02 26478 55707 31821.74 29553 35204 5315610 5315610 0.00
crit 113.43 40.44% 69171.08 55169 139283 69175.50 63165 78602 7845700 7845700 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1219 0.4% 2.9 94.29sec 186264 0 113241 280855 186268 43.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 2.89 0.00 0.00 0.0000 0.0000 538883.96 538883.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.63 56.27% 113240.63 83080 166781 92776.68 0 166781 184353 184353 0.00
crit 1.26 43.63% 280854.94 173104 383445 204848.55 0 383445 354531 354531 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22472 (33485) 7.3% (10.9%) 38.5 11.62sec 391341 316983 0 0 0 0.0% 0.1% 0.0% 0.0% 199.6 34365 74747 50673 40.4% 0.0% 85.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.50 38.50 199.57 199.57 1.2346 1.9346 10112464.51 10112464.51 0.00 34751.13 316983.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.48 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.0 59.62% 34364.96 27457 61105 34382.60 31537 39417 4088510 4088510 0.00
crit 80.6 40.38% 74746.95 57209 152782 74769.96 66727 87348 6023955 6023955 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 11013 3.6% 87.2 5.07sec 56855 0 34339 90478 56894 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.17 87.11 0.00 0.00 0.0000 0.0000 4955972.96 4955972.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.98 59.68% 34338.61 28830 61105 34352.14 30982 38557 1785074 1785074 0.00
crit 35.05 40.23% 90477.62 72566 189452 90518.15 78651 109398 3170899 3170899 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - mindbender 89503 / 23292
melee 89222 7.5% 113.2 3.88sec 92144 94271 64442 141807 92143 40.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.23 113.23 0.00 0.00 0.9775 0.0000 10433123.12 10433123.12 0.00 94270.67 94270.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.04 35.36% 64442.22 50679 105697 64556.83 56109 81465 2580384 2580384 0.00
crit 45.94 40.57% 141807.36 101359 253672 141761.21 118637 182495 6514012 6514012 0.00
glance 27.14 23.97% 49320.54 38010 79273 49351.51 41416 63851 1338727 1338727 0.00
dodge 0.06 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.880000
  • base_dd_min:1846.82
  • base_dd_max:1846.82
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.48 23.48 0.00 0.00 1.0780 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 281 0.0% 4.2 78.15sec 7770 0 4918 11575 7770 42.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.17 4.17 0.00 0.00 0.0000 0.0000 32431.25 32431.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.38 57.01% 4918.35 3835 7078 4524.35 0 7078 11704 11704 0.00
crit 1.79 42.90% 11575.48 7669 16987 9786.12 0 16987 20727 20727 0.00
miss 0.00 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3651.90
  • base_dd_max:3651.90

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.0sec 26.0sec 28.74% 27.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.7sec 125.7sec 17.38% 17.38%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.38%

    Trigger Attempt Success

    • trigger_pct:99.87%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.5sec 23.5sec 41.57% 41.57%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.57%

    Trigger Attempt Success

    • trigger_pct:99.40%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.81% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.81%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.27%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.6sec 39.6sec 22.95% 53.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.95%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.6sec 55.3sec 17.59% 17.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.59%

    Trigger Attempt Success

    • trigger_pct:99.89%
twist_of_fate 1.0 342.4 0.0sec 0.4sec 32.03% 32.03%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-shadowcrawl 23.5 0.0 19.2sec 19.2sec 85.38% 75.72%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 3.0 0.0 180.0sec 180.0sec 24.10% 28.89%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:24.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 2.0 0.0 300.0sec 300.0sec 16.25% 16.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MB_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MB_ToF
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 327523.1
halo Mana 10.5 424185.7 40500.0 40499.4 19.4
mind_blast Mana 45.0 405324.7 9000.0 9000.0 30.6
mind_flay Mana 81.7 245004.2 3000.0 3000.0 50.1
mind_sear Mana 1.0 8924.0 9000.0 8998.9 4.5
shadow_word_death Mana 15.7 122397.6 7800.0 7800.7 42.0
shadow_word_pain Mana 159.1 2100763.1 13200.0 13199.9 19.7
vampiric_touch Mana 38.5 346538.9 9000.0 8999.9 43.5
Resource Gains Type Count Total Average Overflow
mindbender Mana 113.12 571444.59 (22.32%) 5051.62 21094.82 3.56%
Shadow Orbs from Mind Blast Shadow Orb 44.99 44.52 (84.90%) 0.99 0.48 1.06%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.92 7.92 (15.10%) 1.00 0.00 0.00%
Devouring Plague Health Health 230.19 0.00 (0.00%) 0.00 4894924.58 100.00%
Vampiric Touch Mana Mana 286.67 1452250.49 (56.72%) 5065.88 6462.55 0.44%
halo_heal Health 10.47 0.00 (0.00%) 0.00 3780999.84 100.00%
external_healing Health 83.55 0.00 (0.00%) 0.00 29193348.99 100.00%
mp5_regen Mana 1801.83 536814.27 (20.97%) 297.93 3734.66 0.69%
pet - mindbender
external_healing Health 26.90 0.00 (0.00%) 0.00 9938848.50 100.00%
Resource RPS-Gain RPS-Loss
Mana 5682.67 8107.60
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -794193.01 -1396633.33 -310571.43
Shadow Orb 1.37 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%
shadowfiend-Mana Cap 0.7%
mindbender-Mana Cap 0.7%

Procs

Count Interval
Shadowy Recall Extra Tick 429.1 1.0sec
Shadowy Apparition Procced 283.3 1.6sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MB_ToF Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Per Second
Count 24992
Mean 308245.98
Minimum 270048.96
Maximum 355179.11
Spread ( max - min ) 85130.15
Range [ ( max - min ) / 2 * 100% ] 13.81%
Standard Deviation 10501.7055
5th Percentile 291108.67
95th Percentile 325965.61
( 95th Percentile - 5th Percentile ) 34856.94
Mean Distribution
Standard Deviation 66.4292
95.00% Confidence Intervall ( 308115.78 - 308376.18 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4458
0.1 Scale Factor Error with Delta=300 941463
0.05 Scale Factor Error with Delta=300 3765852
0.01 Scale Factor Error with Delta=300 94146317
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Damage per Second (effective)
Count 24992
Mean 308245.98
Minimum 270048.96
Maximum 355179.11
Spread ( max - min ) 85130.15
Range [ ( max - min ) / 2 * 100% ] 13.81%
Damage
Sample Data Priest_Shadow_T16H_MB_ToF Damage
Count 24992
Mean 128288614.08
Minimum 92722301.16
Maximum 170117943.51
Spread ( max - min ) 77395642.35
Range [ ( max - min ) / 2 * 100% ] 30.16%
DTPS
Sample Data Priest_Shadow_T16H_MB_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MB_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MB_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MB_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MB_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.94 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.78 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.71 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.14 mind_blast,if=active_enemies<=5&cooldown_react
I 7.92 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 0.00 mind_flay_insanity,interrupt=1,chain=1
L 29.51 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 36.92 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 1.83 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 12.71 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.33 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.47 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 1.03 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.67 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.99 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 81.67 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 127.81 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

9HLMSZZZZcccHZZOZccccHQZZZccccHMZZZccccHLLLMScccHMQZZ9cccHZZOccccHMZZZccccHQZOZLLLHMMMSYcccHMZZZcccHQZOZ9ccHZZZccccHLLLMScccHMQZZccccHZZZOcccHMZZZcccHQZOZL9LLHMMMSccccHMZZccccHQZZOcccHMZZZcccHLLLMMSccHMQZZcc9cHZZOZcccHZZZZcccHMQZZLLLSHMMMOccccHMZZZccccHQZOccc9HMZZccccHLLLMMSccHMQZZccccHZZOccccHMZZccccHQZZLLLS9HMMMccccWHZZZcccIFHMQZcccIFHZZcccIFHLLLMQSIFHMZZccIF9HQZ8OcIFMHZZZcIFQHZOZZIFLHLLMLGIFS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MB_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_DI : 299007 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
299007.2 299007.2 136.32 / 0.05% 17974 / 6.0% 40.8 7097.8 4701.6 Mana 0.29% 51.9 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Divine Insight
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_DI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.79 5.77 0.00 5.16 5.13 4.89
Normalized 1.00 0.74 0.00 0.66 0.66 0.63
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.19 0.19 0.00 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Int > SP > Crit ~= Haste > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.79, SpellDamage=5.77, CritRating=5.16, HasteRating=5.13, MasteryRating=4.89 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_DI": Intellect=7.79, SpellDamage=5.77, CritRating=5.16, HasteRating=5.13, MasteryRating=4.89 )

