Player Priest_Shadow_T15H_FDCL_ToF_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_MB_ToF_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_MFI_ToF_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_FDCL_PI_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_MB_PI_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_MFI_PI_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_FDCL_DI_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_MB_DI_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932

Player Priest_Shadow_T15H_MFI_DI_No_LMG at slot neck has inconsistency between name 'soul_prism_of_lei_shen' and 'soul_prism_of_leishen' for id 96932
close

SimulationCraft 520-8

for World of Warcraft 5.2.0 Live (build level 16650)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

Priest_Shadow_T15H_FDCL_DI_No_LMG : 141038 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
141038.4 141038.4 60.08 / 0.04% 7982 / 5.7% 27.1 4954.6 4621.9 Mana 0.70% 42.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_DI_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:528805|231652|179334|146722|144858|139024|118769|73078&chds=0,1057610&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++528805++devouring_plague,9482C9,0,0,15|t++231652++vampiric_touch,9482C9,1,0,15|t++179334++halo,9482C9,2,0,15|t++146722++shadow_word_pain,9482C9,3,0,15|t++144858++shadow_word_death,9482C9,4,0,15|t++139024++mind_blast,9482C9,5,0,15|t++118769++mind_spike,4A79D3,6,0,15|t++73078++mind_flay,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_DI_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:18,12,11,9,9,8,6,5,5,5,4,3,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_DI_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:5866532200zz100yxwusoljigfffefefgfggffeeeddddeededcbaZZXXXWWWWXXXWWWWWVWWWXYZZZZZYYYXXXXXXXYYYZYXXXWWWWWXXYYYYXWVUUTTTUUUUVVVUVUUUUVWWXYZZZYYYYXXWWWWWXXXXXXXXXXXXXXYYZZaaZYXYYYZaabcdeffffeeeeefffffeedcbaZYXYXXXYYZZZYYYYXXXWXXXYYYZYWVUUTTTTTUVVVVVVVUUUVWWXYZZZZZYYXXWWWWWXXXXYXXXXWWWXXYYZZaaZYYXXWXXXXYYZZZYZYYYYYZZZabbbbaaaZZYZZZZZaaaaaaaaZZZZZZaabbbaYXWWWYYZabcdefffffffghijjjiihhfedcaaaaaabbbbbbbbaaaabbcdddddccbbbcbbbcccccccccbbccccdddeeeedddcddddeeeffeeeeeeeeeeeffffecbbaZaZZZZZaaaaaaaaZbcddeffggggfffefffffffffefefeeeeeeffffffdedddefgghhijjjjjihgggfhggfeddcaZYX&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4524,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=141038|max=311742&chxp=1,1,45,100& http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_DI_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,1,1,3,6,10,22,47,66,119,174,267,392,496,686,906,1145,1260,1439,1591,1622,1697,1728,1638,1472,1470,1224,1112,909,774,623,501,411,327,263,174,116,93,70,47,25,23,11,15,3,4,4,2,1&chds=0,1728&chbh=5&chxt=x&chxl=0:|min=121746|avg=141038|max=162669&chxp=0,1,47,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_DI_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:42.8,12.8,11.7,9.1,7.0,4.5,3.6,2.6,0.7,0.0,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 193.4s|shadow_word_pain 57.8s|mind_blast 53.0s|mind_spike 41.1s|vampiric_touch 31.5s|devouring_plague 20.2s|shadow_word_death 16.3s|halo 11.8s|shadowfiend 3.2s|dispersion 0.0s|waiting 3.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_FDCL_DI_No_LMG 141038
devouring_plague 8068 (23687) 5.7% (16.8%) 19.3 24.07sec 552837 528805 147758 304649 188354 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.34 19.34 0.00 0.00 1.0455 0.0000 3642912.16 3642912.16 0.00 528804.96 528804.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.34 74.13% 147758.45 126181 216480 147777.83 129399 174529 2118358 2118358 0.00
crit 5.00 25.87% 304649.25 252361 519552 303198.22 0 482117 1524554 1524554 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3724 2.6% 51.9 8.65sec 32393 0 25260 52599 32438 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.87 51.80 0.00 0.00 0.0000 0.0000 1680170.72 1680170.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.20 73.75% 25260.24 21031 36081 25275.89 22103 30163 964904 964904 0.00
crit 13.60 26.25% 52598.51 42061 86594 52618.17 42061 70732 715267 715267 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 11894 8.4% 19.3 24.07sec 277615 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.8 24665 50913 31442 25.8% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.34 19.34 170.77 170.77 0.0000 0.6588 5369353.36 5369353.36 0.00 47725.46 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 74.18% 24665.01 21031 53243 24671.21 22014 27982 3124437 3124437 0.00
crit 44.1 25.82% 50913.29 42061 106487 50896.52 43719 60264 2244916 2244916 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4684) 0.0% (3.3%) 11.3 41.42sec 187380 179334 0 0 0 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 1.0449 0.0000 0.00 0.00 0.00 179334.45 179334.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.30 73.59% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.98 26.41% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4684 3.3% 11.3 41.42sec 187380 0 146312 302118 187376 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 0.0000 0.0000 2113097.78 2113097.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.30 73.64% 146311.65 124529 199208 146366.93 124529 190608 1215059 1215059 0.00
crit 2.97 26.36% 302117.73 249057 478099 291949.90 0 478099 898038 898038 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.42sec 0 0 0 0 0 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.28 121.95 0.00 0.00 0.0000 0.0000 0.00 31996646.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.67 70.25% 0.00 0 0 0.00 0 0 0 17008542 100.00
crit 36.28 29.75% 0.00 0 0 0.00 0 0 0 14988104 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 16310 11.6% 48.3 9.30sec 152514 139024 119277 247184 152516 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.28 48.28 0.00 0.00 1.0971 0.0000 7363684.37 7363684.37 0.00 139024.00 139024.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.74 74.01% 119277.25 100626 173731 119315.38 107120 137640 4262423 4262423 0.00
crit 12.55 25.99% 247183.86 201251 416954 247221.63 201251 314695 3101261 3101261 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 24033 (31330) 17.0% (22.2%) 129.2 3.43sec 109441 73078 0 0 0 0.0% 0.0% 0.0% 0.0% 262.8 31993 67390 41260 26.2% 0.0% 37.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.15 129.15 262.79 262.79 1.4976 0.6510 10842768.74 10842768.74 0.00 73078.21 73078.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.0 73.82% 31993.10 26761 45908 32010.85 29506 35460 6206579 6206579 0.00
crit 68.8 26.18% 67390.48 53521 110180 67422.62 60046 77965 4636189 4636189 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7297 5.2% 79.9 5.49sec 41221 0 31994 67316 41244 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.86 79.82 0.00 0.00 0.0000 0.0000 3292018.31 3292018.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.91 73.81% 31993.63 26761 45908 32011.10 28400 36429 1884876 1884876 0.00
crit 20.90 26.19% 67315.68 53521 110180 67343.22 54867 82730 1407142 1407142 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 10820 7.7% 39.3 11.07sec 124131 118769 96996 201164 124130 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.34 39.34 0.00 0.00 1.0452 0.0000 4883168.57 4883168.57 0.00 118768.54 118768.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.09 73.95% 96995.84 81656 141580 97028.06 85417 115248 2821712 2821712 0.00
crit 10.25 26.05% 201163.88 163313 339793 201242.51 0 307488 2061457 2061457 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=15198 to 15270} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 5232 3.7% 15.6 4.96sec 151550 144858 118401 244248 151551 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.62 15.62 0.00 0.00 1.0462 0.0000 2367551.71 2367551.71 0.00 144857.54 144857.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.51 73.66% 118401.39 98214 170056 118578.01 99921 158472 1362442 1362442 0.00
crit 4.12 26.34% 244247.65 196429 408134 242002.49 0 408134 1005110 1005110 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 14382 (18777) 10.2% (13.3%) 55.3 8.10sec 153291 146722 0 0 0 0.0% 0.0% 0.0% 0.0% 275.5 18480 38136 23568 25.9% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.31 55.31 275.53 275.53 1.0448 1.5779 6493800.11 6493800.11 0.00 17212.56 146722.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 204.2 74.11% 18479.69 15692 26913 18486.49 16764 21294 3773633 3773633 0.00
crit 71.3 25.89% 38136.04 31384 64590 38134.49 33900 44150 2720168 2720168 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4395 3.1% 83.7 5.30sec 23714 0 18558 38437 23733 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.67 83.60 0.00 0.00 0.0000 0.0000 1984111.00 1984111.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.84 73.97% 18558.34 15692 26913 18565.90 16862 21382 1147658 1147658 0.00
crit 21.76 26.03% 38436.68 31384 64590 38446.02 32024 47526 836453 836453 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 1.0577 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6098 4.3% 93.1 4.78sec 29579 0 23476 48703 30075 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.07 91.54 0.00 0.00 0.0000 0.0000 2753074.24 2753074.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.60 73.84% 23475.87 19578 33939 23479.19 21272 27156 1586894 1586894 0.00
crit 23.95 26.16% 48702.69 39157 81453 48701.37 40417 59655 1166180 1166180 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1340 0.9% 23.8 13.49sec 24995 0 17773 42132 24995 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.84 23.84 0.00 0.00 0.0000 0.0000 595823.72 595823.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.77 70.35% 17772.77 12216 21407 17780.72 14078 20984 298060 298060 0.00
crit 7.07 29.65% 42131.71 24432 51377 42139.16 0 51377 297764 297764 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12871.08
  • base_dd_max:12871.08
vampiric_touch 12416 (16150) 8.8% (11.5%) 30.1 15.02sec 241989 231652 0 0 0 0.0% 0.0% 0.0% 0.0% 204.8 21309 44413 27352 26.2% 0.0% 88.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.11 30.11 204.82 204.82 1.0446 1.9502 5602054.97 5602054.97 0.00 16911.77 231652.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.3 73.85% 21309.32 17688 30939 21321.84 19422 23990 3223078 3223078 0.00
crit 53.6 26.15% 44413.44 35377 74252 44430.84 38594 51724 2378977 2378977 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3734 2.6% 62.2 7.07sec 27076 0 21142 43966 27099 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.23 62.18 0.00 0.00 0.0000 0.0000 1685024.40 1685024.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.95 73.90% 21142.47 17688 30939 21151.34 18768 24050 971572 971572 0.00
crit 16.23 26.10% 43965.78 35377 74252 43982.92 35377 59060 713452 713452 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 83268 / 6611
melee 82979 4.6% 35.4 11.16sec 83004 92407 62532 148549 83003 27.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.45 35.45 0.00 0.00 0.8983 0.0000 2942339.49 2942339.49 0.00 92407.26 92407.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.05 48.09% 62532.15 42818 84472 62637.18 48687 80068 1065891 1065891 0.00
crit 9.90 27.93% 148549.37 98481 202733 148605.29 101031 202733 1470911 1470911 0.00
glance 8.50 23.98% 47705.21 32114 63354 47735.10 34522 63354 405537 405537 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0501 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 289 0.0% 7.0 0.74sec 1451 0 987 2369 1451 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 10154.03 10154.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.65 66.43% 986.74 828 988 986.36 0 988 4589 4589 0.00
crit 2.35 33.57% 2368.58 1987 2371 2237.08 0 2371 5565 5565 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:988.00
  • base_dd_max:988.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 33.33%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.8 1.8 81.2sec 59.9sec 28.98% 28.98%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:28.98%

    Trigger Attempt Success

    • trigger_pct:99.77%
chayes_essence_of_brilliance 11.0 3.0 41.8sec 32.3sec 27.75% 27.75%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.75%

    Trigger Attempt Success

    • trigger_pct:99.83%
divine_insight_shadow 17.2 0.7 24.6sec 23.6sec 5.57% 32.28%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.57%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.6 11.7 31.5sec 17.1sec 52.80% 52.80%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:52.80%

    Trigger Attempt Success

    • trigger_pct:99.29%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.3sec 10.3sec 10.06% 49.42%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.06%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 34.3 5.7 12.7sec 10.9sec 18.99% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.64%
  • surge_of_darkness_2:1.37%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.22% 14.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.22%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.8sec 74.8sec 83.41% 80.64%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.76% 72.86%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.38% 16.38%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.69% 5.69%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.69%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_FDCL_DI_No_LMG
devouring_plague Shadow Orb 19.3 58.0 3.0 3.0 184277.4
halo Mana 11.3 456718.5 40500.0 40499.7 4.6
mind_blast Mana 48.3 271068.8 5614.3 5614.3 27.2
mind_flay Mana 129.2 387463.2 3000.0 3000.0 36.5
shadow_word_death Mana 15.6 121858.8 7800.0 7800.3 19.4
shadow_word_pain Mana 55.3 730030.8 13200.0 13199.8 11.6
vampiric_touch Mana 30.1 271019.2 9000.0 9000.0 26.9
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.01 264.24 (0.01%) 18000.00 0.00 0.00%
shadowfiend Mana 35.45 255216.18 (12.22%) 7199.67 63818.70 20.00%
Shadow Orbs from Mind Blast Shadow Orb 48.28 48.26 (85.93%) 1.00 0.02 0.05%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.90 7.90 (14.07%) 1.00 0.00 0.00%
Devouring Plague Health Health 222.57 0.00 (-nan%) 0.00 3789339.72 100.00%
Vampiric Touch Mana Mana 267.00 1319319.37 (63.19%) 4941.32 96122.99 6.79%
mp5_regen Mana 1806.42 513039.37 (24.57%) 284.01 28887.10 5.33%
Resource RPS-Gain RPS-Loss
Mana 4621.88 4954.64
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 148981.79 0.00 300000.00
Shadow Orb 1.12 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.5%
shadowfiend-Mana Cap 5.5%
lightwell-Mana Cap 5.5%

Procs

Count Interval
Shadowy Recall Extra Tick 277.4 1.6sec
Shadowy Apparition Procced 93.1 4.8sec
Divine Insight Mind Blast CD Reset 31.8 23.6sec
FDCL Mind Spike proc 40.0 10.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_FDCL_DI_No_LMG Damage Per Second
Count 24992
Mean 141038.40
Minimum 121746.22
Maximum 162668.84
Spread ( max - min ) 40922.63
Range [ ( max - min ) / 2 * 100% ] 14.51%
Standard Deviation 4845.5973
5th Percentile 133439.09
95th Percentile 149402.26
( 95th Percentile - 5th Percentile ) 15963.16
Mean Distribution
Standard Deviation 30.6512
95.00% Confidence Intervall ( 140978.32 - 141098.47 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4534
0.1 Scale Factor Error with Delta=300 200437
0.05 Scale Factor Error with Delta=300 801748
0.01 Scale Factor Error with Delta=300 20043719
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 141038.40
Distribution Chart

Damage

Sample Data
Count 24992
Mean 60668614.13
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_FDCL_DI_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_FDCL_DI_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_FDCL_DI_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 320.29
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.02 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 5.51 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 52.95 mind_blast,if=active_enemies<=6&cooldown_react
E 7.90 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 0.00 mind_flay_insanity,interrupt=1,chain=1
H 7.72 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 6.03 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 14.81 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 3.59 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 13.49 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 15.37 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 13.83 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 11.28 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.69 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 21.52 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 35.75 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 69.05 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 35.78 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

ACIPDJWTDUUWLMUTDWUWUWZZZZDMCDUWPUTDWKMLUWDOWUZZMDWUWTDWMUWLTDOPWZZZDZJWDWUWMTDKLOUWIZZDJPWDUWMWLTDOWZUZZDJWUWDWMPLWDOWAZZDJUWDKUWMLWDOTTTDWPZDZJWTDOUWWMWDLUWIDZJWPDOWWMUWDLTTTTTTKDUWZZZZDJOWDWMWLPTDUUWUWZUDJOWTDWTTDWMLWTDOKUWUZZZDJPWTDUWWMLDOWUDWIAZDJWTDOUPWDMDLDCEHUWZZZZZDECHDJUWWEDCHLUMWDEHDOPWEH8DIJWWECDHWUUMWLDECHUZUWDMS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_FDCL_DI_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000222
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_FDCL_PI_No_LMG : 141960 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
141959.6 141959.6 58.62 / 0.04% 7740 / 5.5% 26.8 5034.7 4744.3 Mana 0.37% 40.3 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_PI_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:555673|254541|185097|147148|144798|128486|120880|79786&chds=0,1111346&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++555673++devouring_plague,9482C9,0,0,15|t++254541++vampiric_touch,9482C9,1,0,15|t++185097++halo,9482C9,2,0,15|t++147148++shadow_word_death,9482C9,3,0,15|t++144798++shadow_word_pain,9482C9,4,0,15|t++128486++mind_blast,9482C9,5,0,15|t++120880++mind_spike,4A79D3,6,0,15|t++79786++mind_flay,9482C9,7,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_PI_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:20,11,10,9,9,7,6,5,5,5,4,4,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|mind_flay_mastery|shadowy_apparition|shadowfiend: melee|devouring_plague|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|shadowfiend: stormlash&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_PI_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:687775332101201yxvurnkhfdbbbbaaabcccbbbaaZZZaaaaZYXWVUTRRRRRSSSTTSSSSSSSSSTUWVVVVUUTTSTTTTTUUUUTTSSSSSSSTTUUUUTSRRQQRRRRSTUUVUUUUUUVWWXYZYYXXWWVUUUUUUUUUUUTTUUTTTTTUVWVVVVUTUUUVWWXYZZaaaaaZZYZZZZaaZYYXXVUTTTTTTUUUVVUUUUUTTSSTUUUUUTSRRQPQQQRSTUVVVUVVVVVWXYZZZZZYXWVUUUUUUUUUUUTTTTTTTTTUVWVVWVUUTTTUTTTUUVVVUUUUUTUUUVVWWWWWWVVUUVUUVVWWWWWWWVVVVVVVWWWWWVUTSSSUVVWYabdeeeeeeefghiijihgfecaZYYYYYYYYYYXXXXXWWWWXYZYYYYXXXXWXXXXXXYYYXXXXWWWXWXYZYYYYYYYXXYYYZZZZaaZZZZZZZZYZZaaaaZXXWVVWWWWWWXYYYYYYYYZabcdeeeeeedccbcdcccccbbaabaaaaZZZabaaaaZZZYYabbccddeeedddcbddccccaZYYXWVUU&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3972,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=141960|max=357437&chxp=1,1,40,100& http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_PI_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,0,5,8,28,45,57,111,152,235,350,560,664,867,1001,1133,1382,1506,1580,1610,1593,1581,1529,1366,1248,1098,998,885,675,600,518,386,310,239,190,132,101,69,54,43,28,18,9,10,7,8,0,1,1&chds=0,1610&chbh=5&chxt=x&chxl=0:|min=125199|avg=141960|max=163119&chxp=0,1,44,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_PI_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:44.2,13.9,9.7,9.6,6.9,3.7,3.5,2.6,0.7,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 199.6s|shadow_word_pain 63.0s|mind_spike 43.9s|mind_blast 43.2s|vampiric_touch 31.3s|shadow_word_death 16.5s|devouring_plague 16.0s|halo 11.8s|shadowfiend 3.2s|waiting 1.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_FDCL_PI_No_LMG 141960
devouring_plague 6460 (19658) 4.6% (13.9%) 15.3 30.87sec 579621 555673 149447 308465 190527 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.31 15.31 0.00 0.00 1.0431 0.0000 2916291.16 2916291.16 0.00 555673.20 555673.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.35 74.16% 149447.22 126181 227304 149479.90 128326 184418 1696500 1696500 0.00
crit 3.95 25.84% 308465.32 252361 545530 304714.24 0 545530 1219791 1219791 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3189 2.2% 43.0 10.49sec 33447 0 25946 54553 33498 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.00 42.94 0.00 0.00 0.0000 0.0000 1438360.36 1438360.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.60 73.60% 25946.04 21031 37885 25969.55 22555 30820 819978 819978 0.00
crit 11.34 26.40% 54552.77 42061 90923 54591.98 42061 80821 618382 618382 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10008 7.1% 15.3 30.87sec 295121 0 0 0 0 0.0% 0.0% 0.0% 0.0% 141.7 24953 51733 31869 25.8% 0.0% 19.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.31 15.31 141.75 141.75 0.0000 0.6314 4517226.75 4517226.75 0.00 50469.55 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.1 74.18% 24952.92 21031 37885 24963.35 22051 29004 2623542 2623542 0.00
crit 36.6 25.82% 51733.30 42061 90923 51714.59 44453 63215 1893685 1893685 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4838) 0.0% (3.4%) 11.3 41.32sec 192812 185097 0 0 0 26.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 0.00 0.00 1.0417 0.0000 0.00 0.00 0.00 185097.18 185097.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.31 73.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.01 26.58% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4838 3.4% 11.3 41.32sec 192812 0 149956 311386 192812 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 0.00 0.00 0.0000 0.0000 2183036.14 2183036.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.32 73.45% 149956.04 124529 209168 149998.12 125566 189488 1247070 1247070 0.00
crit 3.01 26.55% 311385.91 249057 502003 301221.71 0 502003 935966 935966 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.32sec 0 0 0 0 0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.32 123.25 0.00 0.00 0.0000 0.0000 0.00 32696503.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.32 70.04% 0.00 0 0 0.00 0 0 0 17269002 100.00
crit 36.92 29.96% 0.00 0 0 0.00 0 0 0 15427501 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12285 8.7% 36.0 12.56sec 154033 128486 120455 249224 154035 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.01 36.01 0.00 0.00 1.1988 0.0000 5546217.67 5546217.67 0.00 128485.79 128485.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.62 73.92% 120454.72 100626 182417 120480.49 107257 136389 3206145 3206145 0.00
crit 9.39 26.08% 249223.80 201251 437802 249267.35 0 347840 2340072 2340072 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 27090 (35303) 19.1% (24.9%) 134.4 3.30sec 118448 79786 0 0 0 0.0% 0.0% 0.0% 0.0% 287.8 32791 69436 42457 26.4% 0.0% 39.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.42 134.42 287.77 287.77 1.4846 0.6238 12218131.69 12218131.69 0.00 79785.91 79785.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 211.9 73.62% 32790.69 26761 48204 32812.19 30457 36595 6947000 6947000 0.00
crit 75.9 26.38% 69435.89 53521 115688 69480.14 60948 79666 5271131 5271131 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 8213 5.8% 87.4 5.03sec 42376 0 32757 69316 42398 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.41 87.36 0.00 0.00 0.0000 0.0000 3704103.44 3704103.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.32 73.63% 32756.55 26761 48204 32776.98 29406 37190 2107023 2107023 0.00
crit 23.04 26.37% 69315.70 53521 115688 69358.40 57541 86978 1597080 1597080 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 11764 8.3% 42.1 10.31sec 126217 120880 98464 204710 126218 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 42.08 0.00 0.00 1.0442 0.0000 5311123.90 5311123.90 0.00 120880.44 120880.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.09 73.88% 98464.19 81656 148659 98505.08 86946 115172 3060936 3060936 0.00
crit 10.99 26.12% 204709.93 163313 356783 204752.96 0 356783 2250188 2250188 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=15198 to 15270} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 120.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 5382 3.8% 15.8 4.90sec 153717 147148 120036 248085 153719 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 0.00 0.00 1.0447 0.0000 2435152.60 2435152.60 0.00 147148.02 147148.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.67 73.69% 120035.83 98214 178559 120257.23 100775 155577 1401343 1401343 0.00
crit 4.17 26.31% 248084.70 196429 428541 246260.32 0 428541 1033810 1033810 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 15477 (20195) 10.9% (14.2%) 60.3 7.42sec 151118 144798 0 0 0 0.0% 0.0% 0.0% 0.0% 289.9 18834 39032 24095 26.0% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.32 60.32 289.93 289.93 1.0437 1.5001 6986010.50 6986010.50 0.00 18308.79 144798.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 214.4 73.95% 18833.67 15692 28258 18844.32 17160 21333 4038024 4038024 0.00
crit 75.5 26.05% 39032.33 31384 67820 39039.76 34253 44945 2947986 2947986 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4717 3.3% 88.1 5.06sec 24165 0 18872 39196 24186 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.12 88.04 0.00 0.00 0.0000 0.0000 2129330.82 2129330.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.02 73.85% 18872.36 15692 28258 18881.01 17162 21092 1227102 1227102 0.00
crit 23.02 26.15% 39195.69 31384 67820 39212.52 32383 47320 902229 902229 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 1.0576 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6592 4.6% 98.5 4.52sec 30203 0 23898 49797 30711 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.52 96.89 0.00 0.00 0.0000 0.0000 2975584.01 2975584.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.40 73.70% 23898.05 19578 35636 23903.43 21568 27011 1706416 1706416 0.00
crit 25.49 26.30% 49797.23 39157 85526 49800.14 41730 62106 1269168 1269168 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1619 1.1% 27.2 11.74sec 26440 0 18685 44671 26440 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.23 27.23 0.00 0.00 0.0000 0.0000 719957.73 719957.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.10 70.16% 18684.65 12216 22477 18685.81 14757 21925 356944 356944 0.00
crit 8.13 29.84% 44671.24 24432 53946 44655.42 0 53946 363014 363014 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12871.08
  • base_dd_max:12871.08
vampiric_touch 13605 (17662) 9.6% (12.4%) 30.0 15.07sec 265429 254541 0 0 0 0.0% 0.0% 0.0% 0.0% 218.2 21829 45775 28132 26.3% 0.0% 89.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.03 30.03 218.23 218.23 1.0428 1.8491 6139055.65 6139055.65 0.00 18328.88 254540.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.8 73.68% 21829.33 17688 32485 21843.90 19868 24488 3510016 3510016 0.00
crit 57.4 26.32% 45775.28 35377 77965 45798.01 39499 53918 2629040 2629040 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4057 2.9% 66.2 6.65sec 27640 0 21522 44956 27663 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.24 66.18 0.00 0.00 0.0000 0.0000 1830873.21 1830873.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.84 73.79% 21522.11 17688 32485 21532.99 19193 24394 1051150 1051150 0.00
crit 17.34 26.21% 44956.05 35377 77965 44976.43 36726 59962 779724 779724 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 83893 / 6660
melee 83605 4.6% 35.4 11.16sec 83639 93115 62974 149563 83639 28.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.44 35.44 0.00 0.00 0.8982 0.0000 2964216.11 2964216.11 0.00 93114.79 93114.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.00 47.96% 62974.42 42818 84472 63073.12 48783 79902 1070356 1070356 0.00
crit 9.93 28.02% 149563.38 98481 202733 149548.30 0 202733 1484996 1484996 0.00
glance 8.52 24.03% 48015.71 32114 63354 48048.79 0 63354 408865 408865 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0487 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 288 0.0% 7.0 0.74sec 1446 0 987 2370 1446 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 10122.16 10122.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.68 66.82% 987.33 828 988 986.86 0 988 4618 4618 0.00
crit 2.32 33.18% 2369.80 1987 2371 2229.08 0 2371 5504 5504 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:988.00
  • base_dd_max:988.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 23.14%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.9 1.9 79.7sec 58.1sec 29.76% 29.76%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:29.76%

    Trigger Attempt Success

    • trigger_pct:99.78%
chayes_essence_of_brilliance 11.4 3.3 40.7sec 31.0sec 28.76% 28.76%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:28.76%

    Trigger Attempt Success

    • trigger_pct:99.81%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.8 12.6 31.3sec 16.5sec 54.04% 54.04%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:54.04%

    Trigger Attempt Success

    • trigger_pct:99.29%
power_infusion 4.3 0.0 120.7sec 120.7sec 18.54% 18.54%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 10.2sec 10.2sec 10.17% 49.44%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 9.61%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 36.6 6.1 12.0sec 10.2sec 18.99% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.60%
  • surge_of_darkness_2:1.39%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.22% 14.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.22%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.8sec 74.8sec 83.41% 80.64%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.03% 72.81%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.38% 16.38%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.69% 5.69%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.69%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_FDCL_PI_No_LMG
devouring_plague Shadow Orb 15.3 45.9 3.0 3.0 193206.3
halo Mana 11.3 425273.7 37561.7 37561.4 5.1
mind_blast Mana 36.0 313677.6 8711.7 8711.6 17.7
mind_flay Mana 134.4 384975.4 2863.9 2863.9 41.4
shadow_word_death Mana 15.8 119151.2 7521.0 7521.3 20.4
shadow_word_pain Mana 60.3 774234.3 12835.7 12835.6 11.8
vampiric_touch Mana 30.0 256998.5 8559.0 8559.0 31.0
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.00 13.68 (0.00%) 18000.00 0.00 0.00%
shadowfiend Mana 35.44 235207.52 (10.97%) 6636.62 83760.04 26.26%
Shadow Orbs from Mind Blast Shadow Orb 36.01 36.01 (81.81%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.01 8.01 (18.19%) 1.00 0.00 0.00%
Devouring Plague Health Health 184.69 0.00 (-nan%) 0.00 3144391.60 100.00%
Vampiric Touch Mana Mana 284.41 1397269.23 (65.20%) 4912.82 110656.17 7.34%
mp5_regen Mana 1806.42 510671.07 (23.83%) 282.70 31255.40 5.77%
Resource RPS-Gain RPS-Loss
Mana 4744.34 5034.67
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 169118.35 3720.00 300000.00
Shadow Orb 1.09 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.9%
shadowfiend-Mana Cap 5.9%
lightwell-Mana Cap 5.9%

Procs

Count Interval
Shadowy Recall Extra Tick 284.5 1.6sec
Shadowy Apparition Procced 98.5 4.5sec
FDCL Mind Spike proc 42.7 10.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_FDCL_PI_No_LMG Damage Per Second
Count 24992
Mean 141959.56
Minimum 125199.40
Maximum 163119.00
Spread ( max - min ) 37919.60
Range [ ( max - min ) / 2 * 100% ] 13.36%
Standard Deviation 4728.1145
5th Percentile 134661.52
95th Percentile 150142.16
( 95th Percentile - 5th Percentile ) 15480.63
Mean Distribution
Standard Deviation 29.9080
95.00% Confidence Intervall ( 141900.94 - 142018.18 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4261
0.1 Scale Factor Error with Delta=300 190835
0.05 Scale Factor Error with Delta=300 763342
0.01 Scale Factor Error with Delta=300 19083570
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 141959.56
Distribution Chart

Damage

Sample Data
Count 24992
Mean 61050455.64
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_FDCL_PI_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_FDCL_PI_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_FDCL_PI_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 303.13
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.02 shadowfiend,if=!talent.mindbender.enabled
B 4.30 power_infusion,if=talent.power_infusion.enabled
C 4.96 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 45.23 mind_blast,if=active_enemies<=6&cooldown_react
E 8.01 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 0.00 mind_flay_insanity,interrupt=1,chain=1
H 7.83 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 6.70 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 13.79 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 3.69 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 12.57 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 16.30 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 10.34 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 11.32 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.36 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 7.87 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 38.39 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 65.40 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 41.05 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