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:879937|525263|336139|264931|245169|238402|201745|110820|70475&chds=0,1759875&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++879937++devouring_plague,9482C9,0,0,15|t++525263++halo,9482C9,1,0,15|t++336139++vampiric_touch,9482C9,2,0,15|t++264931++shadow_word_death,9482C9,3,0,15|t++245169++shadow_word_pain,9482C9,4,0,15|t++238402++mind_blast,9482C9,5,0,15|t++201745++mind_flay_insanity,9482C9,6,0,15|t++110820++mind_flay,9482C9,7,0,15|t++70475++mind_sear,9482C9,8,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:13,11,9,8,7,7,6,6,5,4,4,4,3,3,3,3,3,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,336600&chl=shadow_word_pain|mind_blast|shadowy_apparition|essence_of_yulon|devouring_plague_tick|vampiric_touch|shadow_word_pain_mastery|mind_flay_insanity|halo_damage|devouring_plague|mind_flay|multistrike_spell|devouring_plague_mastery|shadow_word_death|vampiric_touch_mastery|shadowfiend: melee|mind_flay_insanity_mastery|mind_flay_mastery|stormlash|mind_sear|mind_sear_mastery|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_DI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.79,5.77,5.16,5.13,4.89|7.60,5.58,4.96,4.94,4.70|7.99,5.96,5.35,5.33,5.08&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.79++Int,FFFFFF,0,0,15,0.1,e|t++++5.77++SP,FFFFFF,0,1,15,0.1,e|t++++5.16++Crit,FFFFFF,0,2,15,0.1,e|t++++5.13++Haste,FFFFFF,0,3,15,0.1,e|t++++4.89++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.360& http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gikmptvy2467786764310zzyxvutsrqppoonmmlkmprtuuvuuuutttsrrqppmjgedccbbbcccccccccccccefgghijkllmmmmnnnnmmkjiihgfeddcccccccddddeffgghknqtvvwxxyyyyyyxxwwwtqnkihggfffeeeeeedddddeefghjknpqrsstttttttsrqponligfedcccccccccccccccdegjlnnnooooooooooooomkifeeeeeeefffffggggghhjllmnoqrrstttttttsssponnmkihggfeeeeeeeeeeeeffffhjlnopppppppppppppoonljhfffeeeeeeeeffffffffgijkmnqsuvwxyyzzzz0zzyxwvusqonmmllllllllllmmmmnopruvvwwwwwwwwwwvvvutspnmlllkkkkkkkkkkkkkkklmmnnopqqrssssssssssrqqqpponmmllllllmmmmmmmnnoopqsvwxxyyzzzz000000zzywussssrrrrqqqqqppppoppqrrrstuvwwxxvsqomkigeb&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6483,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=299007|max=461196&chxp=1,1,65,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,3,4,15,19,38,57,98,126,193,276,388,535,721,855,1100,1228,1406,1463,1637,1643,1700,1635,1574,1501,1225,1128,955,732,692,510,422,306,207,176,147,85,69,43,24,19,11,9,5,6,1,1,1,2&chds=0,1700&chbh=5&chxt=x&chxl=0:|min=257556|avg=299007|max=349477&chxp=0,1,45,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_DI Spent Time&chts=dddddd,18&chs=550x275&chd=t:33.7,16.7,13.5,12.5,8.8,4.8,3.7,2.5,0.7,0.1,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 152.0s|mind_flay 75.4s|mind_blast 60.7s|mind_flay_insanity 56.4s|vampiric_touch 39.6s|devouring_plague 21.8s|shadow_word_death 16.7s|halo 11.2s|shadowfiend 3.3s|mind_sear 0.4s|waiting 1.3s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_DI 299007
devouring_plague 12635 (42526) 4.2% (14.2%) 20.2 21.95sec 948403 879937 192108 416634 281829 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.20 0.00 0.00 1.0778 0.0000 5694370.64 5694370.64 0.00 879937.27 879937.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.10 59.89% 192108.24 169721 307820 192119.15 169721 234372 2324543 2324543 0.00
crit 8.09 40.03% 416634.20 353627 769642 416812.25 0 752750 3369828 3369828 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 9840 3.3% 83.6 5.12sec 53049 0 32227 84204 53121 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.57 83.45 0.00 0.00 0.0000 0.0000 4433156.70 4433156.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.79 59.66% 32226.53 28287 51304 32235.71 29012 37332 1604414 1604414 0.00
crit 33.59 40.25% 84203.66 71200 159064 84203.08 72274 105001 2828743 2828743 0.00
miss 0.07 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 20051 6.7% 20.2 21.95sec 447162 0 0 0 0 0.0% 0.0% 0.0% 0.0% 191.6 32179 69435 47159 40.2% 0.0% 27.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.20 191.58 191.58 0.0000 0.6491 9034866.56 9034866.56 0.00 72654.99 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.5 59.79% 32178.63 28287 133953 32187.42 29124 89886 3685915 3685915 0.00
crit 77.0 40.21% 69435.22 58939 290491 69419.33 60904 193149 5348951 5348951 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 23770 8.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 167.3 25405 55235 37431 40.4% 0.1% 29.5%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.21 167.29 286.02 0.0000 0.7955 10706019.64 10706019.64 0.00 80452.23 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 170.4 59.59% 25405.18 21101 40897 25413.59 22955 28676 4329667 4329667 0.00
crit 115.4 40.36% 55234.91 43965 102254 55225.69 48714 64391 6376353 6376353 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (13048) 0.0% (4.4%) 10.4 45.06sec 565490 525263 0 0 0 40.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 1.0766 0.0000 0.00 0.00 0.00 525263.36 525263.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.16 59.32% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.22 40.58% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 13048 4.4% 10.4 45.06sec 565490 0 176375 381813 259046 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 22.67 0.00 0.00 0.0000 0.0000 5873494.90 5873494.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.53 59.67% 176375.24 153853 275756 176804.06 154952 239036 2386291 2386291 0.00
crit 9.13 40.28% 381813.31 320566 689472 381689.22 0 546343 3487204 3487204 0.00
miss 0.01 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 32130 10.8% 55.3 8.16sec 261715 238402 178933 386447 261714 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.29 55.29 0.00 0.00 1.0978 0.0000 14471243.16 14471243.16 0.00 238402.06 238402.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.14 59.94% 178933.17 135799 396163 178901.91 147323 210508 5930066 5930066 0.00
crit 22.10 39.97% 386447.18 282948 990526 386509.35 311361 479983 8541177 8541177 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 12448 (18589) 4.2% (6.2%) 53.2 8.04sec 156965 110820 0 0 0 0.0% 0.1% 0.0% 0.0% 90.7 41435 91377 61702 40.6% 0.0% 12.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.22 53.22 90.67 90.67 1.4164 0.6250 5594253.45 5594253.45 0.00 110820.33 110820.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.17 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.9 59.42% 41435.32 35993 65277 41464.39 36885 48703 2232278 2232278 0.00
crit 36.8 40.58% 91376.77 74995 163211 91431.32 77274 112768 3361976 3361976 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 17492 (25259) 5.9% (8.5%) 38.5 11.15sec 295592 201745 0 0 0 0.0% 0.1% 0.0% 0.0% 65.8 81891 175812 119721 40.3% 0.0% 9.5%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.50 38.50 65.82 65.82 1.4652 0.6477 7879652.08 7879652.08 0.00 201745.02 201745.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.46 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.3 59.72% 81891.04 71987 130553 81909.09 72942 98407 3218936 3218936 0.00
crit 26.5 40.28% 175812.47 149990 326421 175736.79 151184 222048 4660716 4660716 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 7767 2.6% 28.7 14.62sec 121814 0 74340 193171 121960 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.73 28.69 0.00 0.00 0.0000 0.0000 3499170.57 3499170.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.15 59.77% 74340.46 35993 130553 74382.14 48346 103893 1274831 1274831 0.00
crit 11.51 40.13% 193171.39 90596 404768 193106.87 0 280296 2224340 2224340 0.00
miss 0.03 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6140 2.1% 39.6 10.54sec 69736 0 41517 111088 69758 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.57 39.56 0.00 0.00 0.0000 0.0000 2759604.70 2759604.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.44 59.25% 41516.75 35993 65277 41546.17 36214 52140 973143 973143 0.00
crit 16.08 40.65% 111088.32 90596 202384 111153.24 90596 167696 1786461 1786461 0.00
miss 0.04 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 63 0.0% 0.4 128.02sec 78911 70475 0 0 0 0.0% 0.1% 0.0% 0.0% 0.2 23839 52090 35078 39.8% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.36 0.36 0.20 0.80 1.1215 0.6227 28189.84 28189.84 0.00 70474.61 70474.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.36 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.5 60.17% 23839.43 21183 36670 3058.71 0 36670 11528 11528 0.00
crit 0.3 39.80% 52089.71 44137 91686 6160.79 0 91686 16662 16662 0.00
miss 0.0 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 31 0.0% 0.3 23.10sec 39700 0 23834 63215 39699 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.35 0.35 0.00 0.00 0.0000 0.0000 13859.91 13859.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.21 59.60% 23833.92 21183 36670 2485.12 0 36670 4959 4959 0.00
crit 0.14 40.33% 63214.99 53319 113692 5403.09 0 113692 8901 8901 0.00
miss 0.00 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (31) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 11077 3.7% 232.8 1.99sec 21420 0 21420 0 21420 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 232.85 232.85 0.00 0.00 0.0000 0.0000 4987653.62 4987653.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 232.85 100.00% 21420.38 7034 371987 21432.27 15815 31608 4987654 4987654 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:31017.15
  • base_dd_max:31017.15
shadow_word_death 9802 3.3% 15.4 4.75sec 286378 264931 195398 421423 286377 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.42 15.42 0.00 0.00 1.0810 0.0000 4416663.80 4416663.80 0.00 264930.95 264930.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.19 59.61% 195397.56 152630 446332 195631.62 152630 309806 1796280 1796280 0.00
crit 6.22 40.32% 421423.07 318016 1115962 422203.92 0 880032 2620383 2620383 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 37650 (82708) 12.6% (27.7%) 141.2 3.17sec 263952 245169 0 0 0 0.0% 0.1% 0.0% 0.0% 462.6 24980 54117 36663 40.1% 0.0% 138.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.16 141.16 462.61 462.61 1.0766 1.3490 16960875.73 16960875.73 0.00 48010.78 245169.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.06 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 277.1 59.90% 24979.52 21342 40629 24985.95 23523 27180 6922160 6922160 0.00
crit 185.5 40.10% 54117.11 44467 101583 54130.49 50402 60707 10038715 10038715 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add3
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 18796 6.3% 202.2 2.20sec 41884 0 25365 66670 41915 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 202.16 202.01 0.00 0.00 0.0000 0.0000 8467315.87 8467315.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.77 59.78% 25365.48 22409 40629 25371.90 23713 28037 3063393 3063393 0.00
crit 81.05 40.12% 66670.30 56403 125965 66693.48 60763 75489 5403923 5403923 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0852 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 26262 8.8% 266.5 1.67sec 44387 0 30372 66074 44799 40.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 266.55 264.09 0.00 0.00 0.0000 0.0000 11831147.76 11831147.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.37 59.59% 30371.55 26478 48441 30377.01 28218 33449 4779593 4779593 0.00
crit 106.72 40.41% 66074.36 55169 121116 66082.53 60123 76028 7051555 7051555 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1247 0.4% 3.0 90.95sec 182010 0 110266 275487 182020 43.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 3.04 0.00 0.00 0.0000 0.0000 552540.27 552540.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.71 56.40% 110265.79 83080 153360 91924.45 0 153360 188803 188803 0.00
crit 1.32 43.49% 275486.53 173104 383445 205186.26 0 383445 363737 363737 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:146057.40
  • base_dd_max:146057.40
vampiric_touch 19837 (29545) 6.6% (9.9%) 33.1 13.53sec 401411 336139 0 0 0 0.0% 0.1% 0.0% 0.0% 183.3 32992 71911 48704 40.4% 0.0% 78.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.12 33.12 183.30 183.30 1.1942 1.9264 8927560.09 8927560.09 0.00 33862.43 336139.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.10 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.3 59.63% 32992.18 27457 53135 33008.77 29890 37325 3606032 3606032 0.00
crit 74.0 40.37% 71910.55 57209 132854 71924.81 64157 83788 5321528 5321528 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 9709 3.2% 80.1 5.50sec 54565 0 32896 86902 54603 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.07 80.02 0.00 0.00 0.0000 0.0000 4369099.49 4369099.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.74 59.66% 32896.25 28830 53135 32906.65 29819 37527 1570346 1570346 0.00
crit 32.21 40.25% 86902.23 72566 164741 86936.14 74194 102838 2798754 2798754 0.00
miss 0.07 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115410 / 9212
melee 115022 3.0% 35.6 11.07sec 114874 122893 76414 179057 114874 41.6% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.56 35.56 0.00 0.00 0.9348 0.0000 4084960.14 4084960.14 0.00 122892.90 122892.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.21 34.32% 76414.06 57590 120110 76609.83 60470 111435 932652 932652 0.00
crit 14.80 41.63% 179056.63 115181 288264 178655.62 131334 250271 2650835 2650835 0.00
glance 8.52 23.95% 58888.25 43193 90083 58924.36 0 90083 501473 501473 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0757 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 388 0.0% 1.4 1.75sec 9838 0 5833 14353 9839 47.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.40 0.00 0.00 0.0000 0.0000 13725.15 13725.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 52.76% 5833.41 4377 7078 3158.42 0 7078 4294 4294 0.00
crit 0.66 47.10% 14352.62 10506 16987 7163.72 0 16987 9431 9431 0.00
miss 0.00 0.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.53%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 30.1 3.1 14.4sec 13.0sec 9.33% 51.97%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.33%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s3=100}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a {$s4=5}% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
empowered_shadows 20.2 0.0 22.0sec 22.0sec 25.76% 27.17%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:25.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.2sec 125.2sec 17.47% 17.47%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.47%

    Trigger Attempt Success

    • trigger_pct:99.89%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.58% 41.58%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.58%

    Trigger Attempt Success

    • trigger_pct:99.43%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.0sec 10.0sec 14.58% 49.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.58%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.74%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.5sec 39.7sec 22.97% 53.00%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.97%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 7.9 0.0 56.5sec 56.4sec 17.30% 17.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.30%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.20%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 52.97% 56.96%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_DI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_DI
devouring_plague Shadow Orb 20.2 60.6 3.0 3.0 316304.2
halo Mana 10.4 420655.7 40500.0 40500.0 14.0
mind_blast Mana 55.3 217416.6 3932.0 3932.0 66.6
mind_flay Mana 53.2 159664.9 3000.0 3000.0 52.3
mind_flay_insanity Mana 38.5 115488.4 3000.0 3000.1 98.5
mind_sear Mana 0.4 3215.5 9000.0 9001.2 8.8
shadow_word_death Mana 15.4 120303.8 7800.0 7800.5 36.7
shadow_word_pain Mana 141.2 1863260.3 13200.0 13199.7 20.0
vampiric_touch Mana 33.1 298121.0 9000.0 8999.9 44.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.53 264556.63 (12.49%) 7446.92 55174.13 17.26%
Shadow Orbs from Mind Blast Shadow Orb 55.24 54.24 (87.46%) 0.98 1.00 1.81%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.78 7.78 (12.54%) 1.00 0.00 0.00%
Devouring Plague Health Health 275.04 0.00 (0.00%) 0.00 5848450.31 100.00%
Vampiric Touch Mana Mana 263.32 1320390.97 (62.33%) 5014.47 19462.07 1.45%
halo_heal Health 10.39 0.00 (0.00%) 0.00 3588381.97 100.00%
external_healing Health 83.64 0.00 (0.00%) 0.00 29402743.76 100.00%
mp5_regen Mana 1801.83 533499.72 (25.18%) 296.09 7049.21 1.30%
pet - shadowfiend
external_healing Health 21.19 0.00 (0.00%) 0.00 7910547.04 100.00%
Resource RPS-Gain RPS-Loss
Mana 4701.58 7097.77
Shadow Orb 0.14 0.13
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -782469.14 -1373700.00 -204600.00
Shadow Orb 1.46 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%
shadowfiend-Mana Cap 1.3%
mindbender-Mana Cap 1.3%

Procs

Count Interval
Shadowy Recall Extra Tick 434.1 1.0sec
Shadowy Apparition Procced 266.6 1.7sec
Divine Insight Mind Blast CD Reset 56.3 13.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_DI Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Per Second
Count 24992
Mean 299007.21
Minimum 257555.70
Maximum 349476.79
Spread ( max - min ) 91921.09
Range [ ( max - min ) / 2 * 100% ] 15.37%
Standard Deviation 10995.8180
5th Percentile 281624.10
95th Percentile 317572.08
( 95th Percentile - 5th Percentile ) 35947.98
Mean Distribution
Standard Deviation 69.5548
95.00% Confidence Intervall ( 298870.88 - 299143.53 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5195
0.1 Scale Factor Error with Delta=300 1032140
0.05 Scale Factor Error with Delta=300 4128561
0.01 Scale Factor Error with Delta=300 103214033
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Damage per Second (effective)
Count 24992
Mean 299007.21
Minimum 257555.70
Maximum 349476.79
Spread ( max - min ) 91921.09
Range [ ( max - min ) / 2 * 100% ] 15.37%
Damage
Sample Data Priest_Shadow_T16H_MFI_DI Damage
Count 24992
Mean 130500738.78
Minimum 94275517.28
Maximum 172107402.21
Spread ( max - min ) 77831884.93
Range [ ( max - min ) / 2 * 100% ] 29.82%
DTPS
Sample Data Priest_Shadow_T16H_MFI_DI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_DI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_DI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_DI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_DI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.65 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 3.76 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 57.46 mind_blast,if=active_enemies<=5&cooldown_react
I 7.78 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 3.38 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 35.11 mind_flay_insanity,interrupt=1,chain=1
L 29.54 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 32.61 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 3.22 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 8.11 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 16.45 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.39 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.46 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 8.02 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.36 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 53.22 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 108.39 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLHMSZZZccccHQKKKccccHMZZZccccHZZZOcccHLGHKLLSHMZZZNcccHQKKcHccMZZWHccccZZHOLLLSMMMHGHcccKZOHcHcHQKKKccccHMZZZcccSHLLLMcccHMQKKKcHcZZOZccccHZZZccccHMQHKKALLLMHMMMNScMWHQKKcccHZZOZccccHZZHQcccKJHLLLSMZZHZcccZZHOQcccKJHZccccMWHZZLLHLMMMGHKHNSMZZZWHQcccKZOHZcccZZZHZcccMLHLLMQccHKJOSccccHZZZccHQKHKKMHccMZZWHLALLMMMHOQSNcKHZZccHIFMQKKccIFHZZOcHGIFKKJLLLIFHMQKHLSIFZZ8HOGcHIFKMZcccIFHQKKLLIFHLMMMNcI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_DI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_PI : 302021 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
302021.0 302021.0 124.01 / 0.04% 16444 / 5.4% 37.3 7851.7 4946.7 Mana 0.04% 52.6 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Power Infusion
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_PI Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.77 5.74 0.00 5.33 4.77 4.57
Normalized 1.00 0.74 0.00 0.69 0.61 0.59
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.18 0.18 0.00 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > SP > Crit > Haste > Mastery
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.77, SpellDamage=5.74, CritRating=5.33, HasteRating=4.77, MasteryRating=4.57 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_PI": Intellect=7.77, SpellDamage=5.74, CritRating=5.33, HasteRating=4.77, MasteryRating=4.57 )