ABCIPDJWDWUWLJTDUWZUUZZDMOWUWUUPDWMWLDUWZZUDMOWDWMLWTDPWUWZZZZZDJOWDWMWLTDWBIZZDJOPWDWMUDIUWKUZZUZZDJWTDWUWMLPDOWAZZDJWTDWMULUDWUZPUDJOWUDWMLUWDUWIBZZDJWPDOWMWLDWZZZZZDJUUWDWMWLDOPWUWZZZDJWUTDWMULUDWZZUZDJOPWDWMWLTDUWUWIABZDJWDUUWPMWTDCEHIKUZZZZEDCHJUWUDEHWLMDSECHWPUZZDEHJU8WDCEHWMLUTDUSECHWZUZZDMEHW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_FDCL_PI_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000212
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_FDCL_ToF_No_LMG : 137782 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
137782.3 137782.3 62.96 / 0.05% 8286 / 6.0% 25.1 5222.2 4734.7 Mana 0.84% 41.6 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_ToF_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:552570|236489|183639|165891|140445|131177|121321|75401&chds=0,1105140&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++552570++devouring_plague,9482C9,0,0,15|t++236489++vampiric_touch,9482C9,1,0,15|t++183639++halo,9482C9,2,0,15|t++165891++shadow_word_death,9482C9,3,0,15|t++140445++shadow_word_pain,9482C9,4,0,15|t++131177++mind_blast,9482C9,5,0,15|t++121321++mind_spike,4A79D3,6,0,15|t++75401++mind_flay,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_ToF_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:20,11,10,10,8,8,6,5,5,5,5,4,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_ToF_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:587643210zxyzyywvtrplifdcbbbbccdffffffeeedddeeeedcaZYWVUUUUUUUVVVUUVVUUVVVWXZYYZYYXXWVXWWWWXXXXWWVVUUUUUVWXWXXWVUTTSTTTTTUUVVUUUUTTUVVWXYYXXXXWVVUWUUUVVVVWVVVVVVVVVWXYXYYYXWXXXZZaacdeffeedddcdddddecccbaYXWVWWWWWXXYYXXXXXWWVVWXXXXXWVUTSRSSSSTUVVVUUUUUTUVVWXYYYYYXWVUUVUUUVVWWWVWVWVVVWWXXZYYZYXXWWVWWWWXYYZZYYYYXXXYYYZaaaaaZYYYXYYYYZaabbaaaaaZaZZZabbbbaZXWWWYZZabdeghgghggghiikkljjihgfdbabbbbbbcccbcccbbbbbcdfeffeddddceddddeeffeedddcdedefgfggggffeeggggghhiihhhhhghgghhjiiigfedcbdcbbbbbbbaaaaZZaccdefffffffeedfeeeeeeeecccbbbaaaabcbbaaZZYYZbcddeghijjjjiihhihiiihgffecaYX&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4417,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=137782|max=311917&chxp=1,1,44,100& http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_ToF_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,3,2,5,16,24,30,35,44,70,104,114,146,212,287,383,580,690,891,1135,1245,1518,1572,1774,1792,1758,1679,1545,1428,1236,1058,852,689,563,421,332,224,172,119,91,66,25,25,13,6,8,4,0,3&chds=0,1792&chbh=5&chxt=x&chxl=0:|min=115352|avg=137782|max=158605&chxp=0,1,52,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_FDCL_ToF_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:44.4,13.9,9.6,9.1,6.9,3.6,3.6,2.6,0.7,0.0,0.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 200.5s|shadow_word_pain 62.7s|mind_blast 43.1s|mind_spike 40.9s|vampiric_touch 31.2s|shadow_word_death 16.3s|devouring_plague 16.1s|halo 11.7s|shadowfiend 3.2s|dispersion 0.2s|waiting 3.8s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_FDCL_ToF_No_LMG 137782
devouring_plague 6722 (19755) 4.9% (14.4%) 15.4 30.55sec 577442 552570 154212 318164 196503 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.44 15.44 0.00 0.00 1.0450 0.0000 3034561.19 3034561.19 0.00 552570.03 552570.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.46 74.21% 154211.93 126181 248952 154228.15 129740 190579 1767219 1767219 0.00
crit 3.98 25.79% 318163.87 252361 597485 314622.34 0 554434 1267343 1267343 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3133 2.3% 41.6 10.82sec 34010 0 26465 55293 34060 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.56 41.50 0.00 0.00 0.0000 0.0000 1413434.56 1413434.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.56 73.65% 26464.76 21031 41493 26486.11 22771 31722 808865 808865 0.00
crit 10.93 26.35% 55293.43 42061 99583 55326.62 42061 86594 604570 604570 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9900 7.2% 15.4 30.55sec 289413 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.7 25628 53027 32685 25.8% 0.0% 19.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.44 15.44 136.74 136.74 0.0000 0.6584 4469379.38 4469379.38 0.00 49644.33 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.5 74.24% 25628.31 21031 41493 25636.75 22238 29854 2601810 2601810 0.00
crit 35.2 25.76% 53026.98 42061 99583 53010.52 44601 66261 1867569 1867569 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4765) 0.0% (3.5%) 11.2 41.41sec 191893 183639 0 0 0 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 11.19 0.00 0.00 1.0450 0.0000 0.00 0.00 0.00 183638.82 183638.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.23 73.53% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.96 26.47% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4765 3.5% 11.2 41.41sec 191893 0 149637 309638 191894 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 11.19 0.00 0.00 0.0000 0.0000 2146921.49 2146921.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.23 73.59% 149636.82 124529 229089 149665.64 124529 179700 1232005 1232005 0.00
crit 2.95 26.41% 309637.68 249057 549813 299460.81 0 549813 914916 914916 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.41sec 0 0 0 0 0 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.19 121.83 0.00 0.00 0.0000 0.0000 0.00 32710138.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.55 70.22% 0.00 0 0 0.00 0 0 0 17354078 100.00
crit 36.28 29.78% 0.00 0 0 0.00 0 0 0 15356061 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12540 9.1% 36.4 12.37sec 155546 131177 121745 251882 155545 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.39 36.39 0.00 0.00 1.1858 0.0000 5660018.20 5660018.20 0.00 131176.84 131176.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.94 74.03% 121744.75 100626 199791 121774.75 109063 139319 3279415 3279415 0.00
crit 9.45 25.97% 251882.11 201251 479497 252054.65 201251 347462 2380603 2380603 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 25724 (33532) 18.7% (24.3%) 132.0 3.34sec 114484 75401 0 0 0 0.0% 0.0% 0.0% 0.0% 277.1 32457 68343 41857 26.2% 0.0% 39.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.04 132.04 277.06 277.06 1.5183 0.6512 11596930.32 11596930.32 0.00 75401.31 75401.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 204.5 73.81% 32457.38 26761 52794 32476.73 29917 36534 6637057 6637057 0.00
crit 72.6 26.19% 68342.59 53521 126706 68384.29 60881 77935 4959874 4959874 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7808 5.7% 84.2 5.17sec 41818 0 32460 68306 41838 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.16 84.12 0.00 0.00 0.0000 0.0000 3519298.57 3519298.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.11 73.84% 32459.62 26761 52794 32477.63 29215 37155 2016030 2016030 0.00
crit 22.01 26.16% 68305.63 53521 126706 68348.26 56882 86256 1503269 1503269 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 11014 8.0% 39.2 10.97sec 126819 121321 99190 205577 126818 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.16 39.16 0.00 0.00 1.0453 0.0000 4966044.42 4966044.42 0.00 121321.29 121321.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.99 74.03% 99189.66 81656 162817 99227.25 86472 118405 2875421 2875421 0.00
crit 10.17 25.97% 205577.18 163313 390762 205634.53 0 298259 2090623 2090623 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=15198 to 15270} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 5999 4.4% 15.6 4.97sec 173569 165891 135592 279688 173570 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.61 15.61 0.00 0.00 1.0463 0.0000 2709494.82 2709494.82 0.00 165890.82 165890.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.50 73.65% 135591.53 98214 195564 135790.40 112578 173541 1558816 1558816 0.00
crit 4.11 26.35% 279687.60 196429 469355 277294.53 0 469355 1150679 1150679 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 14931 (19507) 10.8% (14.2%) 60.0 7.44sec 146730 140445 0 0 0 0.0% 0.0% 0.0% 0.0% 280.0 18875 38945 24072 25.9% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.00 60.00 279.96 279.96 1.0448 1.5508 6739249.09 6739249.09 0.00 17719.91 140445.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 207.5 74.10% 18874.52 15692 30949 18880.72 17060 22162 3915802 3915802 0.00
crit 72.5 25.90% 38944.81 31384 74279 38938.95 34130 44561 2823447 2823447 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4576 3.3% 85.1 5.21sec 24258 0 18999 39336 24278 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.12 85.05 0.00 0.00 0.0000 0.0000 2064854.27 2064854.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.97 74.04% 18998.61 15692 30949 19005.21 17119 21492 1196389 1196389 0.00
crit 22.08 25.96% 39336.26 31384 74279 39346.48 33363 47846 868466 868466 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 1.0576 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6338 4.6% 94.6 4.70sec 30256 0 23986 49771 30735 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.56 93.08 0.00 0.00 0.0000 0.0000 2860924.85 2860924.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.72 73.83% 23986.16 19578 39030 23986.58 21493 27158 1648385 1648385 0.00
crit 24.36 26.17% 49771.33 39157 93671 49759.29 41929 61461 1212540 1212540 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1375 1.0% 24.3 13.18sec 25094 0 17859 42258 25095 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.34 24.34 0.00 0.00 0.0000 0.0000 610834.66 610834.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.12 70.35% 17859.33 12216 24618 17872.59 13947 22022 305810 305810 0.00
crit 7.22 29.65% 42257.91 24432 51377 42281.97 0 51377 305024 305024 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12215.88
  • base_dd_max:12215.88
vampiric_touch 12565 (16349) 9.1% (11.9%) 29.8 15.06sec 247041 236489 0 0 0 0.0% 0.0% 0.0% 0.0% 203.0 21739 45304 27903 26.2% 0.0% 87.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.83 29.83 202.99 202.99 1.0446 1.9496 5664156.30 5664156.30 0.00 17263.90 236488.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.9 73.84% 21739.43 17688 35579 21751.62 19797 24264 3258673 3258673 0.00
crit 53.1 26.16% 45303.53 35377 85390 45320.43 39536 52633 2405483 2405483 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3784 2.7% 61.6 7.10sec 27681 0 21631 44992 27701 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.63 61.59 0.00 0.00 0.0000 0.0000 1706011.85 1706011.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.58 74.02% 21631.27 17688 35579 21640.81 19076 25226 986040 986040 0.00
crit 16.00 25.98% 44991.97 35377 85390 45006.45 36187 59823 719972 719972 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 83228 / 6609
melee 82941 4.7% 35.5 11.17sec 82977 92377 62563 148631 82976 27.8% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.45 35.45 0.00 0.00 0.8983 0.0000 2941549.89 2941549.89 0.00 92376.66 92376.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.09 48.20% 62563.02 42818 84472 62673.78 49307 80994 1069042 1069042 0.00
crit 9.87 27.84% 148630.94 98481 202733 148674.10 98481 202733 1467037 1467037 0.00
glance 8.49 23.96% 47743.66 32114 63354 47793.65 0 63354 405470 405470 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0501 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 288 0.0% 7.0 0.74sec 1445 0 987 2369 1445 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 10115.24 10115.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.68 66.84% 986.70 828 988 986.30 0 988 4616 4616 0.00
crit 2.32 33.16% 2368.72 1987 2371 2228.81 0 2371 5499 5499 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:988.00
  • base_dd_max:988.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 33.33%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.8 1.7 81.5sec 60.3sec 28.88% 28.88%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:28.88%

    Trigger Attempt Success

    • trigger_pct:99.77%
chayes_essence_of_brilliance 11.1 3.0 41.7sec 32.3sec 27.80% 27.80%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.80%

    Trigger Attempt Success

    • trigger_pct:99.82%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.6 11.7 31.6sec 17.1sec 52.77% 52.77%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:52.77%

    Trigger Attempt Success

    • trigger_pct:99.32%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 10.1sec 10.1sec 10.21% 48.58%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.21%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.63%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 34.4 5.2 12.6sec 10.9sec 17.82% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:16.64%
  • surge_of_darkness_2:1.20%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.0 125.4 0.0sec 0.6sec 16.95% 16.95%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.22% 14.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.22%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.8sec 74.8sec 83.41% 80.64%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.02% 72.92%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.38% 16.38%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.69% 5.69%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.69%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_ToF_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_FDCL_ToF_No_LMG
devouring_plague Shadow Orb 15.4 46.3 3.0 3.0 192478.3
halo Mana 11.2 453117.2 40500.0 40499.8 4.7
mind_blast Mana 36.4 327494.2 9000.0 9000.1 17.3
mind_flay Mana 132.0 396115.6 3000.0 3000.0 38.2
shadow_word_death Mana 15.6 121767.4 7800.0 7800.4 22.3
shadow_word_pain Mana 60.0 792018.0 13200.0 13199.9 11.1
vampiric_touch Mana 29.8 268504.9 9000.0 9000.0 27.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.31 5567.76 (0.26%) 18000.00 0.00 0.00%
shadowfiend Mana 35.45 272691.11 (12.75%) 7692.20 46361.77 14.53%
Shadow Orbs from Mind Blast Shadow Orb 36.39 36.39 (81.90%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.04 8.04 (18.10%) 1.00 0.00 0.00%
Devouring Plague Health Health 178.24 0.00 (-nan%) 0.00 3034647.41 100.00%
Vampiric Touch Mana Mana 264.58 1337820.24 (62.55%) 5056.37 64906.08 4.63%
mp5_regen Mana 1806.42 522708.82 (24.44%) 289.36 19217.65 3.55%
Resource RPS-Gain RPS-Loss
Mana 4734.66 5222.19
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 80117.00 0.00 262800.00
Shadow Orb 1.10 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.7%
shadowfiend-Mana Cap 3.7%
lightwell-Mana Cap 3.7%

Procs

Count Interval
Shadowy Recall Extra Tick 272.3 1.6sec
Shadowy Apparition Procced 94.6 4.7sec
FDCL Mind Spike proc 39.7 10.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_FDCL_ToF_No_LMG Damage Per Second
Count 24992
Mean 137782.28
Minimum 115351.79
Maximum 158604.70
Spread ( max - min ) 43252.91
Range [ ( max - min ) / 2 * 100% ] 15.70%
Standard Deviation 5078.4131
5th Percentile 129545.20
95th Percentile 146117.38
( 95th Percentile - 5th Percentile ) 16572.18
Mean Distribution
Standard Deviation 32.1238
95.00% Confidence Intervall ( 137719.32 - 137845.24 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5218
0.1 Scale Factor Error with Delta=300 220160
0.05 Scale Factor Error with Delta=300 880642
0.01 Scale Factor Error with Delta=300 22016066
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 137782.28
Distribution Chart

Damage

Sample Data
Count 24992
Mean 59162113.96
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_FDCL_ToF_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_FDCL_ToF_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_FDCL_ToF_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 313.18
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.02 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 4.92 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 44.99 mind_blast,if=active_enemies<=6&cooldown_react
E 8.04 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 0.00 mind_flay_insanity,interrupt=1,chain=1
H 7.57 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 5.93 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 14.03 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 3.19 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 13.27 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 15.87 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 10.52 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 11.19 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 17.45 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 10.08 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 35.97 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 65.28 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 40.80 shadow_word_pain,moving=1
a 0.06 dispersion

Sample Sequence

ACIPDJWUTDWUWLMTDUWZZZZZDMOWUUWUPDWUMWLDUWUWZZUDMOUWDUUWMLWTDWPWZZUZDJWDWMWDLOWUIZZDJPWDWMWLTDOWZZZZDJUWDWPMWLKUDOWAUZDJWDWMWLTDWUPWZZZZZDJOWDKUWMLWDWIZZDJOPWTDWMWDLUUWZZZZZDJWKTDUWMLPTDOWZZUDJWTDWMWLTDUWUWZPZZDJOWUDWMUWLDWUWIAZDJWPWDOWMUWEDHIWZZZZECDHJWWDECHMLPWTDWEHUZZDMCEH8WUWDWSEHMULTDOWEHWZZZPZDECHJ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_FDCL_ToF_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!000202
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_MB_DI_No_LMG : 145192 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
145191.9 145191.9 59.07 / 0.04% 7796 / 5.4% 25.0 5177.4 4959.0 Mana 0.60% 38.1 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_DI_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:528860|231680|179384|144570|139762|139330|74105&chds=0,1057719&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++528860++devouring_plague,9482C9,0,0,15|t++231680++vampiric_touch,9482C9,1,0,15|t++179384++halo,9482C9,2,0,15|t++144570++shadow_word_death,9482C9,3,0,15|t++139762++shadow_word_pain,9482C9,4,0,15|t++139330++mind_blast,9482C9,5,0,15|t++74105++mind_flay,9482C9,6,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_DI_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:22,13,12,11,10,9,7,6,5,4,4,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|mindbender: stormlash&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_DI_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:24678544220122200yxvrpmjgffeeedeffgfffeeddddddddddcbZZZXYYYZZabbccccccbccdcdeddcbaaYYXXWWWXXYYYXXWWVVVWWWWXXYYXVUTTTUVVWXYZaaabbbaabcdeefedccbaYXWWVVVWWWWXWWWWWWWWWXXYYZZYXXWWWXXYYZabcddddedddeefffffeedcaZYYXXXXYYYYYYYXXWWWWWXXYYYXVUTTSTTUUWXYZaZabbbabcdeefffedcbaZXXWWVWWXXXWWWWVVVWWXXYYZZYXXWWVWWXXZabbccddeeeeffgghhhggeedcaaaZZZZZaaZZZZZYZZZZZaaaaZYXWVVVVVWXYZabccddeefhhiijjkjjihfedcbbaaaaaaaaaaZaaaabbccddcbbbaaaaabccdefeffggghiiijjjkkjjihgfffeeeeeeedeeeededeeeeeefdcbaZZZYYZZabbccddeefhijkkllmmmllkjiihhggffffeeeeeeeeeeeffffeddddcdccccddeeeffeedefeiijjkklllkkk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4675,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=145192|max=310550&chxp=1,1,47,100& http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_DI_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,1,16,26,44,78,126,162,278,394,572,710,913,1084,1296,1462,1490,1671,1715,1628,1590,1501,1339,1244,1104,898,813,660,494,415,337,241,180,141,102,88,58,28,37,25,6,5,4,6,1,4,0,0,0,2&chds=0,1715&chbh=5&chxt=x&chxl=0:|min=129750|avg=145192|max=169135&chxp=0,1,39,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_DI_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:49.8,13.6,11.7,7.0,4.5,3.6,2.6,1.8,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 225.1s|shadow_word_pain 61.5s|mind_blast 52.8s|vampiric_touch 31.4s|devouring_plague 20.2s|shadow_word_death 16.2s|halo 11.8s|mindbender 8.3s|waiting 2.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_MB_DI_No_LMG 145192
devouring_plague 8057 (23646) 5.6% (16.3%) 19.3 24.14sec 552894 528860 147769 304217 188417 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.31 19.31 0.00 0.00 1.0455 0.0000 3637876.81 3637876.81 0.00 528859.63 528859.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.29 74.02% 147769.47 126181 216480 147798.78 129672 172406 2111774 2111774 0.00
crit 5.02 25.98% 304216.57 252361 519552 303307.47 0 519552 1526102 1526102 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3717 2.6% 51.8 8.68sec 32400 0 25269 52624 32443 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.77 51.70 0.00 0.00 0.0000 0.0000 1677409.89 1677409.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.15 73.78% 25269.25 21031 36081 25288.87 21893 29852 963901 963901 0.00
crit 13.56 26.22% 52624.23 42061 86594 52648.39 42061 72343 713509 713509 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 11872 8.2% 19.3 24.14sec 277599 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.5 24657 50907 31436 25.8% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.31 19.31 170.50 170.50 0.0000 0.6588 5359744.95 5359744.95 0.00 47715.98 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.5 74.17% 24656.64 21031 57729 24664.70 21956 28316 3118239 3118239 0.00
crit 44.0 25.83% 50906.84 42061 115458 50895.37 44616 60908 2241506 2241506 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4688) 0.0% (3.2%) 11.3 41.42sec 187440 179384 0 0 0 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 1.0449 0.0000 0.00 0.00 0.00 179384.28 179384.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.31 73.63% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.98 26.37% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4688 3.2% 11.3 41.42sec 187440 0 146297 302827 187442 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 0.0000 0.0000 2115120.02 2115120.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.32 73.71% 146296.68 124529 199208 146344.48 124529 179112 1216917 1216917 0.00
crit 2.97 26.29% 302827.09 249057 478099 292230.27 0 478099 898203 898203 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.42sec 0 0 0 0 0 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.28 122.12 0.00 0.00 0.0000 0.0000 0.00 32072528.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.75 70.22% 0.00 0 0 0.00 0 0 0 17028253 100.00
crit 36.37 29.78% 0.00 0 0 0.00 0 0 0 15044276 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_MB_DI_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 16300 11.2% 48.3 9.31sec 152464 139330 119254 247082 152465 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.28 48.28 0.00 0.00 1.0943 0.0000 7360360.71 7360360.71 0.00 139329.52 139329.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.73 74.02% 119253.58 100626 173731 119295.42 107727 134108 4261397 4261397 0.00
crit 12.54 25.98% 247082.42 201251 416954 247177.79 201251 341472 3098964 3098964 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 28380 (36988) 19.5% (25.5%) 148.0 3.00sec 112720 74105 0 0 0 0.0% 0.0% 0.0% 0.0% 310.4 31998 67221 41227 26.2% 0.0% 44.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.96 147.96 310.39 310.39 1.5211 0.6503 12796617.24 12796617.24 0.00 74104.95 74104.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 147.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 229.1 73.80% 31998.47 26761 45908 32016.54 29771 35469 7329751 7329751 0.00
crit 81.3 26.20% 67220.95 53521 110180 67253.12 59969 76865 5466866 5466866 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 8608 5.9% 94.2 4.66sec 41178 0 31991 67201 41202 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.25 94.19 0.00 0.00 0.0000 0.0000 3881073.29 3881073.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.55 73.84% 31991.35 26761 45908 32008.08 29071 36043 2225062 2225062 0.00
crit 24.64 26.16% 67201.17 53521 110180 67232.71 55265 86598 1656011 1656011 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.9 60.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.93 7.93 0.00 0.00 1.0502 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 5176 3.6% 15.5 5.00sec 151249 144570 118349 244144 151249 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 15.48 0.00 0.00 1.0462 0.0000 2342027.75 2342027.75 0.00 144569.61 144569.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.43 73.85% 118349.41 98214 170056 118524.84 99751 154698 1353285 1353285 0.00
crit 4.05 26.15% 244144.09 196429 408134 241843.72 0 408134 988743 988743 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 14579 (19032) 10.0% (13.1%) 58.9 7.62sec 146017 139762 0 0 0 0.0% 0.0% 0.0% 0.0% 279.1 18490 38161 23590 25.9% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.86 58.86 279.07 279.07 1.0448 1.5576 6583231.97 6583231.97 0.00 17320.58 139762.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 206.7 74.07% 18489.74 15692 26913 18498.94 16834 21235 3822143 3822143 0.00
crit 72.4 25.93% 38161.24 31384 64590 38163.90 33568 44488 2761089 2761089 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4453 3.1% 84.8 5.24sec 23711 0 18559 38430 23729 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.80 84.74 0.00 0.00 0.0000 0.0000 2010739.35 2010739.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.69 73.98% 18559.49 15692 26913 18568.59 16717 21013 1163459 1163459 0.00
crit 22.05 26.02% 38429.90 31384 64590 38444.42 32142 46798 847281 847281 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 6186 4.3% 94.4 4.72sec 29590 0 23472 48730 30083 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.38 92.84 0.00 0.00 0.0000 0.0000 2792772.04 2792772.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.54 73.83% 23471.87 19578 33939 23475.99 21048 26379 1608681 1608681 0.00
crit 24.30 26.17% 48729.67 39157 81453 48733.63 41456 58431 1184091 1184091 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1352 0.9% 23.7 13.50sec 25353 0 17970 42717 25353 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.72 23.72 0.00 0.00 0.0000 0.0000 601333.11 601333.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.64 70.17% 17969.97 12216 21407 17978.17 13748 21118 299063 299063 0.00
crit 7.08 29.83% 42717.11 24432 51377 42735.54 0 51377 302270 302270 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12215.88
  • base_dd_max:12215.88
vampiric_touch 12417 (16146) 8.6% (11.1%) 30.1 15.03sec 242022 231680 0 0 0 0.0% 0.0% 0.0% 0.0% 204.8 21309 44408 27362 26.2% 0.0% 88.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.11 30.11 204.77 204.77 1.0447 1.9501 5602793.61 5602793.61 0.00 16914.32 231679.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.1 73.80% 21309.40 17688 30939 21323.36 19461 24180 3220206 3220206 0.00
crit 53.7 26.20% 44408.33 35377 74252 44427.44 38963 52025 2382588 2382588 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3730 2.6% 62.2 7.07sec 27075 0 21151 43938 27098 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.17 62.12 0.00 0.00 0.0000 0.0000 1683301.31 1683301.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.91 73.90% 21151.42 17688 30939 21162.43 18815 24397 971040 971040 0.00
crit 16.21 26.10% 43938.38 35377 74252 43948.36 35755 58419 712261 712261 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 60614 / 15678
melee 60408 10.7% 118.6 3.70sec 59368 63544 47193 103078 59369 26.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.58 118.58 0.00 0.00 0.9343 0.0000 7039586.43 7039586.43 0.00 63543.92 63543.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.51 49.34% 47193.15 34254 67577 47238.08 40775 56138 2761216 2761216 0.00
crit 31.61 26.66% 103078.07 68508 162186 103183.68 84950 128914 3258739 3258739 0.00
glance 28.45 24.00% 35836.34 25691 50683 35864.15 29930 44725 1019632 1019632 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.41 23.41 0.00 0.00 1.0463 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 206 0.0% 20.1 12.38sec 1176 0 833 1983 1176 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.09 20.09 0.00 0.00 0.0000 0.0000 23631.36 23631.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.09 70.12% 832.79 564 988 848.92 627 988 11730 11730 0.00
crit 6.00 29.88% 1982.83 1128 2371 2011.79 0 2371 11901 11901 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:563.81
  • base_dd_max:563.81

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 33.33%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.8 1.8 81.2sec 60.0sec 28.99% 28.99%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:28.99%

    Trigger Attempt Success

    • trigger_pct:99.75%
chayes_essence_of_brilliance 11.0 3.0 41.8sec 32.2sec 27.79% 27.79%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.79%

    Trigger Attempt Success

    • trigger_pct:99.81%
divine_insight_shadow 17.4 0.7 24.3sec 23.3sec 5.71% 32.68%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.71%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.6 11.7 31.6sec 17.2sec 52.75% 52.75%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:52.75%

    Trigger Attempt Success

    • trigger_pct:99.29%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.4sec 10.4sec 9.97% 49.46%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.97%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.21%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 85.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.4 0.0 180.0sec 180.0sec 19.28% 30.80%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:19.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.8 0.0 300.0sec 300.0sec 14.20% 14.20%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:14.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_DI_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_MB_DI_No_LMG
devouring_plague Shadow Orb 19.3 57.9 3.0 3.0 184296.0
halo Mana 11.3 457008.5 40500.0 40499.7 4.6
mind_blast Mana 48.3 269307.7 5578.5 5578.5 27.3
mind_flay Mana 148.0 443871.6 3000.0 3000.0 37.6
shadow_word_death Mana 15.5 120784.6 7800.0 7800.3 19.4
shadow_word_pain Mana 58.9 776888.6 13200.0 13199.8 11.1
vampiric_touch Mana 30.1 270945.7 9000.0 9000.0 26.9
Resource Gains Type Count Total Average Overflow
mindbender Mana 118.58 436846.26 (19.50%) 3684.07 82633.75 15.91%
Shadow Orbs from Mind Blast Shadow Orb 48.28 48.25 (86.05%) 1.00 0.02 0.05%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.82 7.82 (13.95%) 1.00 0.00 0.00%
Devouring Plague Health Health 222.21 0.00 (-nan%) 0.00 3783203.66 100.00%
Vampiric Touch Mana Mana 266.89 1298027.15 (57.94%) 4863.56 116946.97 8.26%
mp5_regen Mana 1806.42 505266.11 (22.56%) 279.71 36660.36 6.76%
Resource RPS-Gain RPS-Loss
Mana 4959.03 5177.45
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 201294.05 74471.43 300000.00
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.9%
shadowfiend-Mana Cap 6.9%
lightwell-Mana Cap 6.9%

Procs

Count Interval
Shadowy Recall Extra Tick 292.8 1.5sec
Shadowy Apparition Procced 94.4 4.7sec
Divine Insight Mind Blast CD Reset 32.1 23.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_MB_DI_No_LMG Damage Per Second
Count 24992
Mean 145191.86
Minimum 129749.83
Maximum 169135.42
Spread ( max - min ) 39385.59
Range [ ( max - min ) / 2 * 100% ] 13.56%
Standard Deviation 4764.4712
5th Percentile 137821.55
95th Percentile 153413.94
( 95th Percentile - 5th Percentile ) 15592.39
Mean Distribution
Standard Deviation 30.1380
95.00% Confidence Intervall ( 145132.79 - 145250.93 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4136
0.1 Scale Factor Error with Delta=300 193781
0.05 Scale Factor Error with Delta=300 775127
0.01 Scale Factor Error with Delta=300 19378184
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 145191.86
Distribution Chart