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:867221|732764|327924|268346|248184|238386|189106|122721|29900&chds=0,1734442&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++867221++devouring_plague,9482C9,0,0,15|t++732764++halo,9482C9,1,0,15|t++327924++vampiric_touch,9482C9,2,0,15|t++268346++shadow_word_death,9482C9,3,0,15|t++248184++mind_blast,9482C9,4,0,15|t++238386++shadow_word_pain,9482C9,5,0,15|t++189106++mind_flay_insanity,9482C9,6,0,15|t++122721++mind_flay,9482C9,7,0,15|t++29900++mind_sear,9482C9,8,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,9,8,7,6,6,5,4,4,4,4,3,3,3,2,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,336600,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|vampiric_touch|shadow_word_pain_mastery|halo_damage|devouring_plague_tick|mind_flay|mind_flay_insanity|multistrike_spell|vampiric_touch_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|devouring_plague_mastery|mind_flay_mastery|mind_flay_insanity_mastery|stormlash|mind_sear|shadowfiend: stormlash|mind_sear_mastery&
http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_PI%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.77,5.74,5.33,4.77,4.57|7.59,5.56,5.15,4.59,4.39|7.95,5.91,5.50,4.94,4.74&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.77++Int,FFFFFF,0,0,15,0.1,e|t++++5.74++SP,FFFFFF,0,1,15,0.1,e|t++++5.33++Crit,FFFFFF,0,2,15,0.1,e|t++++4.77++Haste,FFFFFF,0,3,15,0.1,e|t++++4.57++Mastery,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.334& http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:jmnpquy14687775754421000zyvutssrqqponljhmnnopoqpqrsssssrrqppigfdccbaZYXWWVVWWXYaabbghijjknnnooonmmkjihhdcbbccbbccccddeeffgghhiijiioqsuvvxyz1223332110zspnljigfdbZZYXXXXYZbbcdefhijloqrsttsrrponmlkjihhhedcccbcccccccccccccaZcfhhjijklnnopppqqqqqnkihggffeeddcdcdeeghijkpqssttvwwwwwvutrponmhgfeffdeeeddeeeeeeeeffeeedcghijlkllmnoopppppoookigfeeddcbaaZZZaabbdddefhjlnptvxz011222122110yyxwsrponnnmmmmllllllllkkmoqsttttuvvvvwwvvvuuspnljjjiihhhgggghhhhiiillmmnnoppqqrrrrrqqqqonmmmmllkkjjjjjkllmmmnopqrrtwy12445554443322111zxvsrqqppooonnnmmmlllllmnoopqsuvvvwusqnlkigecY&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6376,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=302021|max=473700&chxp=1,1,64,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,1,6,10,16,23,65,66,117,155,236,386,460,618,807,1018,1159,1303,1480,1566,1593,1717,1689,1539,1483,1360,1170,962,864,675,549,493,375,285,199,149,118,80,70,47,33,19,9,8,5,1,2,3,1&chds=0,1717&chbh=5&chxt=x&chxl=0:|min=264088|avg=302021|max=346504&chxp=0,1,46,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_PI Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.6,16.5,10.7,10.2,10.2,4.1,3.7,2.4,0.7,0.1,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 173.7s|mind_flay 74.6s|mind_blast 48.2s|mind_flay_insanity 46.0s|vampiric_touch 45.8s|devouring_plague 18.3s|shadow_word_death 16.8s|halo 11.0s|shadowfiend 3.3s|mind_sear 0.6s|waiting 0.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_PI 302021
devouring_plague 10493 (35254) 3.5% (11.7%) 17.0 26.06sec 933185 867221 190976 408517 277733 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 0.00 0.00 1.0761 0.0000 4729347.40 4729347.40 0.00 867221.10 867221.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.21 59.95% 190976.07 169721 323211 190954.98 169721 242756 1949482 1949482 0.00
crit 6.80 39.96% 408517.02 353627 808124 408904.81 0 790387 2779866 2779866 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8162 2.7% 70.4 6.04sec 52232 0 32010 82770 52318 40.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.43 70.32 0.00 0.00 0.0000 0.0000 3678965.06 3678965.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.09 59.86% 32009.66 28287 53869 32020.70 28606 37434 1347315 1347315 0.00
crit 28.17 40.06% 82769.66 71200 167017 82784.21 71909 105066 2331651 2331651 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 16598 5.5% 17.0 26.06sec 439413 0 0 0 0 0.0% 0.0% 0.0% 0.0% 161.4 31871 68134 46370 40.0% 0.0% 23.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 17.03 161.37 161.37 0.0000 0.6457 7482646.97 7482646.97 0.00 71811.12 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.8 60.02% 31871.28 28287 171555 31885.71 28774 43526 3086685 3086685 0.00
crit 64.5 39.98% 68134.37 58939 407060 68136.66 59765 100742 4395962 4395962 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25746 8.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 175.6 25680 55973 37885 40.3% 0.1% 31.0%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 35.76 175.57 306.16 0.0000 0.7963 11598976.19 11598976.19 0.00 82960.05 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.5 59.61% 25680.44 21101 42942 25688.94 23061 29463 4687088 4687088 0.00
crit 123.5 40.33% 55973.03 43965 107367 55964.50 49654 65975 6911888 6911888 0.00
miss 0.2 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (17847) 0.0% (5.9%) 10.3 45.53sec 782338 732764 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 0.00 0.00 1.0677 0.0000 0.00 0.00 0.00 732763.69 732763.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.12 59.43% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.17 40.48% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 17847 5.9% 10.3 45.53sec 782338 0 176729 384678 260284 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 30.93 0.00 0.00 0.0000 0.0000 8050141.89 8050141.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.48 59.76% 176728.59 153853 289544 176782.73 155480 218986 3266313 3266313 0.00
crit 12.44 40.21% 384677.80 320566 723945 384006.92 320566 506227 4783829 4783829 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 26554 8.8% 45.1 10.08sec 265512 248184 182070 392142 265511 39.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 1.0698 0.0000 11963213.54 11963213.54 0.00 248184.00 248184.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.09 60.11% 182070.46 135799 415972 182051.09 154602 217961 4931409 4931409 0.00
crit 17.93 39.80% 392142.14 282948 1040052 392187.28 306724 520547 7031804 7031804 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 13606 (20379) 4.5% (6.7%) 52.9 8.13sec 173086 122721 0 0 0 0.0% 0.1% 0.0% 0.0% 95.4 42760 94806 64026 40.9% 0.0% 12.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.87 52.87 95.43 95.43 1.4104 0.5842 6109793.44 6109793.44 0.00 122720.73 122720.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.82 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.4 59.14% 42759.62 35993 68540 42799.52 38282 50703 2413099 2413099 0.00
crit 39.0 40.86% 94806.34 74995 171371 94876.45 80897 116970 3696695 3696695 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 13041 (19298) 4.3% (6.4%) 33.9 12.57sec 256242 189106 0 0 0 0.0% 0.1% 0.0% 0.0% 49.8 81157 173019 117935 40.0% 0.0% 7.1%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.91 33.91 49.79 49.79 1.3550 0.6395 5872081.27 5872081.27 0.00 189105.96 189105.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.88 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.9 59.96% 81157.17 71987 137081 81164.40 72130 99642 2423007 2423007 0.00
crit 19.9 40.04% 173019.38 149990 342742 172905.42 149990 252770 3449074 3449074 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6257 2.1% 21.7 19.08sec 129610 0 79601 205023 129753 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.74 21.71 0.00 0.00 0.0000 0.0000 2817526.76 2817526.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.00 59.88% 79600.92 35993 137081 79699.04 0 112616 1035008 1035008 0.00
crit 8.69 40.04% 205023.15 90596 425007 205078.14 0 290672 1782519 1782519 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6773 2.2% 41.7 10.03sec 72953 0 43032 116000 72970 41.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.68 41.67 0.00 0.00 0.0000 0.0000 3040754.80 3040754.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.51 58.82% 43031.56 35993 68540 43076.12 36687 53630 1054683 1054683 0.00
crit 17.12 41.09% 115999.95 90596 212503 116078.34 91252 166820 1986072 1986072 0.00
miss 0.04 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 40 0.0% 0.5 171.23sec 33515 29900 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 24186 51931 35315 40.2% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.54 0.54 0.13 0.51 1.1210 0.5655 17940.22 17940.22 0.00 29900.37 29900.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.53 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.3 59.84% 24185.78 21183 38503 2073.40 0 37600 7351 7351 0.00
crit 0.2 40.15% 51930.54 44137 96270 4079.14 0 94012 10589 10589 0.00
miss 0.0 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 20 0.0% 0.2 6.35sec 40043 0 24179 63167 40037 40.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.22 0.22 0.00 0.00 0.0000 0.0000 8946.77 8946.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.13 59.24% 24178.74 21183 37600 1650.57 0 37600 3201 3201 0.00
crit 0.09 40.71% 63166.55 53319 116577 3538.52 0 116577 5746 5746 0.00
miss 0.00 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (20) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 11034 3.7% 238.7 1.95sec 20817 0 20816 0 20816 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.75 238.75 0.00 0.00 0.0000 0.0000 4969846.62 4969846.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 238.75 100.00% 20816.50 7034 390587 20827.88 15607 28473 4969847 4969847 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:23300.36
  • base_dd_max:23300.36
power_infusion 0 0.0% 4.3 120.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 9988 3.3% 15.6 4.70sec 287829 268346 196102 423075 287831 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.62 15.62 0.00 0.00 1.0727 0.0000 4495871.67 4495871.67 0.00 268346.17 268346.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.29 59.45% 196101.79 152630 468649 196479.14 152630 288912 1820948 1820948 0.00
crit 6.32 40.48% 423074.61 318016 1171761 423917.66 0 909365 2674923 2674923 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41765 (91915) 13.8% (30.5%) 162.5 2.76sec 254780 238386 0 0 0 0.0% 0.1% 0.0% 0.0% 504.9 25342 55009 37270 40.2% 0.0% 142.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.53 162.53 504.87 504.87 1.0688 1.2712 18816598.40 18816598.40 0.00 50777.00 238385.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.41 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.9 59.79% 25342.36 21342 42660 25348.80 23875 27466 7650504 7650504 0.00
crit 203.0 40.21% 55009.26 44467 106663 55023.68 51326 60989 11166095 11166095 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20885 6.9% 220.6 2.02sec 42649 0 25749 67837 42682 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.59 220.42 0.00 0.00 0.0000 0.0000 9407910.07 9407910.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.43 59.63% 25749.32 22409 42660 25755.72 24060 28153 3384206 3384206 0.00
crit 88.80 40.29% 67836.51 56403 132264 67859.17 61846 76832 6023704 6023704 0.00
miss 0.19 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0851 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 29265 9.7% 291.8 1.53sec 45186 0 30857 67276 45618 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 291.77 289.01 0.00 0.00 0.0000 0.0000 13184083.15 13184083.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.87 59.47% 30857.49 26478 50863 30862.48 28662 34053 5303450 5303450 0.00
crit 117.14 40.53% 67276.15 55169 127172 67285.77 61357 76458 7880633 7880633 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1300 0.4% 3.0 92.02sec 191178 0 115099 289713 191177 43.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 575944.54 575944.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.69 56.24% 115099.01 83080 161028 96272.35 0 161028 195004 195004 0.00
crit 1.31 43.65% 289713.00 173104 402617 214593.33 0 402617 380941 380941 0.00
miss 0.00 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:79124.40
  • base_dd_max:79124.40
vampiric_touch 22481 (33422) 7.4% (11.1%) 37.7 11.84sec 398620 327924 0 0 0 0.0% 0.1% 0.0% 0.0% 202.4 33688 73778 49943 40.5% 0.0% 83.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.71 37.71 202.43 202.43 1.2156 1.8477 10109936.34 10109936.34 0.00 35800.28 327924.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.69 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.4 59.45% 33687.96 27457 55792 33711.43 30756 38136 4054531 4054531 0.00
crit 82.1 40.55% 73778.36 57209 139496 73812.74 65721 86369 6055405 6055405 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10942 3.6% 88.4 4.99sec 55665 0 33444 88771 55701 40.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.41 88.35 0.00 0.00 0.0000 0.0000 4921457.69 4921457.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.69 59.63% 33443.82 28830 55792 33455.74 30455 38776 1762075 1762075 0.00
crit 35.59 40.28% 88770.97 72566 172978 88815.83 75648 106611 3159383 3159383 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115555 / 9223
melee 115172 3.0% 35.6 11.07sec 115031 123063 76392 179112 115031 41.8% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.55 35.55 0.00 0.00 0.9347 0.0000 4089639.29 4089639.29 0.00 123063.29 123063.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.16 34.21% 76391.88 57590 120110 76586.15 61046 111495 929006 929006 0.00
crit 14.85 41.76% 179112.37 115181 288264 178722.99 137084 250435 2659234 2659234 0.00
glance 8.51 23.94% 58908.11 43193 90083 58903.67 0 90083 501399 501399 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0685 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 383 0.0% 1.4 1.67sec 9784 0 5819 14354 9784 46.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.38 1.38 0.00 0.00 0.0000 0.0000 13541.12 13541.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.74 53.30% 5818.77 4377 7078 3156.20 0 7078 4292 4292 0.00
crit 0.64 46.55% 14354.26 10506 16987 7042.39 0 16987 9249 9249 0.00
miss 0.00 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.04%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.1sec 26.1sec 28.39% 27.69%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.1 0.0 125.0sec 125.0sec 17.50% 17.50%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.50%

    Trigger Attempt Success

    • trigger_pct:99.87%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.5sec 41.56% 41.56%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.56%

    Trigger Attempt Success

    • trigger_pct:99.36%
power_infusion 4.3 0.0 120.7sec 120.7sec 18.65% 18.65%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell haste increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell haste by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.8sec 9.8sec 14.76% 49.54%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.76%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.68%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.6sec 39.7sec 22.95% 43.73%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.95%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.6sec 55.4sec 17.59% 17.59%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.59%