Damage

Sample Data
Count 24992
Mean 58444402.06
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_MB_DI_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_MB_DI_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_MB_DI_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 287.12
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.93 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 5.44 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 52.87 mind_blast,if=active_enemies<=6&cooldown_react
E 7.82 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 0.00 mind_flay_insanity,interrupt=1,chain=1
H 7.66 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 6.01 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 14.30 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 13.27 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 15.87 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 13.87 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 11.28 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 0.97 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 20.11 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 69.13 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 39.58 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9CIPDJWTDWDOLMWTDWZZZZZDMWDPWMLDOW9ZZDMWTDWDWMWLWTDOPWZZZZDJWDWMWLTDWI9ZDJOPWDWMWDLWTTTTTTTTTTTTDZZZZJWTDOWWTTTMDPWLDWZZ9DJOWDWMWLWDWPZZZZDJOWDWMWLWDWIZZ9DJOWPWTDWMDWLWDZZZZZJWDOWWDMWDLPWTDZZZJ9WDOWWDJWLWDWZZZZPJDOWTDWMWLWDWIZZDJ9OWDPWMWDEHIWZZZZECDHJWWDECHLMWDPEHZZZMDC9E8HWDWECHJDITTTTTDWECHZZZDJPW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_MB_DI_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001222
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_MB_PI_No_LMG : 147074 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
147073.8 147073.8 59.33 / 0.04% 7873 / 5.4% 24.8 5292.6 5076.6 Mana 0.33% 35.2 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_PI_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:562486|253427|185453|147212|137847|130789|81030&chds=0,1124972&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++562486++devouring_plague,9482C9,0,0,15|t++253427++vampiric_touch,9482C9,1,0,15|t++185453++halo,9482C9,2,0,15|t++147212++shadow_word_death,9482C9,3,0,15|t++137847++shadow_word_pain,9482C9,4,0,15|t++130789++mind_blast,9482C9,5,0,15|t++81030++mind_flay,9482C9,6,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_PI_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:24,12,12,10,10,8,7,5,5,4,4,4,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mindbender: melee|shadow_word_pain|vampiric_touch|mind_blast|devouring_plague_tick|mind_flay_mastery|shadowy_apparition|devouring_plague|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|mindbender: stormlash&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_PI_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:035685322101210yxvvrolhebZZZZYYZaaabaaaZZZZZZaZZYYWVTSSRRSSTUVWXXXYYXXXXYYYaZZYYWWUTSRSRRSSTTUUUSSSSRSSSSTTTTTRQPOOOPQSTUWYZZaabbbccddfefecbaYWUTSSRRRQQQQRPQQQQQQQQSSTTUVUUTTSTUUUVVWWXYXXXXWVVVVWXXWWWWVUTSRSRRRSTTUVTUUUUTSSSSTUTTTSRQPONOOPQSUWXZZaabcccddefffedcbYXVUUTTSSSTTUTTTTTTSTTUVVVUUUTSRRQRRSSTVWXXXYYZZZZZZaabbbaZYXWVUVUTTTTUUUUUUUUUUUUUUVVVVUTTSRRSRRSTVWXYZZabbcdefgghhhhgfecbZZZYXXWWWWVWWWVVVVVVWYXXXXWWVVUWVVWWXXYZZZZZZZabbbcdcddccbaZZZZZYYYYYYXYYYYYYXXXYZYYYXWVVUUVUUUUVWXYYYZaabcefghihiiihhfeefeedcbbaaYZZZZYZZYZZaZZZYYYYXWYYXXXYYZZZZZZYYZZYZabaaaaaZZYZ&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3977,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=147074|max=369838&chxp=1,1,40,100& http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_PI_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,5,6,12,27,59,70,135,195,281,386,539,659,755,939,1151,1287,1362,1474,1524,1554,1544,1404,1352,1272,1166,1008,918,704,678,545,454,358,278,228,174,132,99,66,59,43,28,24,11,8,6,6,1,2,3&chds=0,1554&chbh=5&chxt=x&chxl=0:|min=131495|avg=147074|max=167899&chxp=0,1,43,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_PI_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:51.4,14.8,9.7,6.9,3.6,3.6,2.6,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 232.2s|shadow_word_pain 66.9s|mind_blast 43.6s|vampiric_touch 31.3s|shadow_word_death 16.4s|devouring_plague 16.3s|halo 11.8s|mindbender 8.3s|waiting 1.5s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_MB_PI_No_LMG 147074
devouring_plague 6611 (20385) 4.5% (13.9%) 15.7 30.09sec 586518 562486 149655 307157 190336 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 0.00 0.00 1.0428 0.0000 2983015.37 2983015.37 0.00 562486.06 562486.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.62 74.17% 149654.76 126181 227304 149700.36 129374 179729 1739653 1739653 0.00
crit 4.05 25.83% 307156.83 252361 545530 304266.08 0 545530 1243362 1243362 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3338 2.3% 44.9 10.03sec 33523 0 26020 54469 33575 26.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.87 44.80 0.00 0.00 0.0000 0.0000 1504078.63 1504078.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.90 73.44% 26019.60 21031 37885 26045.73 21884 31145 856076 856076 0.00
crit 11.90 26.56% 54468.93 42061 90923 54497.44 42061 90923 648003 648003 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10436 7.1% 15.7 30.09sec 300212 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147.8 24985 51531 31831 25.8% 0.0% 20.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 147.81 147.81 0.0000 0.6259 4705053.22 4705053.22 0.00 50854.99 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.7 74.21% 24985.17 21031 37885 24996.24 22223 28961 2740784 2740784 0.00
crit 38.1 25.79% 51530.77 42061 90923 51516.58 44255 62411 1964269 1964269 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4841) 0.0% (3.3%) 11.3 41.35sec 193177 185453 0 0 0 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 0.00 0.00 1.0417 0.0000 0.00 0.00 0.00 185453.25 185453.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.31 73.48% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.00 26.52% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4841 3.3% 11.3 41.35sec 193177 0 150213 312234 193177 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 0.00 0.00 0.0000 0.0000 2184453.85 2184453.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.31 73.48% 150212.59 124529 209168 150248.83 124529 197738 1248170 1248170 0.00
crit 3.00 26.52% 312234.05 249057 502003 301697.85 0 502003 936284 936284 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.35sec 0 0 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.31 122.59 0.00 0.00 0.0000 0.0000 0.00 32584844.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.90 70.07% 0.00 0 0 0.00 0 0 0 17215831 100.00
crit 36.69 29.93% 0.00 0 0 0.00 0 0 0 15369013 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_MB_PI_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12638 8.6% 37.2 12.15sec 153427 130789 120263 248405 153428 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.17 0.00 0.00 1.1731 0.0000 5702668.60 5702668.60 0.00 130789.15 130789.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.55 74.12% 120263.20 100626 182417 120299.33 108758 137876 3313131 3313131 0.00
crit 9.62 25.88% 248404.66 201251 437802 248580.61 201251 328211 2389538 2389538 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 32028 (41729) 21.8% (28.4%) 153.7 2.89sec 122407 81030 0 0 0 0.0% 0.0% 0.0% 0.0% 340.3 32796 69336 42432 26.4% 0.0% 47.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.71 153.71 340.34 340.34 1.5106 0.6243 14441445.71 14441445.71 0.00 81029.97 81029.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 250.6 73.63% 32796.43 26761 48204 32817.31 30488 36617 8218500 8218500 0.00
crit 89.8 26.37% 69335.58 53521 115688 69379.71 61807 79321 6222946 6222946 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9701 6.6% 103.3 4.24sec 42328 0 32757 69173 42351 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.34 103.28 0.00 0.00 0.0000 0.0000 4374200.04 4374200.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.07 73.65% 32757.43 26761 48204 32776.93 29060 37134 2491914 2491914 0.00
crit 27.21 26.35% 69172.97 53521 115688 69215.46 56013 92255 1882286 1882286 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.9 60.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 7.92 0.00 0.00 1.0470 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 120.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 5342 3.6% 15.7 4.93sec 153802 147212 120003 248117 153799 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.71 15.71 0.00 0.00 1.0448 0.0000 2416198.11 2416198.11 0.00 147212.46 147212.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.57 73.62% 120002.85 98214 178559 120201.58 100263 154433 1387855 1387855 0.00
crit 4.14 26.38% 248116.68 196429 428541 246092.77 0 428541 1028343 1028343 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 15666 (20435) 10.7% (13.9%) 64.1 6.99sec 143887 137847 0 0 0 0.0% 0.0% 0.0% 0.0% 293.7 18830 39009 24084 26.0% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.12 64.12 293.67 293.67 1.0438 1.4796 7072675.62 7072675.62 0.00 18397.29 137846.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 217.2 73.97% 18830.46 15692 28258 18841.04 17184 21156 4090337 4090337 0.00
crit 76.5 26.03% 39008.57 31384 67820 39014.83 34557 46242 2982338 2982338 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4768 3.2% 89.2 4.99sec 24138 0 18862 39168 24158 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.18 89.11 0.00 0.00 0.0000 0.0000 2152721.45 2152721.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.87 73.92% 18862.33 15692 28258 18871.33 16904 21283 1242428 1242428 0.00
crit 23.24 26.08% 39168.19 31384 67820 39183.91 33273 49547 910294 910294 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 6661 4.5% 99.7 4.48sec 30167 0 23890 49749 30682 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.67 98.00 0.00 0.00 0.0000 0.0000 3006653.00 3006653.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.26 73.74% 23890.00 19578 35636 23895.81 21138 26943 1726209 1726209 0.00
crit 25.74 26.26% 49748.59 39157 85526 49754.87 41617 60342 1280444 1280444 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1646 1.1% 27.0 11.84sec 27151 0 19042 45743 27152 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.95 26.95 0.00 0.00 0.0000 0.0000 731852.83 731852.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.77 69.63% 19041.84 12216 22477 19046.09 14154 22068 357377 357377 0.00
crit 8.19 30.37% 45742.91 24432 53946 45772.96 24432 53946 374476 374476 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12215.88
  • base_dd_max:12215.88
vampiric_touch 13536 (17572) 9.2% (12.0%) 30.0 15.08sec 264275 253427 0 0 0 0.0% 0.0% 0.0% 0.0% 217.2 21824 45763 28126 26.3% 0.0% 89.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.01 30.01 217.18 217.18 1.0428 1.8534 6108312.91 6108312.91 0.00 18280.65 253426.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.0 73.67% 21823.96 17688 32485 21839.31 19978 24530 3491896 3491896 0.00
crit 57.2 26.33% 45763.23 35377 77965 45788.92 40028 53438 2616417 2616417 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4036 2.7% 66.0 6.67sec 27615 0 21514 44913 27638 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.98 65.92 0.00 0.00 0.0000 0.0000 1821923.24 1821923.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.67 73.83% 21514.15 17688 32485 21524.56 19174 24563 1047081 1047081 0.00
crit 17.25 26.17% 44912.93 35377 77965 44929.80 36873 59247 774842 774842 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 61259 / 15825
melee 61071 10.7% 118.4 3.70sec 60021 64246 47741 103836 60021 26.8% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.44 118.44 0.00 0.00 0.9343 0.0000 7108717.85 7108717.85 0.00 64245.66 64245.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.25 49.18% 47741.43 34254 67577 47786.14 41346 56034 2781067 2781067 0.00
crit 31.75 26.80% 103836.17 68508 162186 103941.06 83152 127211 3296456 3296456 0.00
glance 28.44 24.01% 36262.49 25691 50683 36285.97 30149 43887 1031195 1031195 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.0428 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 188 0.0% 17.6 9.69sec 1226 0 859 2060 1226 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.63 17.63 0.00 0.00 0.0000 0.0000 21611.43 21611.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.25 69.46% 859.14 564 988 884.72 637 988 10521 10521 0.00
crit 5.38 30.54% 2059.82 1128 2371 2103.42 0 2371 11090 11090 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:563.81
  • base_dd_max:563.81

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 23.15%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.9 1.9 79.5sec 57.9sec 29.79% 29.79%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:29.79%

    Trigger Attempt Success

    • trigger_pct:99.76%
chayes_essence_of_brilliance 11.3 3.3 40.7sec 31.0sec 28.76% 28.76%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:28.76%

    Trigger Attempt Success

    • trigger_pct:99.80%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.7 12.6 31.3sec 16.5sec 53.99% 53.99%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:53.99%

    Trigger Attempt Success

    • trigger_pct:99.29%
power_infusion 4.3 0.0 120.8sec 120.8sec 18.52% 18.52%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.3sec 10.3sec 10.10% 49.44%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 9.10%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.36% 4.36%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.36%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 85.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.1 0.0 180.0sec 180.0sec 17.55% 29.85%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:17.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.5 0.0 300.0sec 300.0sec 12.14% 12.14%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:12.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_PI_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_MB_PI_No_LMG
devouring_plague Shadow Orb 15.7 47.0 3.0 3.0 195505.1
halo Mana 11.3 424732.6 37560.5 37560.2 5.1
mind_blast Mana 37.2 323803.4 8711.8 8711.8 17.6
mind_flay Mana 153.7 441218.3 2870.4 2870.4 42.6
shadow_word_death Mana 15.7 118153.5 7520.7 7521.0 20.4
shadow_word_pain Mana 64.1 825470.1 12875.0 12874.7 11.2
vampiric_touch Mana 30.0 257435.9 8579.0 8579.0 30.8
Resource Gains Type Count Total Average Overflow
mindbender Mana 118.44 427546.02 (18.64%) 3609.89 91322.77 17.60%
Shadow Orbs from Mind Blast Shadow Orb 37.17 37.17 (82.40%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.94 7.94 (17.60%) 1.00 0.00 0.00%
Devouring Plague Health Health 192.61 0.00 (-nan%) 0.00 3279386.25 100.00%
Vampiric Touch Mana Mana 283.10 1364007.03 (59.48%) 4818.15 136813.65 9.12%
mp5_regen Mana 1806.42 501705.16 (21.88%) 277.73 40221.31 7.42%
Resource RPS-Gain RPS-Loss
Mana 5076.62 5292.58
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 202677.10 51494.29 300000.00
Shadow Orb 1.10 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 7.6%
shadowfiend-Mana Cap 7.6%
lightwell-Mana Cap 7.6%

Procs

Count Interval
Shadowy Recall Extra Tick 303.1 1.5sec
Shadowy Apparition Procced 99.7 4.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_MB_PI_No_LMG Damage Per Second
Count 24992
Mean 147073.80
Minimum 131494.84
Maximum 167899.06
Spread ( max - min ) 36404.23
Range [ ( max - min ) / 2 * 100% ] 12.38%
Standard Deviation 4785.4093
5th Percentile 139591.44
95th Percentile 155336.68
( 95th Percentile - 5th Percentile ) 15745.24
Mean Distribution
Standard Deviation 30.2704
95.00% Confidence Intervall ( 147014.47 - 147133.13 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4066
0.1 Scale Factor Error with Delta=300 195488
0.05 Scale Factor Error with Delta=300 781955
0.01 Scale Factor Error with Delta=300 19548878
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 147073.80
Distribution Chart

Damage

Sample Data
Count 24992
Mean 59205252.59
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_MB_PI_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_MB_PI_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_MB_PI_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 265.16
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.92 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 4.29 power_infusion,if=talent.power_infusion.enabled
C 4.79 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 45.22 mind_blast,if=active_enemies<=6&cooldown_react
E 7.94 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 0.00 mind_flay_insanity,interrupt=1,chain=1
H 7.77 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 6.48 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 13.49 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 12.63 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 16.59 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 10.88 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 11.31 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.00 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 9.38 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 59.47 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 45.00 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9BCIPDJWDWLJTDWZZZZDMOWDPWMLDW9ZZDMWDWMWDIOPWZZZZZDJWTDWMWDLW9BIZDJOPWTDWMLDWZZZZDMWDWMPWLDOWZ9ZDJWTDWMWLTDWPZZZZDJOWDWMWLTDWI9BZDJOWPWDWMWDIWZZZZZDJWDWMWLDOPWZZ9DJWDWMWLTDWZZZZZDJOPWDWMWLWDWIZZ9BDJOWTDWPWMLEDCHWZZZZDEHJWDSECHWLJDWEHWPZZD9CE8HJWDWEHWLDMOWEHZZZZZDWECH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_MB_PI_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001212
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_MB_ToF_No_LMG : 142407 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
142407.4 142407.4 56.24 / 0.04% 7484 / 5.3% 23.2 5470.8 5109.3 Mana 0.38% 35.1 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_ToF_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:552957|235656|183958|165559|134706|132490|76417&chds=0,1105914&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++552957++devouring_plague,9482C9,0,0,15|t++235656++vampiric_touch,9482C9,1,0,15|t++183958++halo,9482C9,2,0,15|t++165559++shadow_word_death,9482C9,3,0,15|t++134706++shadow_word_pain,9482C9,4,0,15|t++132490++mind_blast,9482C9,5,0,15|t++76417++mind_flay,9482C9,6,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_ToF_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:24,12,12,10,10,8,7,5,5,5,4,4,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mindbender: melee|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|mindbender: stormlash&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_ToF_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:2468754321zz100yxvurolifcaababbdffffefeeedddeeeedcaZWWVUUVWWXYZaaabbbaaabbbdedccbaZYXWWVVWWXXYYXWVVVTUUUUVWVVVUTSRQQSTVVXYabbbbccbbcddfefecaaYXVUTTSSSSTTTTSSSSSTTTTUWXXYZYYXXWWYYYZaabcdcbccaZaaZbbcabaaZYXWVVVUUVWXYZXYYYXXWWWWXYXXXWUTSRQRRSSUXYZaabbccccddefggfedbZXWUVUUUUVWXXWYXXXWXYYYZaZYZXWVUTTUTVVXYaaccddeeffffggihhgfdcbaYZZYYXYYZZYaZaaZaaaZabbbcaZYXWVXVWWXYZaccdeeffghijjlkllkjihgeedcbbbbbbabbbaaaaabcedeeeddccbdccddefghghhhhhijjkkmlmmllkjihiihhhhhhhghhhhghggghiihigfedcbdcbbbcddeeffgggiklmnonoppoommlmllkkjiiigghhhhhhghhjiiihggggfhhhggghiihhhhgfhkklmnnmnnonnno&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4605,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=142407|max=309258&chxp=1,1,46,100& http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_ToF_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,3,4,6,20,36,67,122,164,292,409,554,729,918,1176,1378,1540,1638,1773,1739,1686,1615,1526,1343,1231,1030,897,712,573,464,361,277,216,150,106,87,38,45,25,14,4,7,6,3,4,1,0,1,0,1&chds=0,1773&chbh=5&chxt=x&chxl=0:|min=126479|avg=142407|max=165780&chxp=0,1,41,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MB_ToF_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:51.4,14.7,9.6,7.0,3.6,3.6,2.6,1.8,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 232.3s|shadow_word_pain 66.4s|mind_blast 43.2s|vampiric_touch 31.4s|shadow_word_death 16.4s|devouring_plague 16.3s|halo 11.8s|mindbender 8.3s|waiting 1.7s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_MB_ToF_No_LMG 142407
devouring_plague 6746 (19909) 4.7% (14.0%) 15.6 30.30sec 577876 552957 153985 315929 195851 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.55 15.55 0.00 0.00 1.0451 0.0000 3046271.56 3046271.56 0.00 552956.86 552956.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.53 74.15% 153984.55 126181 248952 153989.99 129804 192698 1775890 1775890 0.00
crit 4.02 25.85% 315929.09 252361 597485 312430.93 0 503281 1270382 1270382 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3165 2.2% 42.1 10.62sec 33897 0 26430 54941 33947 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.13 42.07 0.00 0.00 0.0000 0.0000 1428202.58 1428202.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.98 73.63% 26429.65 21031 41493 26449.19 22062 31282 818736 818736 0.00
crit 11.09 26.37% 54940.62 42061 99583 54972.50 0 77014 609466 609466 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9998 7.0% 15.6 30.30sec 290203 0 0 0 0 0.0% 0.0% 0.0% 0.0% 138.8 25556 52625 32523 25.7% 0.0% 20.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.55 15.55 138.79 138.79 0.0000 0.6586 4513839.54 4513839.54 0.00 49382.85 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.1 74.26% 25555.75 21031 41493 25563.48 22467 30260 2633853 2633853 0.00
crit 35.7 25.74% 52624.69 42061 99583 52604.53 44577 63688 1879986 1879986 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4814) 0.0% (3.4%) 11.3 41.40sec 192215 183958 0 0 0 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 1.0449 0.0000 0.00 0.00 0.00 183958.27 183958.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.32 73.66% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.98 26.34% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4814 3.4% 11.3 41.40sec 192215 0 149860 310248 192217 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 0.0000 0.0000 2171627.42 2171627.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.31 73.59% 149859.73 124529 229089 149879.52 124529 185272 1245990 1245990 0.00
crit 2.98 26.41% 310247.52 249057 549813 299807.97 0 514210 925638 925638 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.40sec 0 0 0 0 0 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.30 121.80 0.00 0.00 0.0000 0.0000 0.00 32705826.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.55 70.24% 0.00 0 0 0.00 0 0 0 17378620 100.00
crit 36.25 29.76% 0.00 0 0 0.00 0 0 0 15327207 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_MB_ToF_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12677 8.9% 36.8 12.24sec 155383 132490 121806 252058 155383 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.85 36.85 0.00 0.00 1.1728 0.0000 5725707.78 5725707.78 0.00 132490.46 132490.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.35 74.22% 121805.93 100626 199791 121845.20 109329 139539 3331329 3331329 0.00
crit 9.50 25.78% 252058.28 201251 479497 252205.79 0 336671 2394379 2394379 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 30204 (39371) 21.2% (27.6%) 149.9 2.96sec 118443 76417 0 0 0 0.0% 0.0% 0.0% 0.0% 325.2 32505 68292 41886 26.2% 0.0% 46.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.89 149.89 325.18 325.18 1.5500 0.6506 13620333.92 13620333.92 0.00 76416.67 76416.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 239.9 73.79% 32505.38 26761 52794 32521.68 30152 36398 7799458 7799458 0.00
crit 85.2 26.21% 68291.96 53521 126706 68324.46 61221 76827 5820876 5820876 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 9166 6.4% 98.8 4.46sec 41849 0 32513 68280 41873 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.76 98.70 0.00 0.00 0.0000 0.0000 4132938.97 4132938.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.87 73.83% 32512.63 26761 52794 32528.77 29321 36980 2369181 2369181 0.00
crit 25.83 26.17% 68279.58 53521 126706 68308.10 57014 85377 1763758 1763758 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.9 60.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 7.92 0.00 0.00 1.0501 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 6009 4.2% 15.7 4.94sec 173241 165559 135543 279601 173241 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.69 15.69 0.00 0.00 1.0465 0.0000 2718311.30 2718311.30 0.00 165558.88 165558.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.58 73.83% 135542.70 98214 195564 135752.29 110000 176057 1570249 1570249 0.00
crit 4.11 26.17% 279601.10 196429 469355 276967.44 0 469355 1148062 1148062 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 15179 (19815) 10.7% (13.9%) 63.6 7.05sec 140738 134706 0 0 0 0.0% 0.0% 0.0% 0.0% 284.2 18911 39037 24127 25.9% 0.0% 96.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.59 63.59 284.17 284.17 1.0448 1.5320 6856194.51 6856194.51 0.00 17835.55 134705.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 210.5 74.09% 18911.37 15692 30949 18916.40 17068 21534 3981480 3981480 0.00
crit 73.6 25.91% 39037.04 31384 74279 39030.78 34453 45156 2874715 2874715 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4636 3.3% 86.3 5.15sec 24265 0 19006 39343 24285 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.28 86.21 0.00 0.00 0.0000 0.0000 2093523.21 2093523.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.83 74.05% 19006.23 15692 30949 19011.39 17099 22371 1213218 1213218 0.00
crit 22.37 25.95% 39343.34 31384 74279 39352.89 33576 49611 880305 880305 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 6424 4.5% 96.0 4.63sec 30223 0 24002 49773 30733 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.99 94.40 0.00 0.00 0.0000 0.0000 2901139.14 2901139.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.74 73.88% 24001.68 19578 39030 24002.24 21690 27689 1673870 1673870 0.00
crit 24.66 26.12% 49773.01 39157 93671 49770.71 41554 60523 1227269 1227269 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1358 0.9% 23.6 13.62sec 25615 0 18151 43133 25615 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.55 23.55 0.00 0.00 0.0000 0.0000 603241.90 603241.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.51 70.12% 18150.76 12216 24618 18162.36 14629 22059 299734 299734 0.00
crit 7.04 29.88% 43133.33 24432 51377 43152.40 0 51377 303508 303508 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:16345.08
  • base_dd_max:16345.08
vampiric_touch 12607 (16405) 8.9% (11.5%) 30.1 15.04sec 246163 235656 0 0 0 0.0% 0.0% 0.0% 0.0% 203.7 21757 45321 27923 26.2% 0.0% 87.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.07 30.07 203.74 203.74 1.0446 1.9494 5688894.28 5688894.28 0.00 17273.57 235656.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 150.4 73.83% 21757.44 17688 35579 21767.43 19952 24338 3272930 3272930 0.00
crit 53.3 26.17% 45321.26 35377 85390 45335.15 39069 51765 2415964 2415964 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3798 2.7% 61.8 7.11sec 27718 0 21660 44997 27741 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.85 61.79 0.00 0.00 0.0000 0.0000 1714245.08 1714245.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.69 73.94% 21660.39 17688 35579 21667.89 19392 24873 989734 989734 0.00
crit 16.10 26.06% 44997.07 35377 85390 45011.92 36456 58856 724511 724511 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 60493 / 15626
melee 60307 10.9% 118.4 3.70sec 59266 63438 47198 102726 59267 26.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.43 118.43 0.00 0.00 0.9342 0.0000 7018776.58 7018776.58 0.00 63437.97 63437.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.45 49.36% 47197.89 34254 67577 47246.43 40372 55481 2758831 2758831 0.00
crit 31.56 26.65% 102726.08 68508 162186 102828.10 82996 128000 3241596 3241596 0.00
glance 28.42 24.00% 35833.83 25691 50683 35860.83 29856 43153 1018350 1018350 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.0463 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 186 0.0% 17.4 9.61sec 1229 0 862 2065 1229 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.37 17.37 0.00 0.00 0.0000 0.0000 21358.54 21358.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.07 69.46% 862.00 564 988 887.80 609 988 10402 10402 0.00
crit 5.31 30.54% 2065.25 1128 2371 2107.20 0 2371 10957 10957 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:754.39
  • base_dd_max:754.39