    Trigger Attempt Success

    • trigger_pct:99.89%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.21%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 53.43% 57.24%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:53.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_PI
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_PI
devouring_plague Shadow Orb 17.0 51.1 3.0 3.0 311257.4
halo Mana 10.3 392104.8 38106.3 38106.0 20.5
mind_blast Mana 45.1 390266.2 8661.6 8661.6 30.7
mind_flay Mana 52.9 148211.8 2803.5 2803.5 61.7
mind_flay_insanity Mana 33.9 101047.2 2979.6 2979.7 86.0
mind_sear Mana 0.5 4801.1 8970.0 8969.1 3.7
shadow_word_death Mana 15.6 117256.0 7506.3 7506.8 38.3
shadow_word_pain Mana 162.5 2058557.4 12666.2 12666.0 20.1
vampiric_touch Mana 37.7 325577.2 8634.2 8634.0 46.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.52 247840.46 (11.12%) 6977.53 71837.74 22.47%
Shadow Orbs from Mind Blast Shadow Orb 45.02 44.53 (84.97%) 0.99 0.48 1.07%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.88 7.88 (15.03%) 1.00 0.00 0.00%
Devouring Plague Health Health 231.69 0.00 (0.00%) 0.00 4926753.88 100.00%
Vampiric Touch Mana Mana 290.78 1449778.28 (65.05%) 4985.78 29858.44 2.02%
halo_heal Health 10.29 0.00 (0.00%) 0.00 3557966.74 100.00%
external_healing Health 83.74 0.00 (0.00%) 0.00 29434994.43 100.00%
mp5_regen Mana 1801.83 531255.28 (23.84%) 294.84 9293.64 1.72%
pet - shadowfiend
external_healing Health 21.31 0.00 (0.00%) 0.00 7952487.77 100.00%
Resource RPS-Gain RPS-Loss
Mana 4946.65 7851.67
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -1010453.07 -1616820.00 -456060.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.8%
shadowfiend-Mana Cap 1.8%
mindbender-Mana Cap 1.8%

Procs

Count Interval
Shadowy Recall Extra Tick 442.7 1.0sec
Shadowy Apparition Procced 291.8 1.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_PI Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Per Second
Count 24992
Mean 302021.01
Minimum 264088.38
Maximum 346504.22
Spread ( max - min ) 82415.84
Range [ ( max - min ) / 2 * 100% ] 13.64%
Standard Deviation 10002.1724
5th Percentile 286202.06
95th Percentile 319089.76
( 95th Percentile - 5th Percentile ) 32887.70
Mean Distribution
Standard Deviation 63.2694
95.00% Confidence Intervall ( 301897.00 - 302145.01 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4213
0.1 Scale Factor Error with Delta=300 854028
0.05 Scale Factor Error with Delta=300 3416113
0.01 Scale Factor Error with Delta=300 85402844
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Damage per Second (effective)
Count 24992
Mean 302021.01
Minimum 264088.38
Maximum 346504.22
Spread ( max - min ) 82415.84
Range [ ( max - min ) / 2 * 100% ] 13.64%
Damage
Sample Data Priest_Shadow_T16H_MFI_PI Damage
Count 24992
Mean 131851982.80
Minimum 94124564.29
Maximum 175109646.15
Spread ( max - min ) 80985081.87
Range [ ( max - min ) / 2 * 100% ] 30.71%
DTPS
Sample Data Priest_Shadow_T16H_MFI_PI Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_PI Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_PI Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_PI Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_PI Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 4.31 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.74 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.62 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.88 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.42 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 33.49 mind_flay_insanity,interrupt=1,chain=1
L 29.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.59 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 2.11 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 10.15 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.40 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.29 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.54 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.18 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.54 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 52.87 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 130.93 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

ABHLMSZZZZccccHZOZccccHQKKKccccHMZZZccccHLLLMScccHMQKKccccHZZOccccHMZZccccHQKKLLLSHMMMMYNccHZZOZcccHQKKKcBcccHMZZccccHLLLMMScccHMQKKcccHZZOZcccHZZZccccHMQKKALLHLMMMOSNccHMZZccccHQKKccccHMZZccccHLLLMMcSccHMQKKcBccHZZZccccHMZZZccccHQKKLLLSHMMMMccccHZZOZcccHQKKKccccHMZZccccHLLLMScccHMQKKcccHZZOZcccHZZZccccHMQKKLABLHLMMMOScccHMZZZccIFHQKKccIFHMZZccIFHLLLMMGIFHKJMNIFQHKK8KJIFSHMQKKIFLcHZZOIFLLHLMMGIFNc

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_PI"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Priest_Shadow_T16H_MFI_ToF : 304761 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
304760.8 304760.8 123.75 / 0.04% 16374 / 5.4% 36.3 8135.1 4887.3 Mana 0.04% 51.7 100.0% 100%
Talents
  • 15: Void Tendrils
  • 30: Body and Soul
  • 45: Solace and Insanity
  • 60: Angelic Bulwark
  • 75: Twist of Fate
  • 90: Halo
  • Talent Calculator
Glyphs
  • Glyph of Mind Flay
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T16H_MFI_ToF Damage Per Second
Int SP Hit Crit Haste Mastery
Scale Factors 7.74 5.65 0.00 5.28 4.18 4.66
Normalized 1.00 0.73 0.00 0.68 0.54 0.60
Scale Deltas 1000 1000 -1000 1000 1000 1000
Error 0.18 0.18 0.00 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Int > SP > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.74, SpellDamage=5.65, CritRating=5.28, HasteRating=4.18, MasteryRating=4.66 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T16H_MFI_ToF": Intellect=7.74, SpellDamage=5.65, CritRating=5.28, HasteRating=4.18, MasteryRating=4.66 )

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Per Execute Time&chts=dddddd,18&chs=550x300&chd=t:909357|746144|315498|302804|256122|239006|197047|114566|16158&chds=0,1818715&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++909357++devouring_plague,9482C9,0,0,15|t++746144++halo,9482C9,1,0,15|t++315498++vampiric_touch,9482C9,2,0,15|t++302804++shadow_word_death,9482C9,3,0,15|t++256122++mind_blast,9482C9,4,0,15|t++239006++shadow_word_pain,9482C9,5,0,15|t++197047++mind_flay_insanity,9482C9,6,0,15|t++114566++mind_flay,9482C9,7,0,15|t++16158++mind_sear,9482C9,8,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,10,9,9,7,7,6,6,5,4,4,4,4,4,3,3,2,2,0,0,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,7BC29D,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600,9482C9,9482C9&chl=shadow_word_pain|shadowy_apparition|mind_blast|essence_of_yulon|vampiric_touch|shadow_word_pain_mastery|halo_damage|devouring_plague_tick|mind_flay_insanity|mind_flay|shadow_word_death|multistrike_spell|devouring_plague|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery|mind_flay_insanity_mastery|mind_flay_mastery|stormlash|shadowfiend: stormlash|mind_sear|mind_sear_mastery&
http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Scale Factors|Priest_Shadow_T16H_MFI_ToF%20Damage%20Per%20Second&chts=dddddd,18&chs=550x210&chd=t1:7.74,5.65,5.28,4.66,4.18|7.56,5.48,5.10,4.48,4.00|7.92,5.83,5.46,4.83,4.35&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++7.74++Int,FFFFFF,0,0,15,0.1,e|t++++5.65++SP,FFFFFF,0,1,15,0.1,e|t++++5.28++Crit,FFFFFF,0,2,15,0.1,e|t++++4.66++Mastery,FFFFFF,0,3,15,0.1,e|t++++4.18++Haste,FFFFFF,0,4,15,0.1,e&chds=-0.010,9.299& http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gikloruwy12211z20z0yyyxxvvuttsssrrrpomkiopqqrqsrstuuvvuutssrkhgfedccaZYXXWWXXYZbccdhikllmppppqqponmkkjiedcdddccddddeeeeefffffgggfekmoprqstvxyz00000zzyspnmkjhgecbaZZZZZZacddefgjklnrtuvvvuutrqponmlkjjigfeddddddddddddedddcbehijlklmnpqqrrrrrrrqnjhgffddcbaZZZZabceghijopstuvyzzz00zyxvtsrrlkjjjjhhhhhhhhhiiiiiiijiihgkmnoqpqqstuuvvvvvvvupnmkjjiigffeeeeeffgijjklmoqstxz12344443222110zyyxvtsrrqrrrrssssssssssruwz233445566677665552zwtrrqqpooonnnnooooppqttuvvwxxyzz00000zzzzwvvvuuttsrqqqpppqqqqrrsstttvxz245677787777776776520yzyyxxxxwwwvvuuttstuvwwxyz22345520yvtrpmkf&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.6746,0.4|h,C41F3B,0,0.0000,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=304761|max=451778&chxp=1,1,67,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,4,5,6,11,15,30,57,101,132,208,304,401,582,697,929,1021,1234,1354,1481,1572,1649,1600,1589,1502,1355,1312,1133,956,829,670,509,419,354,271,189,137,116,79,47,39,36,24,12,8,5,3,2,1&chds=0,1649&chbh=5&chxt=x&chxl=0:|min=266481|avg=304761|max=347404&chxp=0,1,47,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T16H_MFI_ToF Spent Time&chts=dddddd,18&chs=550x275&chd=t:38.4,16.4,10.8,10.2,10.2,4.1,3.7,2.5,0.7,0.1,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=shadow_word_pain 172.9s|mind_flay 73.8s|mind_blast 48.5s|vampiric_touch 46.2s|mind_flay_insanity 46.0s|devouring_plague 18.3s|shadow_word_death 16.8s|halo 11.1s|shadowfiend 3.3s|mind_sear 0.6s|waiting 0.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T16H_MFI_ToF 304761
devouring_plague 11086 (36996) 3.6% (12.2%) 17.0 26.08sec 980962 909357 202173 432294 293905 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 1.0788 0.0000 4996710.20 4996710.20 0.00 909357.26 909357.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.20 59.99% 202172.63 169721 353993 202189.80 169721 261286 2062098 2062098 0.00
crit 6.79 39.93% 432294.03 353627 885088 432586.24 0 721385 2934612 2934612 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 8565 2.8% 69.9 6.08sec 55253 0 33877 87554 55337 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.88 69.77 0.00 0.00 0.0000 0.0000 3860929.91 3860929.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.78 59.88% 33877.15 28287 59000 33888.13 29978 41401 1415433 1415433 0.00
crit 27.93 40.03% 87554.01 71200 182923 87554.78 73332 110032 2445497 2445497 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 17345 5.7% 17.0 26.08sec 459964 0 0 0 0 0.0% 0.0% 0.0% 0.0% 159.9 33639 71865 48908 39.9% 0.0% 23.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 159.89 159.89 0.0000 0.6529 7819972.12 7819972.12 0.00 74903.95 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.0 60.06% 33639.24 28287 117843 33652.04 30199 44734 3230190 3230190 0.00
crit 63.9 39.94% 71864.53 58939 245535 71859.07 62934 97423 4589782 4589782 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=12824} Shadow damage and an additional {$s5=2137} Shadow damage every $t2 sec for {$d=6 seconds}. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
essence_of_yulon 25840 8.5% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.9 26563 57789 39135 40.3% 0.1% 30.2%

Stats details: essence_of_yulon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.78 170.91 297.39 0.0000 0.7965 11638324.54 11638324.54 0.00 85489.17 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.4 59.65% 26563.32 21101 47031 26566.95 24055 30725 4711774 4711774 0.00
crit 119.9 40.30% 57789.33 43965 117592 57764.81 50780 69192 6926550 6926550 0.00
miss 0.1 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: essence_of_yulon

Static Values
  • id:146198
  • school:firestorm
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:146198
  • name:Essence of Yu'lon
  • school:firestorm
  • tooltip:$w1 damage taken every $t1 sec.
  • description:{$@spelldesc146197=Your damaging spell casts have a chance to empower you with the Essence of Yu'lon, causing you to hurl jade dragonflame at the target, dealing {$148008s1=28451} damage over {$146198d=4 seconds}. This damage also affects up to 4 other enemies near the burning target. (Approximately ${$procrppm}.2 procs per minute)}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
halo 0 (18336) 0.0% (6.0%) 10.3 45.55sec 803483 746144 0 0 0 40.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 10.28 0.00 0.00 1.0769 0.0000 0.00 0.00 0.00 746143.92 746143.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.11 59.45% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.16 40.46% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.
halo_damage 18336 6.0% 10.3 45.55sec 803483 0 182046 395218 267687 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 30.86 0.00 0.00 0.0000 0.0000 8259813.17 8259813.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.44 59.77% 182045.65 153853 317120 182085.74 156878 238959 3357479 3357479 0.00
crit 12.40 40.20% 395218.29 320566 792892 394591.90 322150 538963 4902334 4902334 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=42901 to 53009} Shadow damage to enemies, and up to {$120696s1=71502 to 88349} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 27598 9.1% 45.1 10.08sec 275977 256122 189065 407141 275979 39.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.05 45.05 0.00 0.00 1.0775 0.0000 12433718.51 12433718.51 0.00 256122.41 256122.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.02 59.98% 189064.92 135799 455588 189046.08 156338 226140 5109371 5109371 0.00
crit 17.99 39.93% 407140.97 282948 1139104 407269.42 311465 539493 7324347 7324347 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=29848 to 30000} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 12575 (18817) 4.1% (6.2%) 51.9 8.26sec 162948 114566 0 0 0 0.0% 0.1% 0.0% 0.0% 88.4 42890 94625 63928 40.7% 0.0% 12.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.88 51.88 88.37 88.37 1.4223 0.6232 5649399.53 5649399.53 0.00 114565.66 114565.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.83 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.4 59.34% 42890.19 35993 75068 42911.43 37983 49805 2248977 2248977 0.00
crit 35.9 40.66% 94625.15 74995 187692 94669.34 81423 116545 3400422 3400422 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 13591 (20109) 4.5% (6.6%) 33.8 12.61sec 267959 197047 0 0 0 0.0% 0.1% 0.0% 0.0% 49.5 85156 181596 123714 40.0% 0.0% 7.1%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.81 33.81 49.49 49.49 1.3599 0.6437 6122982.01 6122982.01 0.00 197047.10 197047.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.78 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.7 60.02% 85156.08 71987 150136 85058.10 73499 104371 2529561 2529561 0.00
crit 19.8 39.98% 181596.33 149990 375384 181272.39 151828 234748 3593421 3593421 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6519 2.1% 21.6 19.26sec 135806 0 83430 214863 135959 40.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.62 21.60 0.00 0.00 0.0000 0.0000 2936455.59 2936455.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.94 59.89% 83429.50 35993 150136 83456.83 65119 112167 1079184 1079184 0.00
crit 8.64 40.02% 214863.04 90596 465484 214626.19 0 345756 1857272 1857272 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6242 2.0% 38.6 10.84sec 72672 0 43162 115650 72690 40.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.58 38.57 0.00 0.00 0.0000 0.0000 2803827.52 2803827.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.80 59.12% 43162.35 35993 75068 43186.28 37040 55397 984217 984217 0.00
crit 15.73 40.79% 115649.54 90596 232742 115705.99 90956 160568 1819610 1819610 0.00
miss 0.04 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_sear 24 0.0% 0.6 172.90sec 18241 16158 0 0 0 0.0% 0.1% 0.0% 0.0% 0.1 24327 52527 35589 39.9% 0.0% 0.0%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.57 0.57 0.07 0.29 1.1298 0.5518 10373.20 10373.20 0.00 16157.64 16157.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.57 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.2 60.09% 24327.17 21183 42170 1233.03 0 42170 4262 4262 0.00
crit 0.1 39.91% 52527.46 44137 87865 2407.22 0 87865 6111 6111 0.00
DPS Timeline Chart

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $49821a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_mastery 12 0.0% 0.1 15.47sec 39916 0 24404 63588 39914 39.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.13 0.13 0.00 0.00 0.0000 0.0000 5075.78 5075.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.08 60.29% 24403.60 21183 42170 993.82 0 42170 1870 1870 0.00
crit 0.05 39.65% 63588.19 53319 127680 2048.07 0 127680 3206 3206 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_sear_mastery

Static Values
  • id:124469
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124469
  • name:Mind Sear
  • school:shadow
  • tooltip:$@spellaura49821
  • description:{$@spelldesc49821=Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
mind_sear_tick 0 (12) 0.0% (0.0%) 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a1 yards.
  • description:Causes an explosion of shadow magic around the target, causing {$49821s1=4570 to 4595} Shadow damage every $48045T1 sec for {$48045d=5 seconds} to all enemies within $49821a1 yards around the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:302.21
  • base_dd_max:327.39
multistrike_spell 11193 3.7% 231.7 2.01sec 21757 0 21757 0 21757 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multistrike_spell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 231.70 231.70 0.00 0.00 0.0000 0.0000 5041104.70 5041104.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 231.70 100.00% 21757.31 7034 427786 21769.09 15455 30510 5041105 5041105 0.00
DPS Timeline Chart

Action details: multistrike_spell

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:92668.96
  • base_dd_max:92668.96
shadow_word_death 11321 3.7% 15.6 4.71sec 327338 302804 223501 480753 327343 40.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.57 15.57 0.00 0.00 1.0810 0.0000 5097094.51 5097094.51 0.00 302803.69 302803.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.26 59.48% 223500.68 175524 513282 223819.40 0 416537 2070132 2070132 0.00
crit 6.30 40.44% 480752.62 365719 1283357 481656.52 0 1013022 3026963 3026963 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=33193} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=9 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.157000
  • base_dd_min:2509.99
  • base_dd_max:2509.99
shadow_word_pain 41738 (91747) 13.7% (30.1%) 160.7 2.78sec 257287 239006 0 0 0 0.0% 0.1% 0.0% 0.0% 490.2 26130 56582 38357 40.2% 0.0% 142.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 160.65 160.65 490.22 490.22 1.0765 1.3073 18803687.38 18803687.38 0.00 50791.18 239006.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.53 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 293.4 59.85% 26130.27 21342 46723 26135.62 24692 28261 7666301 7666301 0.00
crit 196.8 40.15% 56581.81 44467 116821 56592.08 52664 61878 11137386 11137386 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Add1
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.311100
  • base_td:662.70
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 20853 6.8% 214.2 2.08sec 43864 0 26563 69784 43897 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.18 214.02 0.00 0.00 0.0000 0.0000 9394701.39 9394701.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.89 59.76% 26562.69 22409 46723 26568.53 24574 29699 3397043 3397043 0.00
crit 85.95 40.16% 69784.42 56403 144860 69800.20 63677 78135 5997659 5997659 0.00
miss 0.18 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=663} Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.311100
  • base_dd_min:662.70
  • base_dd_max:662.70
shadowfiend 0 0.0% 3.0 180.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0850 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 29155 9.6% 282.8 1.58sec 46452 0 31783 69117 46889 40.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 282.77 280.14 0.00 0.00 0.0000 0.0000 13135370.69 13135370.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 166.79 59.54% 31782.77 26478 55707 31786.39 29569 35057 5301124 5301124 0.00
crit 113.35 40.46% 69116.61 55169 139283 69122.79 63354 77421 7834246 7834246 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When you deal critical periodic damage with your Shadow Word: Pain, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=5728} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.00
  • base_dd_max:393.00
stormlash 1212 0.4% 2.9 93.87sec 186218 0 113154 280773 186209 43.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 2.88 0.00 0.00 0.0000 0.0000 535777.88 535777.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.62 56.23% 113154.00 83080 166781 92918.35 0 166781 183068 183068 0.00
crit 1.26 43.66% 280772.66 173104 383445 203730.00 0 383445 352710 352710 0.00
miss 0.00 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:118198.80
  • base_dd_max:118198.80
vampiric_touch 21721 (32373) 7.1% (10.6%) 37.7 11.82sec 386116 315498 0 0 0 0.0% 0.1% 0.0% 0.0% 193.2 34291 74622 50575 40.4% 0.0% 82.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.72 37.72 193.23 193.23 1.2238 1.9321 9772324.86 9772324.86 0.00 34720.22 315497.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.70 99.95% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.2 59.62% 34290.75 27457 61105 34307.97 31542 38727 3950612 3950612 0.00
crit 78.0 40.38% 74621.53 57209 152782 74644.71 66734 85604 5821713 5821713 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.415000
  • base_td:74.50
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 10651 3.5% 84.4 5.20sec 56782 0 34285 90396 56819 40.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.40 84.34 0.00 0.00 0.0000 0.0000 4792323.21 4792323.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.35 59.69% 34284.60 28830 61105 34294.72 30820 39256 1726084 1726084 0.00
crit 33.92 40.22% 90396.01 72566 189452 90429.22 76730 109739 3066240 3066240 0.00
miss 0.08 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.415000
  • base_dd_min:74.50
  • base_dd_max:74.50
pet - shadowfiend 115074 / 9184
melee 114683 3.0% 35.6 11.08sec 114537 122536 76171 178515 114537 41.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.55 35.55 0.00 0.00 0.9347 0.0000 4072347.64 4072347.64 0.00 122535.59 122535.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.17 34.24% 76170.98 57590 120110 76372.83 60369 114888 927205 927205 0.00
crit 14.81 41.65% 178514.52 115181 288264 178149.35 130580 258572 2643714 2643714 0.00
glance 8.54 24.01% 58730.81 43193 90083 58735.56 43193 90083 501428 501428 0.00
dodge 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0756 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 391 0.0% 1.4 1.73sec 9780 0 5815 14310 9780 46.8% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.41 0.00 0.00 0.0000 0.0000 13801.69 13801.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.75 53.06% 5815.24 4377 7078 3181.49 0 7078 4354 4354 0.00
crit 0.66 46.78% 14309.99 10506 16987 7136.86 0 16987 9448 9448 0.00
miss 0.00 0.16% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5455.33
  • base_dd_max:5455.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
empowered_shadows 17.0 0.0 26.1sec 26.1sec 28.44% 27.66%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_empowered_shadows
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • empowered_shadows_1:28.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145180
  • name:Empowered Shadows
  • tooltip:Damage dealt by your next Mind Blast, Mind Spike, or Shadow Word: Death increased by $w1%.
  • description:{$@spelldesc145179=Each Shadow Orb consumed for Devouring Plague increases the damage of your next Mind Blast, Shadow Word: Death, or Mind Spike cast within {$145180d=12 seconds} by {$s1=20}%.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
expanded_mind 4.0 0.0 125.7sec 125.7sec 17.38% 17.38%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_expanded_mind
  • max_stacks:1
  • duration:20.00
  • cooldown:115.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • expanded_mind_1:17.38%

    Trigger Attempt Success

    • trigger_pct:99.88%
jade_serpent_potion 2.0 0.0 420.8sec 0.0sec 10.10% 10.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3999.98

    Stack Uptimes

    • jade_serpent_potion_1:10.10%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.6 6.6 36.6sec 23.4sec 41.61% 41.61%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.61%

    Trigger Attempt Success

    • trigger_pct:99.40%
raid_movement 44.5 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 9.9sec 9.9sec 14.72% 49.55%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:14.72%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.25%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.51% 4.51%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 9.3 2.1 49.6sec 39.6sec 22.95% 53.02%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:22.95%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
toxic_power 8.0 0.0 55.4sec 55.2sec 17.63% 17.63%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_toxic_power
  • max_stacks:1
  • duration:10.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:14039.00

    Stack Uptimes

    • toxic_power_1:17.63%

    Trigger Attempt Success

    • trigger_pct:99.87%
twist_of_fate 1.0 338.4 0.0sec 0.4sec 32.03% 32.03%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:32.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.1sec 74.1sec 83.38% 75.22%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 53.29% 57.10%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:53.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.30% 16.30%

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
amplified

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_amplified
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • amplified_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:146051
  • name:Amplification
  • tooltip:
  • description:Amplifies your Critical Strike damage and healing, Haste, Mastery, and Spirit by {$s2=3}%.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T16H_MFI_ToF
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s7=60}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, increasing your armor by {$s7=60}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells except for Renew, Prayer of Mending, and Leap of Faith while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T16H_MFI_ToF
devouring_plague Shadow Orb 17.0 51.0 3.0 3.0 327151.3
halo Mana 10.3 416336.8 40500.0 40499.6 19.8
mind_blast Mana 45.1 405480.6 9000.0 9000.0 30.7
mind_flay Mana 51.9 155631.6 3000.0 3000.0 54.3
mind_flay_insanity Mana 33.8 101432.2 3000.0 3000.1 89.3
mind_sear Mana 0.6 5118.1 9000.0 9000.3 2.0
shadow_word_death Mana 15.6 121464.4 7800.0 7800.5 42.0
shadow_word_pain Mana 160.6 2120563.1 13200.0 13199.7 19.5
vampiric_touch Mana 37.7 339485.4 9000.0 8999.9 42.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 35.52 266117.11 (12.08%) 7492.06 53561.81 16.75%
Shadow Orbs from Mind Blast Shadow Orb 45.01 44.49 (85.00%) 0.99 0.52 1.15%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.85 7.85 (15.00%) 1.00 0.00 0.00%
Devouring Plague Health Health 229.67 0.00 (0.00%) 0.00 4883680.86 100.00%
Vampiric Touch Mana Mana 277.57 1400646.43 (63.60%) 5046.11 11740.73 0.83%
halo_heal Health 10.28 0.00 (0.00%) 0.00 3717547.97 100.00%
external_healing Health 83.75 0.00 (0.00%) 0.00 29277880.06 100.00%
mp5_regen Mana 1801.83 535350.94 (24.31%) 297.12 5197.99 0.96%
pet - shadowfiend
external_healing Health 21.27 0.00 (0.00%) 0.00 7939716.49 100.00%
Resource RPS-Gain RPS-Loss
Mana 4887.27 8135.06
Shadow Orb 0.12 0.11
Combat End Resource Mean Min Max
Health 708811.00 708811.00 708811.00
Mana -1164725.70 -1788300.00 -620700.00
Shadow Orb 1.36 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.0%
shadowfiend-Mana Cap 1.0%
mindbender-Mana Cap 1.0%

Procs

Count Interval
Shadowy Recall Extra Tick 428.4 1.0sec
Shadowy Apparition Procced 282.8 1.6sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T16H_MFI_ToF Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Per Second
Count 24992
Mean 304760.77
Minimum 266481.29
Maximum 347404.45
Spread ( max - min ) 80923.16
Range [ ( max - min ) / 2 * 100% ] 13.28%
Standard Deviation 9981.5893
5th Percentile 289023.88
95th Percentile 321771.60
( 95th Percentile - 5th Percentile ) 32747.72
Mean Distribution
Standard Deviation 63.1392
95.00% Confidence Intervall ( 304637.02 - 304884.52 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4120
0.1 Scale Factor Error with Delta=300 850517
0.05 Scale Factor Error with Delta=300 3402068
0.01 Scale Factor Error with Delta=300 85051712
Distribution Chart
DPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Damage per Second (effective)
Count 24992
Mean 304760.77
Minimum 266481.29
Maximum 347404.45
Spread ( max - min ) 80923.16
Range [ ( max - min ) / 2 * 100% ] 13.28%
Damage
Sample Data Priest_Shadow_T16H_MFI_ToF Damage
Count 24992
Mean 133109966.68
Minimum 96995668.59
Maximum 175645541.68
Spread ( max - min ) 78649873.09
Range [ ( max - min ) / 2 * 100% ] 29.54%
DTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Damage Taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Priest_Shadow_T16H_MFI_ToF Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T16H_MFI_ToF Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T16H_MFI_ToF Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T16H_MFI_ToF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.01 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent
F 7.72 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
G 1.59 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
H 45.15 mind_blast,if=active_enemies<=5&cooldown_react
I 7.85 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
J 0.44 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
K 33.37 mind_flay_insanity,interrupt=1,chain=1
L 29.47 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
M 37.50 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
N 2.16 shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
O 10.65 vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
P 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
Q 15.41 devouring_plague,if=shadow_orb=3&ticks_remain<=1
R 0.00 mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
S 10.28 halo,if=talent.halo.enabled
T 0.00 cascade_damage,if=talent.cascade.enabled
U 0.00 divine_star,if=talent.divine_star.enabled
V 0.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
W 0.36 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
X 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
Y 0.57 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
Z 51.88 mind_flay,chain=1,interrupt=1
a 0.00 shadow_word_death,moving=1
b 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
c 129.02 shadow_word_pain,moving=1
d 0.00 dispersion