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 33.33%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.8 1.7 81.3sec 60.1sec 28.86% 28.86%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:28.86%

    Trigger Attempt Success

    • trigger_pct:99.73%
chayes_essence_of_brilliance 11.1 3.0 41.7sec 32.2sec 27.81% 27.81%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.81%

    Trigger Attempt Success

    • trigger_pct:99.81%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.6 11.7 31.6sec 17.1sec 52.77% 52.77%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:52.77%

    Trigger Attempt Success

    • trigger_pct:99.29%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.3sec 10.3sec 10.09% 49.46%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.09%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.99%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
twist_of_fate 1.0 130.0 0.0sec 0.6sec 16.95% 16.95%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.36% 4.36%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.36%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 85.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-skull_banner 2.1 0.0 180.0sec 180.0sec 17.52% 30.00%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:17.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
mindbender-stormlash 1.5 0.0 300.0sec 300.0sec 11.93% 11.93%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:11.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_MB_ToF_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_MB_ToF_No_LMG
devouring_plague Shadow Orb 15.6 46.7 3.0 3.0 192624.0
halo Mana 11.3 457562.5 40500.0 40499.7 4.7
mind_blast Mana 36.8 331640.6 9000.0 9000.0 17.3
mind_flay Mana 149.9 449667.8 3000.0 3000.0 39.5
shadow_word_death Mana 15.7 122395.1 7800.0 7800.4 22.2
shadow_word_pain Mana 63.6 839386.4 13200.0 13199.7 10.7
vampiric_touch Mana 30.1 270667.1 9000.0 9000.0 27.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.00 5.76 (0.00%) 18000.00 0.00 0.00%
mindbender Mana 118.43 461702.45 (20.00%) 3898.56 57129.01 11.01%
Shadow Orbs from Mind Blast Shadow Orb 36.85 36.85 (82.29%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.93 7.93 (17.71%) 1.00 0.00 0.00%
Devouring Plague Health Health 180.86 0.00 (-nan%) 0.00 3079309.88 100.00%
Vampiric Touch Mana Mana 265.53 1327935.56 (57.54%) 5001.03 79871.56 5.67%
mp5_regen Mana 1806.42 518364.46 (22.46%) 286.96 23562.01 4.35%
Resource RPS-Gain RPS-Loss
Mana 5109.27 5470.79
Shadow Orb 0.10 0.10
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 137030.70 5771.43 251428.57
Shadow Orb 1.12 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.5%
shadowfiend-Mana Cap 4.5%
lightwell-Mana Cap 4.5%

Procs

Count Interval
Shadowy Recall Extra Tick 288.8 1.5sec
Shadowy Apparition Procced 96.0 4.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_MB_ToF_No_LMG Damage Per Second
Count 24992
Mean 142407.42
Minimum 126479.01
Maximum 165779.57
Spread ( max - min ) 39300.56
Range [ ( max - min ) / 2 * 100% ] 13.80%
Standard Deviation 4536.3008
5th Percentile 135317.24
95th Percentile 150284.73
( 95th Percentile - 5th Percentile ) 14967.49
Mean Distribution
Standard Deviation 28.6947
95.00% Confidence Intervall ( 142351.18 - 142463.66 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3897
0.1 Scale Factor Error with Delta=300 175665
0.05 Scale Factor Error with Delta=300 702663
0.01 Scale Factor Error with Delta=300 17566585
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 142407.42
Distribution Chart

Damage

Sample Data
Count 24992
Mean 57214471.17
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_MB_ToF_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_MB_ToF_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_MB_ToF_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 264.09
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 7.92 mindbender,if=talent.mindbender.enabled
A 0.00 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 4.72 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 45.22 mind_blast,if=active_enemies<=6&cooldown_react
E 7.93 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 0.00 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 0.00 mind_flay_insanity,interrupt=1,chain=1
H 7.76 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 5.82 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 13.77 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 13.29 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 16.38 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 10.83 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 11.30 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 1.00 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 9.51 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 63.16 mind_flay,chain=1,interrupt=1
X 0.00 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 44.47 shadow_word_pain,moving=1
a 0.00 dispersion

Sample Sequence

9CIPDJWTDWLMWDWZZZZDMOWTDPWMWDIW9ZZDMOWDWMWLWDPWZZZZZDJOWDWMWLWDWI9ZDJOPWDWMWDLWZZZZZDJWTDWMPLWDOWZZ9DJWTDWMWLTDWPZZZZDJOWDWMWLWDWIZZ9DJOWPWTDWMWLWDWZZZZZDJOWDWMWLPTDWZZZD9JOWDWMLTDWZZZPZDJWDWMWLDOWIZZDJ9WPDWMWECDHIWZZZZDECHJWDSEHWLMPDCEHWZZZDME98CHWDWEHMWDIWECHZZZPDJWE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_MB_ToF_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!001202
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_MFI_DI_No_LMG : 146009 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
146008.8 146008.8 71.22 / 0.05% 9432 / 6.5% 27.6 5041.5 4555.9 Mana 0.93% 39.4 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_DI_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:527433|224097|178852|144399|139281|135858|132773|73869&chds=0,1054866&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++527433++devouring_plague,9482C9,0,0,15|t++224097++vampiric_touch,9482C9,1,0,15|t++178852++halo,9482C9,2,0,15|t++144399++shadow_word_death,9482C9,3,0,15|t++139281++mind_blast,9482C9,4,0,15|t++135858++shadow_word_pain,9482C9,5,0,15|t++132773++mind_flay_insanity,9482C9,6,0,15|t++73869++mind_flay,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_DI_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:14,13,12,10,9,8,6,5,4,4,4,3,3,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay_insanity|mind_flay|mind_blast|shadow_word_pain|devouring_plague_tick|vampiric_touch|devouring_plague|shadowfiend: melee|mind_flay_insanity_mastery|shadowy_apparition|mind_flay_mastery|shadow_word_death|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|vampiric_touch_mastery|stormlash|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_DI_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:6877532110z0212zzwspnmkiggggghghhggfffffeefffggffecbaZZXYXXXXXXXXWWWWWWWXXYYZZZZZZYYXXXXXXYYYYZYYYYXXXXYYYZZZZYXWVUTUTTUUUVVWVVVVVVWXYYZaabbaZZYXWXWXXXXYYYXYXYXXXYYYZaaaaaYYYYYZabcdegghgggffffgggggfeecbZYXWXXXXYYYZZZZZZYYYYZZZaaaaZYWVVTUTTUUVVVWVVVVUUVWXYYZaaaaZZYXWXXXXYYZYZYYYYXXXXXYYZZaaZYYXXWXXXYYZaabaaaaaZabbbbcccccbaZYYYYYYZZZaaaaaaaaaabbcccddbaZXYXZZaacdefgfgfgffgiikkkjjjigfdcbbbbbbcccccccccccccddeeefecccbbbbbbbbcccccccdddeeefggggggffededdddddeeeeeeeeeefffggghfddccabaZZZZZZZYZYZZZabcccddeeeedccbcbbbbababaaaaaaaaabbbbbbaZZYYYaaabcdeeffffffgiijiiiihhgfedcb&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4628,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=146009|max=315498&chxp=1,1,46,100& http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_DI_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,0,6,3,15,14,25,30,56,73,86,124,181,251,303,432,577,802,945,1240,1429,1561,1780,1807,1857,1804,1672,1522,1329,1108,999,729,603,457,370,236,179,130,98,62,38,24,10,13,5,2,0,1,2&chds=0,1857&chbh=5&chxt=x&chxl=0:|min=120221|avg=146009|max=170910&chxp=0,1,51,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_DI_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:32.2,19.6,13.6,11.6,6.5,4.5,3.1,2.4,0.7,0.1,0.9&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 145.6s|mind_flay_insanity 88.5s|shadow_word_pain 61.3s|mind_blast 52.3s|vampiric_touch 29.6s|devouring_plague 20.5s|shadow_word_death 14.1s|halo 11.0s|shadowfiend 3.2s|dispersion 0.3s|waiting 4.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_MFI_DI_No_LMG 146009
devouring_plague 8165 (23933) 5.6% (16.4%) 19.6 23.81sec 551458 527433 147811 304368 188133 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.58 19.58 0.00 0.00 1.0456 0.0000 3683172.08 3683172.08 0.00 527432.77 527432.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.53 74.24% 147811.39 126181 216480 147840.14 129626 171885 2148378 2148378 0.00
crit 5.04 25.76% 304368.34 252361 519552 303528.25 0 482117 1534794 1534794 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3758 2.6% 52.3 8.59sec 32402 0 25257 52595 32450 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.29 52.22 0.00 0.00 0.0000 0.0000 1694431.64 1694431.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.48 73.69% 25256.99 21031 36081 25274.05 22205 29782 971878 971878 0.00
crit 13.74 26.31% 52594.55 42061 86594 52624.82 42674 70016 722554 722554 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12011 8.2% 19.6 23.81sec 276771 0 0 0 0 0.0% 0.0% 0.0% 0.0% 172.3 24665 50921 31448 25.8% 0.0% 25.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.58 19.58 172.30 172.30 0.0000 0.6591 5418417.71 5418417.71 0.00 47715.40 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.8 74.17% 24665.48 21031 52926 24674.10 21906 28175 3152075 3152075 0.00
crit 44.5 25.83% 50920.55 42061 105852 50909.66 44453 60509 2266343 2266343 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4361) 0.0% (3.0%) 10.5 43.77sec 186948 178852 0 0 0 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.51 10.51 0.00 0.00 1.0453 0.0000 0.00 0.00 0.00 178851.69 178851.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.74 73.63% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.77 26.37% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4361 3.0% 10.5 43.77sec 186948 0 146202 301037 186950 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.51 10.51 0.00 0.00 0.0000 0.0000 1964506.97 1964506.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.74 73.68% 146201.89 124529 199208 146253.61 124529 180986 1132021 1132021 0.00
crit 2.77 26.32% 301037.01 249057 478099 288182.12 0 478099 832486 832486 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.5 43.77sec 0 0 0 0 0 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.51 113.22 0.00 0.00 0.0000 0.0000 0.00 29658315.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.52 70.23% 0.00 0 0 0.00 0 0 0 15805854 100.00
crit 33.70 29.77% 0.00 0 0 0.00 0 0 0 13852462 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_MFI_DI_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 16138 11.1% 47.8 9.38sec 152345 139281 119209 246971 152345 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.78 47.78 0.00 0.00 1.0938 0.0000 7279798.59 7279798.59 0.00 139280.97 139280.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.39 74.06% 119209.24 100626 173731 119249.57 106291 137604 4219012 4219012 0.00
crit 12.39 25.94% 246970.63 201251 416954 247034.14 201251 306294 3060787 3060787 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18293 (23840) 12.5% (16.3%) 95.4 4.46sec 112744 73869 0 0 0 0.0% 0.0% 0.0% 0.0% 200.9 31923 66865 41062 26.2% 0.0% 28.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.37 95.37 200.93 200.93 1.5263 0.6503 8250492.24 8250492.24 0.00 73869.12 73869.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.4 73.85% 31922.62 26761 45908 31940.79 28798 35722 4736548 4736548 0.00
crit 52.6 26.15% 66865.01 53521 110180 66878.49 58590 78187 3513944 3513944 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 19975 (26045) 13.7% (17.8%) 54.7 8.18sec 214573 132773 0 0 0 0.0% 0.0% 0.0% 0.0% 121.1 57761 121012 74357 26.2% 0.0% 17.5%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.74 54.74 121.15 121.15 1.6161 0.6526 9008052.91 9008052.91 0.00 132773.45 132773.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.4 73.76% 57760.77 26761 91816 57847.71 47994 68893 5161398 5161398 0.00
crit 31.8 26.24% 121011.81 53521 220359 121186.05 95272 163385 3846655 3846655 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6070 4.2% 36.8 12.02sec 74320 0 57773 121101 74408 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.82 36.78 0.00 0.00 0.0000 0.0000 2736688.38 2736688.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.12 73.73% 57773.23 26761 91816 57865.28 43247 74661 1566752 1566752 0.00
crit 9.66 26.27% 121101.16 53521 220359 121299.31 0 213810 1169936 1169936 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 5548 3.8% 61.0 6.79sec 40999 0 31896 66785 41010 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.03 61.01 0.00 0.00 0.0000 0.0000 2502191.88 2502191.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.08 73.88% 31895.55 26761 45908 31910.71 28209 37290 1437704 1437704 0.00
crit 15.94 26.12% 66785.30 53521 110180 66797.56 54067 91752 1064488 1064488 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4519 3.1% 13.5 5.79sec 151024 144399 118214 243623 151024 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.52 13.52 0.00 0.00 1.0459 0.0000 2041372.97 2041372.97 0.00 144399.30 144399.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.98 73.84% 118213.74 98214 170056 118397.76 99238 164937 1179803 1179803 0.00
crit 3.54 26.16% 243622.57 196429 408134 238906.78 0 408134 861570 861570 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 14145 (18473) 9.7% (12.7%) 58.7 7.57sec 141950 135858 0 0 0 0.0% 0.0% 0.0% 0.0% 271.2 18450 38084 23534 25.9% 0.0% 92.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.71 58.71 271.18 271.18 1.0448 1.5457 6381796.94 6381796.94 0.00 17345.15 135858.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 201.0 74.11% 18449.94 15692 26913 18457.58 16657 20695 3707792 3707792 0.00
crit 70.2 25.89% 38083.68 31384 64590 38081.51 33917 43558 2674005 2674005 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4328 3.0% 82.4 5.38sec 23699 0 18546 38411 23716 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.39 82.33 0.00 0.00 0.0000 0.0000 1952442.01 1952442.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.90 73.97% 18545.64 15692 26913 18553.73 16796 21039 1129428 1129428 0.00
crit 21.43 26.03% 38411.07 31384 64590 38420.08 32744 46643 823014 823014 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 1.0575 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6019 4.1% 91.6 4.83sec 29635 0 23460 48699 30060 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.63 90.34 0.00 0.00 0.0000 0.0000 2715435.14 2715435.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.72 73.85% 23460.09 19578 33939 23463.72 21160 27033 1565152 1565152 0.00
crit 23.62 26.15% 48699.35 39157 81453 48693.65 40670 59895 1150283 1150283 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1378 0.9% 24.5 13.14sec 25002 0 17773 42141 25002 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.50 24.50 0.00 0.00 0.0000 0.0000 612434.24 612434.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.23 70.34% 17773.32 12216 21407 17782.32 14019 21010 306229 306229 0.00
crit 7.27 29.66% 42140.93 24432 51377 42161.40 0 51377 306206 306206 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12871.08
  • base_dd_max:12871.08
vampiric_touch 11288 (14689) 7.7% (10.1%) 28.0 15.81sec 236779 224097 0 0 0 0.0% 0.0% 0.0% 0.0% 187.8 21161 44002 27115 26.1% 0.0% 81.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.98 27.98 187.77 187.77 1.0566 1.9510 5091223.43 5091223.43 0.00 16735.04 224096.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.8 73.94% 21161.25 17688 30939 21173.51 19011 24291 2937757 2937757 0.00
crit 48.9 26.06% 44002.00 35377 74252 44015.67 38274 51390 2153467 2153467 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3401 2.3% 57.0 7.53sec 26894 0 21062 43595 26911 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.05 57.01 0.00 0.00 0.0000 0.0000 1534193.98 1534193.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.21 74.04% 21061.89 17688 30939 21069.52 18368 24702 889028 889028 0.00
crit 14.80 25.96% 43595.09 35377 74252 43603.27 35917 57700 645166 645166 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 83257 / 6613
melee 82969 4.5% 35.5 11.17sec 82993 92392 62551 148536 82993 27.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.46 35.46 0.00 0.00 0.8983 0.0000 2942951.20 2942951.20 0.00 92391.65 92391.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.05 48.09% 62550.83 42818 84472 62661.28 48682 80669 1066710 1066710 0.00
crit 9.90 27.91% 148535.98 98481 202733 148553.98 100993 202733 1469938 1469938 0.00
glance 8.51 24.00% 47739.90 32114 63354 47777.93 0 63354 406303 406303 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0501 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 288 0.0% 7.0 0.74sec 1447 0 987 2369 1447 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 10129.80 10129.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.67 66.70% 986.86 828 988 986.48 0 988 4607 4607 0.00
crit 2.33 33.30% 2368.85 1987 2371 2227.13 0 2371 5522 5522 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:988.00
  • base_dd_max:988.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 33.33%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.8 1.7 81.3sec 60.1sec 28.89% 28.89%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:28.89%