Sample Sequence

AHLMSZZZZcccHZOZZccccHQKKKccccHMZZZcccHLLLMMScccHMQKKccccHZZOZcccHZZZccccHMQKKLLLSHMMMOccccHZZZccccHMQKKccccHZZOZcccHLLLMMSccHMQKKccccHZZOccccHMZZccccHQKKALLLHMMMMScccHZZZOccccHMQKKcccHZZOZcccHLLLMMScccHMQKKcccHZZOZcccHZZZccccHMQKKLLLSHMMMYccccHMZZccccHQKKccccHMZZccccHLLLMMScccHMQKKcccHZZOZcccHZZZccccHOQKKALLLHMMMOScccHMZZZccIFHQKKccIFHMZZccIFHLLLMQSIFHKMZNcIFHQKK8KcIFHMZZccIFHQKKKLIFLHLMMMLIFQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 124
Agility 149 142 142
Stamina 40172 36520 36520
Intellect 29743 26626 25369
Spirit 2857 2637 2637
Health 708811 657683 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 52750 40841 14225
Spell Hit 14.87% 14.22% 815
Spell Crit 40.60% 34.37% 13573
Spell Haste 41.88% 32.42% 13778
Spell Speed 41.88% 32.42% 13778
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 10.16% 9.52% 815
Melee Crit 30.99% 25.98% 13573
Melee Haste 35.13% 32.42% 13778
Swing Speed 48.64% 32.42% 13778
Expertise 4.71% 4.71% 1600
Armor 45442 17751 17751
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 2.39% 2.37% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 43.69% 32.42% 6008

Gear

Source Slot Average Item Level: 572.75
Local Head hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
Local Neck necklace_of_fading_light,id=105473,reforge=spi_crit
Local Shoulders shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
Shirt empty
Local Chest raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
Local Waist miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
Local Legs leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
Local Feet toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
Local Wrists bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
Local Hands montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
Local Finger1 seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
Local Finger2 laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
Local Trinket1 purified_bindings_of_immerseus,id=105422
Local Trinket2 kardris_toxic_totem,id=105540
Local Back xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
Local Main Hand immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T16H_MFI_ToF"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=mind_flay/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&active_enemies<=5
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=5&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time&miss_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=5,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=5,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=2
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_ternion_glory,id=99360,gems=sinister_primal_160exp_160mastery_180int
neck=necklace_of_fading_light,id=105473,reforge=spi_crit
shoulders=shoulderguards_of_the_ternion_glory,id=99363,gems=160exp_160mastery_160exp_160mastery_120int,enchant=200int_100crit
back=xingho_breath_of_yulon,id=102246,upgrade=2,gems=160exp_160haste_60int,enchant=180int,reforge=mastery_spi
chest=raiment_of_the_ternion_glory,id=99362,gems=160exp_160haste_160exp_160haste_160exp_160haste_180int,enchant=80all,reforge=mastery_haste
wrists=bracers_of_sonic_projection,id=105626,gems=320mastery,enchant=180int
hands=montaks_grips_of_scorching_breath,id=105603,gems=160exp_160haste_320haste_320haste_120int,enchant=170haste
waist=miasmic_skullbelt,id=105569,gems=160exp_160mastery_320haste_320haste_120int,reforge=hit_haste
legs=leggings_of_the_ternion_glory,id=99361,gems=320mastery_320haste_120int,enchant=285int_165crit,reforge=mastery_haste
feet=toxic_tornado_treads,id=105537,gems=160spi_160mastery_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_sullen_fury,id=105574,gems=80int_160mastery_60spi,enchant=160int,reforge=spi_haste
finger2=laserslice_signet,id=105520,gems=320mastery_60spi,enchant=160int,reforge=spi_crit
trinket1=purified_bindings_of_immerseus,id=105422
trinket2=kardris_toxic_totem,id=105540
main_hand=immaculately_preserved_wand,id=105594,gems=160exp_160mastery_60int,enchant=jade_spirit,reforge=mastery_haste
off_hand=juggernauts_power_core,id=105521,gems=320mastery_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=36443
# gear_intellect=25152
# gear_spirit=2421
# gear_spell_power=14225
# gear_expertise_rating=1600
# gear_hit_rating=815
# gear_crit_rating=13573
# gear_haste_rating=13778
# gear_mastery_rating=6008
# gear_armor=17751
# meta_gem=sinister_primal
# tier16_2pc_caster=1
# tier16_4pc_caster=1
# main_hand=immaculately_preserved_wand,heroic=1,elite=1,weapon=wand,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 347 - 556 ( 450.6 )

Performance:
Total Events Processed: 1034864400
Max Event Queue: 280
Sim Seconds: 11264552
CPU Seconds: 1271.4900
Physical Seconds: 161.0190
Speed Up: 8859

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
Simulation Length
Sample Data Simulation Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
Standard Deviation 55.7008
5th Percentile 368.65
95th Percentile 536.84
( 95th Percentile - 5th Percentile ) 168.19
Mean Distribution
Standard Deviation 0.3523
95.00% Confidence Intervall ( 449.89 - 451.27 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 587
0.1% Error 58704
0.1 Scale Factor Error with Delta=300 26
0.05 Scale Factor Error with Delta=300 105
0.01 Scale Factor Error with Delta=300 2648
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague 2944 5725122 12706 2.71 192052 416153 20.3 20.3 40.1% 0.1% 0.0% 0.0% 21.83sec 5725122 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_mastery 124467 4455638 9889 11.19 32177 84085 84.2 84.1 40.2% 0.1% 0.0% 0.0% 5.08sec 4455638 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI devouring_plague_tick ticks -2944 9091302 20203 25.67 32214 69539 20.3 192.6 40.2% 0.0% 0.0% 0.0% 21.83sec 9091302 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI essence_of_yulon ticks -146198 10790855 23980 23.27 25413 55362 0.0 174.6 40.3% 0.1% 0.0% 0.0% 0.00sec 10790855 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo 120644 0 0 1.40 0 0 10.5 10.5 40.6% 0.1% 0.0% 0.0% 44.39sec 0 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_damage 120696 5230972 11609 2.68 176894 382888 10.5 20.1 40.3% 0.0% 0.0% 0.0% 44.39sec 5230972 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI halo_heal 120696 0 0 15.34 0 0 10.5 115.2 43.8% 0.0% 0.0% 0.0% 44.39sec 40497050 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_blast 8092 13443640 29836 7.41 165073 357124 55.6 55.6 40.0% 0.1% 0.0% 0.0% 8.12sec 13443640 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay ticks -15407 6647093 14771 14.51 41287 90244 65.4 108.8 40.4% 0.0% 0.0% 0.0% 6.68sec 6647093 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_flay_mastery 124468 3263742 7243 6.32 41231 109315 47.5 47.5 40.4% 0.1% 0.0% 0.0% 8.89sec 3263742 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear ticks -48045 9403 21 0.01 23519 51479 0.1 0.1 39.3% 0.0% 0.0% 0.0% 124.80sec 9403 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_sear_mastery 124469 4618 10 0.02 23651 62173 0.1 0.1 39.9% 0.1% 0.0% 0.0% 9.70sec 4618 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI mind_spike 73510 11105265 24646 7.15 140464 305480 53.7 53.7 40.2% 0.1% 0.0% 0.0% 8.14sec 11105265 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI multistrike_spell 0 5176097 11488 31.35 21983 0 235.5 235.5 0.0% 0.0% 0.0% 0.0% 1.96sec 5176097 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_death 32379 4389824 9743 2.09 190670 412014 15.7 15.7 40.5% 0.1% 0.0% 0.0% 4.68sec 4389824 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain ticks -589 16421828 36493 59.61 25006 54198 119.0 447.1 40.2% 0.0% 0.0% 0.0% 3.76sec 16421828 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadow_word_pain_mastery 124464 8190511 18178 25.99 25385 66716 195.3 195.1 40.2% 0.1% 0.0% 0.0% 2.28sec 8190511 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowy_apparition 78203 11455535 25424 34.03 30385 66123 258.0 255.5 40.4% 0.0% 0.0% 0.0% 1.73sec 11455535 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.64sec 0 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI stormlash 120687 569371 1264 0.41 110793 276828 3.1 3.1 43.5% 0.1% 0.0% 0.0% 89.87sec 569371 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch ticks -34914 10094217 22432 27.63 33018 71864 37.6 207.2 40.4% 0.0% 0.0% 0.0% 11.93sec 10094217 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI vampiric_touch_mastery 124465 4933175 10948 12.05 32912 86787 90.5 90.5 40.2% 0.1% 0.0% 0.0% 4.88sec 4933175 450.58sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend melee 0 4122557 115960 60.02 76896 180316 35.6 35.6 41.9% 0.1% 24.0% 0.0% 11.06sec 4122557 35.55sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.20sec 0 35.55sec
Priest_Shadow_T16H_FDCL_DI Priest_Shadow_T16H_FDCL_DI_shadowfiend stormlash 120687 14011 394 2.37 5889 14493 1.4 1.4 47.5% 0.1% 0.0% 0.0% 1.71sec 14011 35.55sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague 2944 4738557 10517 2.27 191004 408582 17.1 17.1 39.9% 0.1% 0.0% 0.0% 25.99sec 4738557 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_mastery 124467 3696690 8204 9.40 32014 82851 70.7 70.6 40.0% 0.1% 0.0% 0.0% 5.99sec 3696690 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI devouring_plague_tick ticks -2944 7503583 16675 21.56 31887 68182 17.1 161.7 40.0% 0.0% 0.0% 0.0% 25.99sec 7503583 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI essence_of_yulon ticks -146198 11489118 25531 24.10 25807 56517 0.0 180.8 40.4% 0.1% 0.0% 0.0% 0.00sec 11489118 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo 120644 0 0 1.39 0 0 10.4 10.4 40.5% 0.1% 0.0% 0.0% 44.81sec 0 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_damage 120696 7218216 16020 3.69 177186 384760 10.4 27.7 40.3% 0.0% 0.0% 0.0% 44.81sec 7218216 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI halo_heal 120696 0 0 15.50 0 0 10.4 116.4 43.8% 0.0% 0.0% 0.0% 44.81sec 40864395 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_blast 8092 10776439 23917 6.00 163491 353069 45.1 45.1 40.0% 0.1% 0.0% 0.0% 10.08sec 10776439 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay ticks -15407 6886806 15304 14.66 42165 92534 65.6 110.0 40.6% 0.0% 0.0% 0.0% 6.64sec 6886806 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_flay_mastery 124468 3397527 7540 6.39 42242 112529 48.0 48.0 40.6% 0.1% 0.0% 0.0% 8.69sec 3397527 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear ticks -48045 12252 27 0.01 23751 52721 0.2 0.1 39.9% 0.0% 0.0% 0.0% 150.31sec 12252 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_sear_mastery 124469 5994 13 0.02 23764 64844 0.2 0.2 39.3% 0.1% 0.0% 0.0% 22.65sec 5994 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI mind_spike 73510 11523786 25575 7.34 141590 309215 55.1 55.1 40.4% 0.1% 0.0% 0.0% 7.95sec 11523786 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI multistrike_spell 0 5173859 11483 31.60 21803 0 237.3 237.3 0.0% 0.0% 0.0% 0.0% 1.95sec 5173859 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.64sec 0 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_death 32379 4465402 9910 2.10 192951 416470 15.8 15.8 40.4% 0.1% 0.0% 0.0% 4.65sec 4465402 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain ticks -589 17882957 39740 63.91 25362 55074 134.4 479.3 40.2% 0.0% 0.0% 0.0% 3.34sec 17882957 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadow_word_pain_mastery 124464 8933154 19826 27.87 25765 67917 209.4 209.3 40.2% 0.1% 0.0% 0.0% 2.13sec 8933154 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowy_apparition 78203 12514797 27775 36.50 30871 67376 276.9 274.1 40.5% 0.0% 0.0% 0.0% 1.61sec 12514797 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI stormlash 120687 608628 1351 0.42 115226 290934 3.2 3.2 43.7% 0.1% 0.0% 0.0% 88.07sec 608628 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch ticks -34914 10362838 23029 27.66 33699 73810 38.2 207.4 40.5% 0.0% 0.0% 0.0% 11.71sec 10362838 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI vampiric_touch_mastery 124465 5059908 11230 12.05 33519 89008 90.5 90.5 40.4% 0.1% 0.0% 0.0% 4.90sec 5059908 450.58sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend melee 0 4119530 115878 60.02 76899 180401 35.6 35.6 41.8% 0.1% 24.0% 0.0% 11.07sec 4119530 35.55sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.16sec 0 35.55sec
Priest_Shadow_T16H_FDCL_PI Priest_Shadow_T16H_FDCL_PI_shadowfiend stormlash 120687 13831 389 2.36 5888 14459 1.4 1.4 46.8% 0.1% 0.0% 0.0% 1.73sec 13831 35.55sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague 2944 5016695 11134 2.27 202386 433355 17.0 17.0 39.9% 0.1% 0.0% 0.0% 26.03sec 5016695 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_mastery 124467 3876021 8602 9.32 33884 87634 70.1 70.0 40.1% 0.1% 0.0% 0.0% 6.07sec 3876021 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF devouring_plague_tick ticks -2944 7860567 17468 21.38 33696 72016 17.0 160.4 40.0% 0.0% 0.0% 0.0% 26.03sec 7860567 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF essence_of_yulon ticks -146198 11435476 25412 23.33 26618 58073 0.0 175.0 40.3% 0.1% 0.0% 0.0% 0.00sec 11435476 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo 120644 0 0 1.39 0 0 10.4 10.4 40.3% 0.1% 0.0% 0.0% 44.95sec 0 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_damage 120696 7454669 16545 3.72 182041 393789 10.4 27.9 40.2% 0.0% 0.0% 0.0% 44.95sec 7454669 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF halo_heal 120696 0 0 15.50 0 0 10.4 116.4 43.8% 0.0% 0.0% 0.0% 44.95sec 42551350 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_blast 8092 11197607 24851 6.00 170041 367039 45.1 45.1 39.9% 0.1% 0.0% 0.0% 10.08sec 11197607 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay ticks -15407 6629965 14733 14.01 42669 93159 65.4 105.1 40.5% 0.0% 0.0% 0.0% 6.64sec 6629965 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_flay_mastery 124468 3269746 7257 6.11 42751 113183 45.9 45.9 40.6% 0.1% 0.0% 0.0% 9.07sec 3269746 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear ticks -48045 11790 26 0.01 24264 52579 0.2 0.1 39.2% 0.0% 0.0% 0.0% 153.48sec 11790 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_sear_mastery 124469 5720 13 0.02 24118 63933 0.1 0.1 37.9% 0.1% 0.0% 0.0% 8.70sec 5720 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF mind_spike 73510 11293168 25064 7.00 145856 317125 52.6 52.6 40.3% 0.1% 0.0% 0.0% 8.32sec 11293168 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF multistrike_spell 0 5231236 11610 30.71 22681 0 230.6 230.6 0.0% 0.0% 0.0% 0.0% 2.01sec 5231236 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_death 32379 5067900 11247 2.09 219445 473897 15.7 15.7 40.5% 0.1% 0.0% 0.0% 4.67sec 5067900 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain ticks -589 17880345 39734 62.13 26133 56617 134.2 466.0 40.1% 0.0% 0.0% 0.0% 3.34sec 17880345 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadow_word_pain_mastery 124464 8927487 19813 27.07 26569 69787 203.5 203.3 40.2% 0.1% 0.0% 0.0% 2.19sec 8927487 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowy_apparition 78203 12468838 27673 35.43 31782 69115 268.7 266.1 40.4% 0.0% 0.0% 0.0% 1.66sec 12468838 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.64sec 0 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF stormlash 120687 559627 1242 0.40 113153 280915 3.0 3.0 43.7% 0.1% 0.0% 0.0% 90.86sec 559627 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch ticks -34914 10050221 22334 26.42 34379 74821 38.3 198.2 40.4% 0.0% 0.0% 0.0% 11.70sec 10050221 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF vampiric_touch_mastery 124465 4934425 10951 11.52 34386 90738 86.6 86.5 40.3% 0.1% 0.0% 0.0% 5.10sec 4934425 450.58sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend melee 0 4100203 115338 60.02 76538 179609 35.6 35.6 41.8% 0.1% 24.0% 0.0% 11.06sec 4100203 35.55sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.18sec 0 35.55sec
Priest_Shadow_T16H_FDCL_ToF Priest_Shadow_T16H_FDCL_ToF_shadowfiend stormlash 120687 13794 388 2.35 5872 14443 1.4 1.4 47.0% 0.2% 0.0% 0.0% 1.69sec 13794 35.55sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague 2944 5746769 12754 2.72 191960 416161 20.4 20.4 40.0% 0.1% 0.0% 0.0% 21.71sec 5746769 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_mastery 124467 4488361 9961 11.24 32225 84250 84.5 84.4 40.3% 0.1% 0.0% 0.0% 5.07sec 4488361 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI devouring_plague_tick ticks -2944 9136284 20303 25.79 32224 69546 20.4 193.4 40.2% 0.0% 0.0% 0.0% 21.71sec 9136284 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI essence_of_yulon ticks -146198 10737011 23860 22.35 25405 55242 0.0 167.7 40.3% 0.1% 0.0% 0.0% 0.00sec 10737011 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo 120644 0 0 1.42 0 0 10.7 10.7 40.4% 0.1% 0.0% 0.0% 43.90sec 0 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_damage 120696 5853223 12990 3.00 176635 381921 10.7 22.6 40.4% 0.0% 0.0% 0.0% 43.90sec 5853223 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI halo_heal 120696 0 0 15.64 0 0 10.7 117.5 43.8% 0.0% 0.0% 0.0% 43.90sec 41161163 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_blast 8092 14615974 32438 7.44 178975 386724 55.8 55.8 39.9% 0.1% 0.0% 0.0% 8.09sec 14615974 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay ticks -15407 8439223 18754 18.47 41200 89963 83.5 138.5 40.5% 0.0% 0.0% 0.0% 5.28sec 8439223 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_flay_mastery 124468 4151961 9215 8.06 41195 109082 60.5 60.5 40.4% 0.1% 0.0% 0.0% 7.09sec 4151961 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear ticks -48045 44044 98 0.04 23836 52264 0.5 0.3 39.9% 0.0% 0.0% 0.0% 119.45sec 44044 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mind_sear_mastery 124469 21554 48 0.07 23866 63304 0.5 0.5 39.3% 0.1% 0.0% 0.0% 29.63sec 21554 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI mindbender 123040 0 0 1.06 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.66sec 0 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI multistrike_spell 0 4811172 10678 31.40 20402 0 235.8 235.8 0.0% 0.0% 0.0% 0.0% 1.96sec 4811172 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_death 32379 4483437 9950 2.08 196071 422453 15.6 15.6 40.5% 0.1% 0.0% 0.0% 4.70sec 4483437 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain ticks -589 17285790 38413 62.83 24984 54136 142.1 471.2 40.1% 0.0% 0.0% 0.0% 3.15sec 17285790 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadow_word_pain_mastery 124464 8632466 19158 27.40 25379 66693 205.9 205.8 40.2% 0.1% 0.0% 0.0% 2.16sec 8632466 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowy_apparition 78203 12070154 26788 35.84 30388 66108 271.8 269.1 40.5% 0.0% 0.0% 0.0% 1.64sec 12070154 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI stormlash 120687 546314 1212 0.40 110858 277788 3.0 3.0 43.9% 0.1% 0.0% 0.0% 91.19sec 546314 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch ticks -34914 10090815 22424 27.57 33076 71979 37.5 206.8 40.4% 0.0% 0.0% 0.0% 11.98sec 10090815 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI vampiric_touch_mastery 124465 4907933 10892 12.02 32842 86577 90.3 90.2 40.2% 0.1% 0.0% 0.0% 4.89sec 4907933 450.58sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender melee 0 10513677 89779 58.01 64789 142864 113.2 113.2 40.7% 0.1% 24.0% 0.0% 3.88sec 10513677 117.11sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.18sec 0 117.11sec
Priest_Shadow_T16H_MB_DI Priest_Shadow_T16H_MB_DI_mindbender stormlash 120687 32766 280 2.14 4940 11686 4.2 4.2 43.1% 0.1% 0.0% 0.0% 77.42sec 32766 117.11sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague 2944 4738303 10516 2.27 191137 408529 17.1 17.1 40.0% 0.1% 0.0% 0.0% 26.03sec 4738303 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_mastery 124467 3685677 8180 9.38 31998 82726 70.6 70.5 40.1% 0.1% 0.0% 0.0% 6.02sec 3685677 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI devouring_plague_tick ticks -2944 7504224 16676 21.55 31899 68189 17.1 161.7 40.0% 0.0% 0.0% 0.0% 26.03sec 7504224 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI essence_of_yulon ticks -146198 11468150 25485 23.36 25704 55996 0.0 175.2 40.4% 0.1% 0.0% 0.0% 0.00sec 11468150 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo 120644 0 0 1.40 0 0 10.5 10.5 40.5% 0.1% 0.0% 0.0% 44.50sec 0 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_damage 120696 7680622 17046 3.93 177093 384004 10.5 29.5 40.2% 0.0% 0.0% 0.0% 44.50sec 7680622 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI halo_heal 120696 0 0 15.70 0 0 10.5 117.9 43.7% 0.0% 0.0% 0.0% 44.50sec 41181846 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_blast 8092 11971275 26568 6.00 182004 392557 45.0 45.0 39.9% 0.1% 0.0% 0.0% 10.08sec 11971275 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay ticks -15407 8589136 19087 18.34 42063 92207 82.4 137.5 40.6% 0.0% 0.0% 0.0% 5.33sec 8589136 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_flay_mastery 124468 4250771 9434 8.00 42239 112461 60.1 60.1 40.6% 0.1% 0.0% 0.0% 7.08sec 4250771 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear ticks -48045 47080 105 0.04 23838 52942 0.9 0.3 40.2% 0.0% 0.0% 0.0% 145.69sec 47080 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mind_sear_mastery 124469 23253 52 0.08 23850 64347 0.6 0.6 39.9% 0.1% 0.0% 0.0% 33.18sec 23253 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI mindbender 123040 0 0 1.06 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.64sec 0 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI multistrike_spell 0 4777955 10604 31.72 20061 0 238.2 238.2 0.0% 0.0% 0.0% 0.0% 1.95sec 4777955 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.26sec 0 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_death 32379 4521133 10034 2.09 196156 423211 15.7 15.7 40.3% 0.1% 0.0% 0.0% 4.67sec 4521133 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain ticks -589 18905560 42012 67.57 25360 55067 161.2 506.8 40.2% 0.0% 0.0% 0.0% 2.78sec 18905560 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadow_word_pain_mastery 124464 9444366 20960 29.45 25760 67881 221.4 221.2 40.3% 0.1% 0.0% 0.0% 2.01sec 9444366 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowy_apparition 78203 13236102 29376 38.61 30877 67335 292.9 289.9 40.5% 0.0% 0.0% 0.0% 1.52sec 13236102 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI stormlash 120687 574539 1275 0.40 114966 289646 3.0 3.0 44.0% 0.1% 0.0% 0.0% 91.51sec 574539 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch ticks -34914 10405257 23123 27.79 33683 73735 38.3 208.4 40.6% 0.0% 0.0% 0.0% 11.67sec 10405257 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI vampiric_touch_mastery 124465 5063984 11239 12.11 33438 88632 91.0 90.9 40.4% 0.1% 0.0% 0.0% 4.85sec 5063984 450.58sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender melee 0 10491256 89573 58.01 64726 142484 113.2 113.2 40.7% 0.1% 24.0% 0.0% 3.88sec 10491256 117.13sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.18sec 0 117.13sec
Priest_Shadow_T16H_MB_PI Priest_Shadow_T16H_MB_PI_mindbender stormlash 120687 32456 277 2.14 4912 11586 4.2 4.2 42.9% 0.1% 0.0% 0.0% 77.38sec 32456 117.13sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague 2944 5010904 11121 2.27 202281 432720 17.0 17.0 39.9% 0.1% 0.0% 0.0% 26.06sec 5010904 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_mastery 124467 3870925 8591 9.31 33879 87634 70.0 69.9 40.0% 0.1% 0.0% 0.0% 6.09sec 3870925 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF devouring_plague_tick ticks -2944 7846976 17438 21.37 33673 71920 17.0 160.3 40.0% 0.0% 0.0% 0.0% 26.06sec 7846976 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF essence_of_yulon ticks -146198 11522240 25605 22.73 26556 57740 0.0 170.5 40.3% 0.1% 0.0% 0.0% 0.00sec 11522240 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo 120644 0 0 1.39 0 0 10.5 10.5 40.3% 0.1% 0.0% 0.0% 44.77sec 0 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_damage 120696 8233252 18272 4.10 181822 394179 10.5 30.8 40.4% 0.0% 0.0% 0.0% 44.77sec 8233252 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF halo_heal 120696 0 0 15.73 0 0 10.5 118.1 43.7% 0.0% 0.0% 0.0% 44.77sec 42979501 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_blast 8092 12419793 27564 6.00 188917 407289 45.0 45.0 39.9% 0.1% 0.0% 0.0% 10.08sec 12419793 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay ticks -15407 8214715 18255 17.40 42594 92954 81.7 130.5 40.4% 0.0% 0.0% 0.0% 5.37sec 8214715 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_flay_mastery 124468 4056793 9003 7.59 42789 113141 57.0 57.0 40.5% 0.1% 0.0% 0.0% 7.44sec 4056793 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear ticks -48045 40208 89 0.04 24487 53321 1.0 0.3 39.9% 0.0% 0.0% 0.0% 150.00sec 40208 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mind_sear_mastery 124469 19697 44 0.06 24498 64683 0.5 0.5 39.7% 0.1% 0.0% 0.0% 38.17sec 19697 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF mindbender 123040 0 0 1.06 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.64sec 0 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF multistrike_spell 0 4859507 10785 30.80 21008 0 231.3 231.3 0.0% 0.0% 0.0% 0.0% 2.02sec 4859507 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_death 32379 5135856 11398 2.09 223325 481260 15.7 15.7 40.4% 0.1% 0.0% 0.0% 4.68sec 5135856 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain ticks -589 18861807 41915 65.52 26153 56647 159.1 491.4 40.1% 0.0% 0.0% 0.0% 2.81sec 18861807 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadow_word_pain_mastery 124464 9427309 20923 28.57 26588 69844 214.7 214.6 40.2% 0.1% 0.0% 0.0% 2.08sec 9427309 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowy_apparition 78203 13161311 29210 37.35 31817 69171 283.3 280.5 40.4% 0.0% 0.0% 0.0% 1.57sec 13161311 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF stormlash 120687 538884 1196 0.39 113241 280855 2.9 2.9 43.6% 0.1% 0.0% 0.0% 94.29sec 538884 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch ticks -34914 10112465 22472 26.61 34365 74747 38.5 199.6 40.4% 0.0% 0.0% 0.0% 11.62sec 10112465 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF vampiric_touch_mastery 124465 4955973 10999 11.60 34339 90478 87.2 87.1 40.2% 0.1% 0.0% 0.0% 5.07sec 4955973 450.58sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender melee 0 10433123 89082 58.01 64442 141807 113.2 113.2 40.6% 0.1% 24.0% 0.0% 3.88sec 10433123 117.12sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.18sec 0 117.12sec
Priest_Shadow_T16H_MB_ToF Priest_Shadow_T16H_MB_ToF_mindbender stormlash 120687 32431 277 2.14 4918 11575 4.2 4.2 42.9% 0.1% 0.0% 0.0% 78.15sec 32431 117.12sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague 2944 5694371 12638 2.69 192108 416634 20.2 20.2 40.0% 0.1% 0.0% 0.0% 21.95sec 5694371 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_mastery 124467 4433157 9839 11.11 32227 84204 83.6 83.5 40.3% 0.1% 0.0% 0.0% 5.12sec 4433157 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI devouring_plague_tick ticks -2944 9034867 20077 25.54 32179 69435 20.2 191.6 40.2% 0.0% 0.0% 0.0% 21.95sec 9034867 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI essence_of_yulon ticks -146198 10706020 23791 22.30 25405 55235 0.0 167.3 40.4% 0.1% 0.0% 0.0% 0.00sec 10706020 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo 120644 0 0 1.38 0 0 10.4 10.4 40.6% 0.1% 0.0% 0.0% 45.06sec 0 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_damage 120696 5873495 13035 3.02 176375 381813 10.4 22.7 40.3% 0.0% 0.0% 0.0% 45.06sec 5873495 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI halo_heal 120696 0 0 15.38 0 0 10.4 115.5 43.7% 0.0% 0.0% 0.0% 45.06sec 40409484 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_blast 8092 14471243 32117 7.36 178933 386447 55.3 55.3 40.0% 0.1% 0.0% 0.0% 8.16sec 14471243 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay ticks -15407 5594253 12432 12.09 41435 91377 53.2 90.7 40.6% 0.0% 0.0% 0.0% 8.04sec 5594253 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_mastery 124468 2759605 6125 5.27 41517 111088 39.6 39.6 40.7% 0.1% 0.0% 0.0% 10.54sec 2759605 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity ticks -129197 7879652 17510 8.78 81891 175812 38.5 65.8 40.3% 0.0% 0.0% 0.0% 11.15sec 7879652 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_flay_insanity_mastery 124468 3499171 7766 3.82 74340 193171 28.7 28.7 40.1% 0.1% 0.0% 0.0% 14.62sec 3499171 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear ticks -48045 28190 63 0.03 23839 52090 0.4 0.2 39.8% 0.0% 0.0% 0.0% 128.02sec 28190 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI mind_sear_mastery 124469 13860 31 0.05 23834 63215 0.3 0.3 40.3% 0.1% 0.0% 0.0% 23.10sec 13860 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI multistrike_spell 0 4987654 11069 31.01 21420 0 232.8 232.8 0.0% 0.0% 0.0% 0.0% 1.99sec 4987654 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_death 32379 4416664 9802 2.05 195398 421423 15.4 15.4 40.3% 0.1% 0.0% 0.0% 4.75sec 4416664 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain ticks -589 16960876 37691 61.68 24980 54117 141.2 462.6 40.1% 0.0% 0.0% 0.0% 3.17sec 16960876 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadow_word_pain_mastery 124464 8467316 18792 26.90 25365 66670 202.2 202.0 40.1% 0.1% 0.0% 0.0% 2.20sec 8467316 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowy_apparition 78203 11831148 26257 35.17 30372 66074 266.5 264.1 40.4% 0.0% 0.0% 0.0% 1.67sec 11831148 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI stormlash 120687 552540 1226 0.40 110266 275487 3.0 3.0 43.5% 0.1% 0.0% 0.0% 90.95sec 552540 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch ticks -34914 8927560 19839 24.44 32992 71911 33.1 183.3 40.4% 0.0% 0.0% 0.0% 13.53sec 8927560 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI vampiric_touch_mastery 124465 4369099 9697 10.65 32896 86902 80.1 80.0 40.2% 0.1% 0.0% 0.0% 5.50sec 4369099 450.58sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend melee 0 4084960 114909 60.02 76414 179057 35.6 35.6 41.6% 0.1% 23.9% 0.0% 11.07sec 4084960 35.55sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.20sec 0 35.55sec
Priest_Shadow_T16H_MFI_DI Priest_Shadow_T16H_MFI_DI_shadowfiend stormlash 120687 13725 386 2.35 5833 14353 1.4 1.4 47.1% 0.1% 0.0% 0.0% 1.75sec 13725 35.55sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague 2944 4729347 10496 2.27 190976 408517 17.0 17.0 40.0% 0.1% 0.0% 0.0% 26.06sec 4729347 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_mastery 124467 3678965 8165 9.36 32010 82770 70.4 70.3 40.1% 0.1% 0.0% 0.0% 6.04sec 3678965 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI devouring_plague_tick ticks -2944 7482647 16628 21.52 31871 68134 17.0 161.4 40.0% 0.0% 0.0% 0.0% 26.06sec 7482647 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI essence_of_yulon ticks -146198 11598976 25776 23.41 25680 55973 0.0 175.6 40.3% 0.1% 0.0% 0.0% 0.00sec 11598976 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo 120644 0 0 1.37 0 0 10.3 10.3 40.5% 0.1% 0.0% 0.0% 45.53sec 0 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_damage 120696 8050142 17866 4.12 176729 384678 10.3 30.9 40.2% 0.0% 0.0% 0.0% 45.53sec 8050142 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI halo_heal 120696 0 0 15.83 0 0 10.3 118.9 43.7% 0.0% 0.0% 0.0% 45.53sec 41513041 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_blast 8092 11963214 26551 6.00 182070 392142 45.1 45.1 39.8% 0.1% 0.0% 0.0% 10.08sec 11963214 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay ticks -15407 6109793 13577 12.72 42760 94806 52.9 95.4 40.9% 0.0% 0.0% 0.0% 8.13sec 6109793 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_mastery 124468 3040755 6749 5.55 43032 116000 41.7 41.7 41.1% 0.1% 0.0% 0.0% 10.03sec 3040755 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity ticks -129197 5872081 13049 6.64 81157 173019 33.9 49.8 40.0% 0.0% 0.0% 0.0% 12.57sec 5872081 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_flay_insanity_mastery 124468 2817527 6253 2.89 79601 205023 21.7 21.7 40.0% 0.1% 0.0% 0.0% 19.08sec 2817527 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear ticks -48045 17940 40 0.02 24186 51931 0.5 0.1 40.2% 0.0% 0.0% 0.0% 171.23sec 17940 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI mind_sear_mastery 124469 8947 20 0.03 24179 63167 0.2 0.2 40.7% 0.1% 0.0% 0.0% 6.35sec 8947 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI multistrike_spell 0 4969847 11030 31.79 20816 0 238.7 238.7 0.0% 0.0% 0.0% 0.0% 1.95sec 4969847 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.66sec 0 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_death 32379 4495872 9978 2.08 196102 423075 15.6 15.6 40.5% 0.1% 0.0% 0.0% 4.70sec 4495872 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain ticks -589 18816598 41815 67.32 25342 55009 162.5 504.9 40.2% 0.0% 0.0% 0.0% 2.76sec 18816598 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadow_word_pain_mastery 124464 9407910 20879 29.35 25749 67837 220.6 220.4 40.3% 0.1% 0.0% 0.0% 2.02sec 9407910 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowy_apparition 78203 13184083 29260 38.48 30857 67276 291.8 289.0 40.5% 0.0% 0.0% 0.0% 1.53sec 13184083 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI stormlash 120687 575945 1278 0.40 115099 289713 3.0 3.0 43.6% 0.1% 0.0% 0.0% 92.02sec 575945 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch ticks -34914 10109936 22467 26.99 33688 73778 37.7 202.4 40.5% 0.0% 0.0% 0.0% 11.84sec 10109936 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI vampiric_touch_mastery 124465 4921458 10922 11.77 33444 88771 88.4 88.4 40.3% 0.1% 0.0% 0.0% 4.99sec 4921458 450.58sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend melee 0 4089639 115067 60.02 76392 179112 35.6 35.6 41.8% 0.1% 23.9% 0.0% 11.07sec 4089639 35.54sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.20sec 0 35.54sec
Priest_Shadow_T16H_MFI_PI Priest_Shadow_T16H_MFI_PI_shadowfiend stormlash 120687 13541 381 2.34 5819 14354 1.4 1.4 46.6% 0.1% 0.0% 0.0% 1.67sec 13541 35.54sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague 2944 4996710 11089 2.26 202173 432294 17.0 17.0 39.9% 0.1% 0.0% 0.0% 26.08sec 4996710 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_mastery 124467 3860930 8569 9.29 33877 87554 69.9 69.8 40.0% 0.1% 0.0% 0.0% 6.08sec 3860930 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF devouring_plague_tick ticks -2944 7819972 17378 21.32 33639 71865 17.0 159.9 39.9% 0.0% 0.0% 0.0% 26.08sec 7819972 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF essence_of_yulon ticks -146198 11638325 25863 22.79 26563 57789 0.0 170.9 40.3% 0.1% 0.0% 0.0% 0.00sec 11638325 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo 120644 0 0 1.37 0 0 10.3 10.3 40.5% 0.1% 0.0% 0.0% 45.55sec 0 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_damage 120696 8259813 18331 4.11 182046 395218 10.3 30.9 40.2% 0.0% 0.0% 0.0% 45.55sec 8259813 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF halo_heal 120696 0 0 15.78 0 0 10.3 118.5 43.7% 0.0% 0.0% 0.0% 45.55sec 43116627 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_blast 8092 12433719 27595 6.00 189065 407141 45.1 45.1 39.9% 0.1% 0.0% 0.0% 10.08sec 12433719 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay ticks -15407 5649400 12554 11.78 42890 94625 51.9 88.4 40.7% 0.0% 0.0% 0.0% 8.26sec 5649400 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_mastery 124468 2803828 6223 5.14 43162 115650 38.6 38.6 40.8% 0.1% 0.0% 0.0% 10.84sec 2803828 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity ticks -129197 6122982 13607 6.60 85156 181596 33.8 49.5 40.0% 0.0% 0.0% 0.0% 12.61sec 6122982 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_flay_insanity_mastery 124468 2936456 6517 2.88 83430 214863 21.6 21.6 40.0% 0.1% 0.0% 0.0% 19.26sec 2936456 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear ticks -48045 10373 23 0.01 24327 52527 0.6 0.1 39.9% 0.0% 0.0% 0.0% 172.90sec 10373 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_tick 49821 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF mind_sear_mastery 124469 5076 11 0.02 24404 63588 0.1 0.1 39.6% 0.1% 0.0% 0.0% 15.47sec 5076 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF multistrike_spell 0 5041105 11188 30.85 21757 0 231.7 231.7 0.0% 0.0% 0.0% 0.0% 2.01sec 5041105 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_death 32379 5097095 11312 2.07 223501 480753 15.6 15.6 40.4% 0.1% 0.0% 0.0% 4.71sec 5097095 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain ticks -589 18803687 41786 65.36 26130 56582 160.7 490.2 40.2% 0.0% 0.0% 0.0% 2.78sec 18803687 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadow_word_pain_mastery 124464 9394701 20850 28.50 26563 69784 214.2 214.0 40.2% 0.1% 0.0% 0.0% 2.08sec 9394701 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowy_apparition 78203 13135371 29152 37.30 31783 69117 282.8 280.1 40.5% 0.0% 0.0% 0.0% 1.58sec 13135371 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.67sec 0 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF stormlash 120687 535778 1189 0.38 113154 280773 2.9 2.9 43.7% 0.1% 0.0% 0.0% 93.87sec 535778 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch ticks -34914 9772325 21716 25.76 34291 74622 37.7 193.2 40.4% 0.0% 0.0% 0.0% 11.82sec 9772325 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF vampiric_touch_mastery 124465 4792323 10636 11.23 34285 90396 84.4 84.3 40.2% 0.1% 0.0% 0.0% 5.20sec 4792323 450.58sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend melee 0 4072348 114576 60.02 76171 178515 35.6 35.6 41.7% 0.1% 24.0% 0.0% 11.08sec 4072348 35.54sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.19sec 0 35.54sec
Priest_Shadow_T16H_MFI_ToF Priest_Shadow_T16H_MFI_ToF_shadowfiend stormlash 120687 13802 388 2.38 5815 14310 1.4 1.4 46.8% 0.2% 0.0% 0.0% 1.73sec 13802 35.54sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|&chxp=1,1,-nan,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.84% 7.84%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.41% 8.41%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.60% 10.60%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.93% 10.93%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.34% 11.34%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.56% 10.56%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.87% 11.87%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.73% 10.73%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.44% 6.44%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target{$?s146963=false}[ and $146963s1 additional nearby targets][], increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2431800.58
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 25360
death count pct 101.44
avg death time 450.55
min death time 346.59
max death time 556.49
dmg taken 1096164344.58