    Trigger Attempt Success

    • trigger_pct:99.76%
chayes_essence_of_brilliance 11.1 3.0 41.7sec 32.3sec 27.78% 27.78%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.78%

    Trigger Attempt Success

    • trigger_pct:99.81%
divine_insight_shadow 17.0 0.7 24.8sec 23.7sec 5.79% 32.34%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.79%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 419.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.6 11.7 31.6sec 17.2sec 52.76% 52.76%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:52.76%

    Trigger Attempt Success

    • trigger_pct:99.32%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 9.1 0.0 8.8sec 8.8sec 11.63% 32.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:11.63%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 7.84%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.22% 14.22%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.22%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.8sec 74.8sec 83.41% 80.64%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 61.79% 72.65%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:61.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.38% 16.38%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.69% 5.69%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.69%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_DI_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_MFI_DI_No_LMG
devouring_plague Shadow Orb 19.6 58.7 3.0 3.0 183818.1
halo Mana 10.5 425583.7 40500.0 40499.8 4.6
mind_blast Mana 47.8 269220.6 5634.0 5634.0 27.0
mind_flay Mana 95.4 286118.4 3000.0 3000.0 37.6
mind_flay_insanity Mana 54.7 164206.2 3000.0 3000.0 71.5
shadow_word_death Mana 13.5 105437.0 7800.0 7800.4 19.4
shadow_word_pain Mana 58.7 775004.2 13200.0 13200.0 10.8
vampiric_touch Mana 28.0 251834.0 9000.0 9000.0 26.3
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.40 7141.68 (0.35%) 18000.00 0.00 0.00%
shadowfiend Mana 35.46 278920.03 (13.55%) 7865.65 40224.65 12.60%
Shadow Orbs from Mind Blast Shadow Orb 47.78 47.76 (83.96%) 1.00 0.02 0.05%
Shadow Orbs from Shadow Word: Death Shadow Orb 9.13 9.13 (16.04%) 1.00 0.00 0.00%
Devouring Plague Health Health 224.52 0.00 (-nan%) 0.00 3822612.00 100.00%
Vampiric Touch Mana Mana 244.78 1248473.96 (60.66%) 5100.44 49162.60 3.79%
mp5_regen Mana 1806.42 523510.04 (25.44%) 289.81 18416.42 3.40%
Resource RPS-Gain RPS-Loss
Mana 4555.92 5041.52
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 80082.71 0.00 262200.00
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.6%
shadowfiend-Mana Cap 3.6%
lightwell-Mana Cap 3.6%

Procs

Count Interval
Shadowy Recall Extra Tick 289.3 1.5sec
Shadowy Apparition Procced 91.6 4.8sec
Divine Insight Mind Blast CD Reset 31.3 23.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_MFI_DI_No_LMG Damage Per Second
Count 24992
Mean 146008.81
Minimum 120220.86
Maximum 170910.42
Spread ( max - min ) 50689.56
Range [ ( max - min ) / 2 * 100% ] 17.36%
Standard Deviation 5744.6342
5th Percentile 136633.21
95th Percentile 155497.01
( 95th Percentile - 5th Percentile ) 18863.81
Mean Distribution
Standard Deviation 36.3381
95.00% Confidence Intervall ( 145937.59 - 146080.03 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5946
0.1 Scale Factor Error with Delta=300 281713
0.05 Scale Factor Error with Delta=300 1126855
0.01 Scale Factor Error with Delta=300 28171399
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 146008.81
Distribution Chart

Damage

Sample Data
Count 24992
Mean 62866651.11
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_MFI_DI_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_MFI_DI_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_MFI_DI_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 296.59
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.02 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 5.83 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 52.05 mind_blast,if=active_enemies<=6&cooldown_react
E 9.13 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 6.75 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 22.03 mind_flay_insanity,interrupt=1,chain=1
H 3.79 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 8.83 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 15.77 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 10.06 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 13.06 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 13.74 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 10.51 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 19.64 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 14.48 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 46.42 mind_flay,chain=1,interrupt=1
X 0.60 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 39.83 shadow_word_pain,moving=1
a 0.06 dispersion

Sample Sequence

ACIPDGJWDWLWDMWTTDOGZZZZDWMWTDPWDOGIDJWZZZTDWMWDOGDFIMPWTDWZZZZWDMOGFDWLDJWIZZDJOGDPWMWDLDOGZZZZZDJWDWMWLTDWPTTTTTTTDOGAZZJDWDWMWLWDOGZZZZZDJPWDWMWLWDOGIZZDJWDWPMWDIWZZZZZDJOGFDWMWLWDWPZZZDJOGFDWMWLWDWZZDOZGFDJPWWTDWLWMWDOIAZJTDWWDMWLECGDGEHPZDOGDGEHJWDOGEGIDMECGXZZDWM8EHPWDWECGDEFIJXZZZDJOGE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_MFI_DI_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002222
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_MFI_PI_No_LMG : 148880 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
148880.1 148880.1 64.31 / 0.04% 8471 / 5.7% 27.0 5257.1 4811.1 Mana 0.50% 36.6 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_PI_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:561030|249247|182760|151424|146977|134055|129531|80333&chds=0,1122060&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++561030++devouring_plague,9482C9,0,0,15|t++249247++vampiric_touch,9482C9,1,0,15|t++182760++halo,9482C9,2,0,15|t++151424++mind_flay_insanity,9482C9,3,0,15|t++146977++shadow_word_death,9482C9,4,0,15|t++134055++shadow_word_pain,9482C9,5,0,15|t++129531++mind_blast,9482C9,6,0,15|t++80333++mind_flay,9482C9,7,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_PI_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:16,13,11,9,9,7,5,5,5,5,4,3,3,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay|mind_flay_insanity|shadow_word_pain|vampiric_touch|mind_blast|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadowfiend: melee|mind_flay_insanity_mastery|shadow_word_pain_mastery|shadow_word_death|halo_damage|vampiric_touch_mastery|devouring_plague_mastery|stormlash|shadowfiend: stormlash&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_PI_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:6778765432123210zwsrqoljgeeeddccccccbbaYXXWXXXYXXXWVVUTSTTTTTTUTTTTSSSSSSSTTUTTTSSRQQQRRSSTTUUUTTSTTTTTTUUVUUUTRQPPOPQQQRSTTUTTUUUUUVWXYYYYYYXWVUUUUTTTTUUUTTTTSSRRRSTUUUUUTSSSSUVVWYabddcccbbabbbbbbaZZXVTRQPQQQRSUVWWWWXWWVWWWWXXXWWVTRQOOPPPQSUWXYZYYYZZZabccddccaYWUTSSRRRRRSRSQRRQQQQQQSSUUVWWVVVUUVVVVWXXYYWWVVUSTTSTUVUVVUUTTSRSSSTTUVWWWWWWWWWWWXXYYYYXVUSSSUUUWYbdeffffggghijlklkjihfcaYXYYXXXXXXXWXXWWWWWWXXYYZZYXXXWWXWWWWXXXXWXXXXXYYYYZaaabbaaZYYZYXXYYYYZYZZZYYYYZZabbbbaYYXXWXWWWWXXXYYYYZZZabccdeeeffeeccbcbbaaaaaaZZZZYYYYYYYZZZZYXXWWWXXXYYZaabbcbbcbbbaaabaZZYXVUTS&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3994,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=148880|max=372778&chxp=1,1,40,100& http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_PI_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,4,5,9,16,21,25,56,65,95,156,216,308,469,598,930,1139,1350,1657,1761,1920,1874,1980,1749,1636,1486,1228,1041,832,661,472,366,281,182,138,87,60,48,23,19,8,7,7,1,1,1,0,0,0,1&chds=0,1980&chbh=5&chxt=x&chxl=0:|min=127393|avg=148880|max=176177&chxp=0,1,44,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_PI_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:36.8,16.3,15.1,9.8,6.7,3.7,3.2,2.5,0.7,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 166.1s|mind_flay_insanity 73.5s|shadow_word_pain 68.4s|mind_blast 44.2s|vampiric_touch 30.2s|devouring_plague 16.6s|shadow_word_death 14.5s|halo 11.2s|shadowfiend 3.2s|dispersion 0.1s|waiting 2.2s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_MFI_PI_No_LMG 148880
devouring_plague 6755 (20660) 4.5% (13.9%) 15.9 29.57sec 585090 561030 149656 310543 191287 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.94 15.94 0.00 0.00 1.0429 0.0000 3049701.17 3049701.17 0.00 561029.81 561029.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.82 74.13% 149655.54 126181 227304 149688.25 128755 175580 1768646 1768646 0.00
crit 4.13 25.87% 310542.65 252361 545530 307479.56 0 529315 1281055 1281055 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3363 2.3% 45.2 9.99sec 33593 0 25980 54964 33644 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.17 45.10 0.00 0.00 0.0000 0.0000 1517238.36 1517238.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.17 73.56% 25979.52 21031 37885 26003.06 22256 31085 861781 861781 0.00
crit 11.93 26.44% 54963.52 42061 90923 54994.83 42061 76940 655457 655457 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10543 7.1% 15.9 29.57sec 298640 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.8 24991 52147 31998 25.8% 0.0% 20.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.94 15.94 148.80 148.80 0.0000 0.6288 4761303.04 4761303.04 0.00 50890.37 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.4 74.20% 24991.43 21031 37885 25002.10 22250 29112 2759137 2759137 0.00
crit 38.4 25.80% 52147.10 42061 90923 52117.11 44930 61650 2002166 2002166 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4540) 0.0% (3.0%) 10.7 43.25sec 190505 182760 0 0 0 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.74 10.74 0.00 0.00 1.0424 0.0000 0.00 0.00 0.00 182760.39 182760.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.89 73.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.85 26.54% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4540 3.0% 10.7 43.25sec 190505 0 149033 306225 190500 26.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.74 10.74 0.00 0.00 0.0000 0.0000 2045454.25 2045454.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.90 73.62% 149033.15 124529 209168 149085.16 124529 188227 1178009 1178009 0.00
crit 2.83 26.38% 306224.74 249057 502003 293900.28 0 502003 867445 867445 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.7 43.25sec 0 0 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.74 115.21 0.00 0.00 0.0000 0.0000 0.00 30284044.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.79 70.12% 0.00 0 0 0.00 0 0 0 16139444 100.00
crit 34.42 29.88% 0.00 0 0 0.00 0 0 0 14144600 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_MFI_PI_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12671 8.5% 36.9 12.24sec 155118 129531 120964 252130 155118 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.87 36.87 0.00 0.00 1.1976 0.0000 5719555.78 5719555.78 0.00 129530.66 129530.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.27 73.96% 120963.86 100626 182417 121005.71 107846 135375 3298861 3298861 0.00
crit 9.60 26.04% 252129.89 201251 437802 252263.82 0 342709 2420695 2420695 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 22735 (29607) 15.3% (19.9%) 108.8 3.97sec 122584 80333 0 0 0 0.0% 0.0% 0.0% 0.0% 242.4 32772 68764 42261 26.4% 0.0% 33.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.84 108.84 242.41 242.41 1.5260 0.6246 10244653.87 10244653.87 0.00 80332.55 80332.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 178.5 73.64% 32772.45 26761 48204 32798.70 29750 37672 5850053 5850053 0.00
crit 63.9 26.36% 68763.95 53521 115688 68814.21 58926 79300 4394601 4394601 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 18912 (24655) 12.7% (16.6%) 47.4 9.46sec 234904 151424 0 0 0 0.0% 0.0% 0.0% 0.0% 107.8 60943 130077 79186 26.4% 0.0% 14.8%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.39 47.39 107.84 107.84 1.5513 0.6212 8539617.97 8539617.97 0.00 151424.09 151424.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.4 73.61% 60942.84 26761 96407 61039.87 51645 74161 4838093 4838093 0.00
crit 28.5 26.39% 130076.75 53521 231377 130195.61 99392 165652 3701525 3701525 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 5743 3.9% 32.7 13.51sec 79236 0 61015 130193 79333 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.73 32.69 0.00 0.00 0.0000 0.0000 2593232.23 2593232.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.03 73.52% 61014.64 26761 96407 61120.06 44123 81390 1466311 1466311 0.00
crit 8.66 26.48% 130192.94 53521 231377 130271.31 0 231377 1126922 1126922 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 6873 4.6% 73.6 5.74sec 42053 0 32668 68437 42068 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.64 73.61 0.00 0.00 0.0000 0.0000 3096814.86 3096814.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.27 73.72% 32667.63 26761 48204 32692.64 29007 37739 1772822 1772822 0.00
crit 19.35 26.28% 68436.85 53521 115688 68486.31 55694 92116 1323993 1323993 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 120.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 4714 3.2% 13.9 5.62sec 153448 146977 119919 247790 153448 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.88 13.88 0.00 0.00 1.0441 0.0000 2130135.79 2130135.79 0.00 146976.87 146976.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.24 73.78% 119918.73 98214 178559 120140.53 98214 158198 1228163 1228163 0.00
crit 3.64 26.22% 247790.40 196429 428541 243399.96 0 428541 901972 901972 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 15581 (20326) 10.5% (13.7%) 65.6 6.80sec 139909 134055 0 0 0 0.0% 0.0% 0.0% 0.0% 292.4 18800 38952 24044 26.0% 0.0% 95.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.57 65.57 292.44 292.44 1.0437 1.4693 7031561.11 7031561.11 0.00 18416.25 134054.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 216.3 73.98% 18800.33 15692 28258 18810.88 17091 21666 4067430 4067430 0.00
crit 76.1 26.02% 38952.12 31384 67820 38957.58 34299 44674 2964132 2964132 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4746 3.2% 88.8 5.01sec 24130 0 18852 39160 24148 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.76 88.69 0.00 0.00 0.0000 0.0000 2141796.15 2141796.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.56 73.92% 18851.71 15692 28258 18859.55 17040 21453 1235928 1235928 0.00
crit 23.13 26.08% 39159.72 31384 67820 39170.54 32261 47812 905868 905868 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 1.0576 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6641 4.5% 99.2 4.48sec 30212 0 23879 49729 30666 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.21 97.74 0.00 0.00 0.0000 0.0000 2997246.26 2997246.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.08 73.74% 23878.74 19578 35636 23883.40 21421 26948 1721090 1721090 0.00
crit 25.66 26.26% 49728.70 39157 85526 49740.58 42098 60812 1276156 1276156 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1728 1.1% 29.0 11.02sec 26477 0 18663 44710 26477 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.01 29.01 0.00 0.00 0.0000 0.0000 768194.51 768194.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.31 70.00% 18663.17 12216 22477 18668.36 15445 21852 379057 379057 0.00
crit 8.70 30.00% 44709.56 24432 53946 44740.05 0 53946 389138 389138 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12871.08
  • base_dd_max:12871.08
vampiric_touch 12839 (16677) 8.6% (11.2%) 28.9 15.42sec 260790 249247 0 0 0 0.0% 0.0% 0.0% 0.0% 207.8 21675 45330 27876 26.2% 0.0% 85.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.86 28.86 207.83 207.83 1.0463 1.8493 5793547.35 5793547.35 0.00 18154.33 249246.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.3 73.78% 21675.00 17688 32485 21688.43 19515 24465 3323820 3323820 0.00
crit 54.5 26.22% 45330.06 35377 77965 45346.33 39419 53540 2469727 2469727 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3838 2.6% 63.1 6.87sec 27455 0 21417 44577 27475 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.09 63.05 0.00 0.00 0.0000 0.0000 1732202.25 1732202.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.55 73.84% 21416.68 17688 32485 21424.89 18917 24598 997016 997016 0.00
crit 16.49 26.16% 44576.52 35377 77965 44581.91 36007 60857 735186 735186 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 83900 / 6660
melee 83612 4.4% 35.4 11.16sec 83667 93148 63020 149784 83666 27.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.43 35.43 0.00 0.00 0.8982 0.0000 2964433.62 2964433.62 0.00 93147.95 93147.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.00 47.98% 63019.62 42818 84472 63126.82 49357 80668 1071233 1071233 0.00
crit 9.90 27.94% 149783.75 98481 202733 149748.13 0 202733 1483041 1483041 0.00
glance 8.53 24.08% 48074.38 32114 63354 48128.70 0 63354 410160 410160 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.0487 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 288 0.0% 7.0 0.74sec 1448 0 987 2370 1448 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 10137.55 10137.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.67 66.68% 987.45 828 988 986.87 0 988 4609 4609 0.00
crit 2.33 33.32% 2370.17 1987 2371 2225.06 0 2371 5529 5529 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:988.00
  • base_dd_max:988.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 23.15%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.9 1.9 79.7sec 58.0sec 29.70% 29.70%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:29.70%