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24992
Mean 450.58
Minimum 346.59
Maximum 556.49
Spread ( max - min ) 209.90
Range [ ( max - min ) / 2 * 100% ] 23.29%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 2435397.30
Minimum 2331187.85
Maximum 2566023.40
Spread ( max - min ) 234835.55
Range [ ( max - min ) / 2 * 100% ] 4.82%
Standard Deviation 34205.1507
5th Percentile 2381528.00
95th Percentile 2493536.72
( 95th Percentile - 5th Percentile ) 112008.72
Mean Distribution
Standard Deviation 216.3670
95.00% Confidence Intervall ( 2434973.23 - 2435821.37 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 757
0.1 Scale Factor Error with Delta=300 9987727
0.05 Scale Factor Error with Delta=300 39950909
0.01 Scale Factor Error with Delta=300 998772747
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 876357312 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Speed 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 24835
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

Fluffy_Pillow_Add1 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
492457.8 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add1 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|&chxp=1,1,-nan,100 http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add1 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.2s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 492457.75
Combat End Resource Mean Min Max
Health 1092521449.46 872490324.60 1313555587.78

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 24992
Mean 94.17
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.55%
DPS
Sample Data Add1 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add1 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 24992
Mean 493025.38
Minimum 379297.38
Maximum 598370.22
Spread ( max - min ) 219072.84
Range [ ( max - min ) / 2 * 100% ] 22.22%
HPS
Sample Data Add1 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add1 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add2 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
458974.5 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add2 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|&chxp=1,1,-nan,100 http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add2 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.2s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 458974.47
Combat End Resource Mean Min Max
Health 1092579646.78 871920829.06 1313720867.87

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 24992
Mean 94.17
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.55%
DPS
Sample Data Add2 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add2 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 24992
Mean 459318.59
Minimum 358505.98
Maximum 558000.70
Spread ( max - min ) 199494.72
Range [ ( max - min ) / 2 * 100% ] 21.72%
HPS
Sample Data Add2 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add2 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Fluffy_Pillow_Add3 : 0 dps

Results

RPS Out RPS In Primary Resource Waiting APM Active Skill
462160.7 0.0 Health 100.01% 0.0 20.9% 100%

Charts

DPS Taken Timeline Chart
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Add3 DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|&chxp=1,1,-nan,100 http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow_Add3 Spent Time&chts=dddddd,18&chs=550x275&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 94.2s&

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 462160.67
Combat End Resource Mean Min Max
Health 1092563378.57 872358387.04 1313280776.37

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 24992
Mean 94.17
Minimum 70.00
Maximum 120.00
Spread ( max - min ) 50.00
Range [ ( max - min ) / 2 * 100% ] 26.55%
DPS
Sample Data Add3 Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Add3 Damage per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 24992
Mean 462719.85
Minimum 359143.76
Maximum 562698.86
Spread ( max - min ) 203555.11
Range [ ( max - min ) / 2 * 100% ] 22.00%
HPS
Sample Data Add3 Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Add3 Healing per Second (effective)
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing taken Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS Error Chart

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

DTPS

Average damage taken per second per active player duration.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Lower is better.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.