    Trigger Attempt Success

    • trigger_pct:99.78%
chayes_essence_of_brilliance 11.3 3.3 40.7sec 31.0sec 28.73% 28.73%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:28.73%

    Trigger Attempt Success

    • trigger_pct:99.79%
jade_serpent_potion 2.0 0.0 419.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.7 12.6 31.3sec 16.5sec 54.03% 54.03%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:54.03%

    Trigger Attempt Success

    • trigger_pct:99.26%
power_infusion 4.3 0.0 120.8sec 120.8sec 18.53% 18.53%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 9.1 0.0 8.8sec 8.8sec 11.62% 34.14%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:11.62%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 9.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.23% 14.23%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.23%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.8sec 74.8sec 83.41% 80.64%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.33% 73.16%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.39% 16.39%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.69% 5.69%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.69%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_PI_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_MFI_PI_No_LMG
devouring_plague Shadow Orb 15.9 47.8 3.0 3.0 195027.3
halo Mana 10.7 411705.2 38344.8 38344.5 5.0
mind_blast Mana 36.9 320758.7 8699.2 8699.2 17.8
mind_flay Mana 108.8 312362.3 2870.1 2870.0 42.7
mind_flay_insanity Mana 47.4 135190.2 2852.5 2852.5 82.3
shadow_word_death Mana 13.9 104365.0 7517.8 7518.1 20.4
shadow_word_pain Mana 65.6 843039.6 12858.0 12857.8 10.9
vampiric_touch Mana 28.9 247361.5 8571.9 8571.8 30.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.20 3673.44 (0.17%) 18000.00 0.00 0.00%
shadowfiend Mana 35.43 267003.60 (12.29%) 7535.76 51880.08 16.27%
Shadow Orbs from Mind Blast Shadow Orb 36.87 36.87 (80.19%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 9.11 9.11 (19.81%) 1.00 0.00 0.00%
Devouring Plague Health Health 193.90 0.00 (-nan%) 0.00 3301245.88 100.00%
Vampiric Touch Mana Mana 270.87 1380465.84 (63.52%) 5096.39 55631.40 3.87%
mp5_regen Mana 1806.42 522179.94 (24.03%) 289.07 19746.53 3.64%
Resource RPS-Gain RPS-Loss
Mana 4811.11 5257.09
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 98630.74 0.00 270900.00
Shadow Orb 1.13 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.8%
shadowfiend-Mana Cap 3.8%
lightwell-Mana Cap 3.8%

Procs

Count Interval
Shadowy Recall Extra Tick 303.1 1.5sec
Shadowy Apparition Procced 99.2 4.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_MFI_PI_No_LMG Damage Per Second
Count 24992
Mean 148880.07
Minimum 127393.22
Maximum 176176.93
Spread ( max - min ) 48783.70
Range [ ( max - min ) / 2 * 100% ] 16.38%
Standard Deviation 5187.0686
5th Percentile 140658.21
95th Percentile 157600.45
( 95th Percentile - 5th Percentile ) 16942.24
Mean Distribution
Standard Deviation 32.8112
95.00% Confidence Intervall ( 148815.77 - 148944.38 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4663
0.1 Scale Factor Error with Delta=300 229682
0.05 Scale Factor Error with Delta=300 918729
0.01 Scale Factor Error with Delta=300 22968236
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 148880.07
Distribution Chart

Damage

Sample Data
Count 24992
Mean 64162254.96
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_MFI_PI_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_MFI_PI_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_MFI_PI_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 275.57
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.02 shadowfiend,if=!talent.mindbender.enabled
B 4.29 power_infusion,if=talent.power_infusion.enabled
C 5.26 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 45.06 mind_blast,if=active_enemies<=6&cooldown_react
E 9.11 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 4.12 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 16.93 mind_flay_insanity,interrupt=1,chain=1
H 4.07 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 8.39 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 14.62 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 10.61 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 14.63 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 10.68 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 10.74 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 10.93 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 7.02 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 47.79 mind_flay,chain=1,interrupt=1
X 0.71 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 46.56 shadow_word_pain,moving=1
a 0.03 dispersion

Sample Sequence

ABCIPDGJWDWLWMDOGZZZZZDWMWDPWDIJWZZZDOGFDJWLTDWPMWZZZZZDWMWDOGLWDWMWBIZZDJPWTDWMWDIOGZZZZZDJWDWPMWLDWAZZDJOGFDWMWLWDWPZZZZZDJOGFDWMWLWDWIBZZDJOGDPWMWDIWZZZZZDJWTDWMWLDOGPZZDJWDWMWLTDWZZZZZDJOGFDPWMWLTDWIABZDJOGDWMWDEHIPWZZZZECDGEHJWTDOGEGIDMECGXZZDWPW8EHJWDOGEGLDMECGXZZZZDWSEH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_MFI_PI_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002212
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Priest_Shadow_T15H_MFI_ToF_No_LMG : 142531 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
142531.4 142531.4 83.35 / 0.06% 11299 / 7.9% 25.6 5296.5 4732.0 Mana 2.64% 46.5 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
Glyphs
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
Professions
  • alchemy: 600
  • enchanting: 600

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_ToF_No_LMG Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:552065|228673|182317|164767|141109|138670|129880|75038&chds=0,1104130&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++552065++devouring_plague,9482C9,0,0,15|t++228673++vampiric_touch,9482C9,1,0,15|t++182317++halo,9482C9,2,0,15|t++164767++shadow_word_death,9482C9,3,0,15|t++141109++mind_flay_insanity,9482C9,4,0,15|t++138670++mind_blast,9482C9,5,0,15|t++129880++shadow_word_pain,9482C9,6,0,15|t++75038++mind_flay,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_ToF_No_LMG Damage Sources&chts=dddddd,18&chs=550x275&chd=t:15,14,11,10,8,8,5,5,5,4,4,4,3,3,2,2,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=mind_flay_insanity|mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|devouring_plague|shadowfiend: melee|shadowy_apparition|mind_flay_insanity_mastery|mind_flay_mastery|shadow_word_death|shadow_word_pain_mastery|halo_damage|vampiric_touch_mastery|devouring_plague_mastery|stormlash|shadowfiend: stormlash&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_ToF_No_LMG DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:6877532100yz1zzwvsnlihedaacbceehiiighighgghhhiiggebZWUTSUUUVWXXYXXXXXXYYZZabbaaZYWVUTSUTUUVVWWWVWWWWXXYYZZaZaaZXWUUTUTTTUUVVVUVVWVVWYYYZaaaaaZYXWVXVVVVWWWWWWWXWWXXXYZZaZaZYXWWWYZZbcefghgggggfgghhhhfeecaYWUUVUUVWXYZZZaaaaZaaaabcbbbZXVUSSTRRSTUVWWVWWWVVWXXYZaaaaZYXVUTVUUVWXYZZYYYXXWWWWXXYYYYXVUTSRTTUVWYZababbbaabbbbcdcccaZXWVUVVVWXYYZZZZZZZZZZaaabaaaYXVUUUWWXZacefgghhiiijklmmnmllkigecbcbbccddeedeeeeeeeeefhghhgeeddcdccccddeedeeeeefgffgihiijihggfgfeeeeeffefeeeedddeeffffecbbaZaZYYYXXXXWWWWWWXYYYYZZZZZZZYXXYXXXXWXXXWXXXWWWWWWXXWWWVUUTTTWWXYabdeffghhijkkjjllkkjjhgecc&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4531,0.4&chxt=x,y&chxl=0:|0|sec=566|1:|0|avg=142531|max=314538&chxp=1,1,45,100& http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_ToF_No_LMG DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,2,3,10,7,17,45,57,88,152,184,238,290,342,379,480,574,715,781,893,1091,1310,1580,1706,1807,1860,1733,1645,1529,1322,1111,880,608,526,339,242,171,123,58,39,26,11,5,2,3,2,1,0,0,1&chds=0,1860&chbh=5&chxt=x&chxl=0:|min=115002|avg=142531|max=171360&chxp=0,1,49,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Priest_Shadow_T15H_MFI_ToF_No_LMG Spent Time&chts=dddddd,18&chs=550x275&chd=t:32.3,18.5,14.8,9.7,6.4,3.9,3.0,2.3,0.8,0.7,2.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 145.7s|mind_flay_insanity 83.5s|shadow_word_pain 66.7s|mind_blast 43.7s|vampiric_touch 28.8s|devouring_plague 17.4s|shadow_word_death 13.6s|halo 10.5s|dispersion 3.7s|shadowfiend 3.2s|waiting 11.9s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_MFI_ToF_No_LMG 142531
devouring_plague 7225 (21295) 5.1% (15.0%) 16.6 28.20sec 576949 552065 153626 317550 195731 25.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.65 16.65 0.00 0.00 1.0451 0.0000 3258423.91 3258423.91 0.00 552065.09 552065.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.37 74.31% 153625.90 126181 248952 153653.49 131886 184192 1900611 1900611 0.00
crit 4.28 25.69% 317550.29 252361 597485 314815.60 0 503281 1357813 1357813 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 3380 2.4% 45.0 9.95sec 33880 0 26349 55165 33930 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.99 44.92 0.00 0.00 0.0000 0.0000 1524247.37 1524247.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.11 73.69% 26349.30 21031 41493 26365.86 22396 31227 872303 872303 0.00
crit 11.82 26.31% 55164.56 42061 99583 55178.29 42061 74987 651944 651944 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10689 7.5% 16.6 28.20sec 289661 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.1 25515 52921 32551 25.7% 0.0% 21.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.65 16.65 148.14 148.14 0.0000 0.6594 4822157.22 4822157.22 0.00 49361.33 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.1 74.33% 25514.50 21031 41493 25524.72 22329 29831 2809349 2809349 0.00
crit 38.0 25.67% 52921.41 42061 99583 52900.13 44610 64555 2012809 2012809 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=10018} Shadow damage and an additional {$s5=1670} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (4248) 0.0% (3.0%) 10.0 44.79sec 190604 182317 0 0 0 26.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.02 10.02 0.00 0.00 1.0455 0.0000 0.00 0.00 0.00 182317.06 182317.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.38 73.67% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.64 26.33% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.
halo_damage 4248 3.0% 10.0 44.79sec 190604 0 148880 306285 190600 26.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.02 10.02 0.00 0.00 0.0000 0.0000 1910135.89 1910135.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.37 73.49% 148879.66 124529 229089 148849.27 0 199208 1096498 1096498 0.00
crit 2.66 26.51% 306285.06 249057 549813 291724.09 0 549813 813637 813637 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.0 44.79sec 0 0 0 0 0 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.02 108.42 0.00 0.00 0.0000 0.0000 0.00 28943656.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.04 70.14% 0.00 0 0 0.00 0 0 0 15398472 100.00
crit 32.38 29.86% 0.00 0 0 0.00 0 0 0 13545185 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=35940 to 46048} Shadow damage to enemies, and up to {$120696s1=59899 to 76746} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13439 9.4% 39.1 11.35sec 154985 138670 121218 251237 154985 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.10 39.10 0.00 0.00 1.1177 0.0000 6059184.88 6059184.88 0.00 138669.98 138669.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.94 74.03% 121217.92 100626 199791 121239.44 107774 139848 3508232 3508232 0.00
crit 10.15 25.97% 251236.86 201251 479497 251443.71 201251 358999 2550953 2550953 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=23032 to 23185} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 18630 (24282) 13.1% (17.0%) 97.1 4.32sec 112584 75038 0 0 0 0.0% 0.0% 0.0% 0.0% 201.9 32319 67633 41562 26.2% 0.0% 29.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.14 97.14 201.88 201.88 1.5004 0.6508 8390789.46 8390789.46 0.00 75037.62 75037.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.0 73.82% 32318.76 26761 52794 32341.11 29206 36877 4816718 4816718 0.00
crit 52.8 26.18% 67633.12 53521 126706 67662.37 57271 79397 3574071 3574071 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity 20045 (26126) 14.1% (18.3%) 51.2 8.74sec 230040 141109 0 0 0 0.0% 0.0% 0.0% 0.0% 117.3 59776 125708 77041 26.2% 0.0% 16.9%

Stats details: mind_flay_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.21 51.21 117.31 117.31 1.6302 0.6492 9037920.68 9037920.68 0.00 141109.16 141109.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.6 73.81% 59776.11 26761 105589 59861.79 50744 70291 5176266 5176266 0.00
crit 30.7 26.19% 125707.93 53521 253413 125832.93 99056 166775 3861655 3861655 0.00
DPS Timeline Chart

Action details: mind_flay_insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.dot.devouring_plague_tick.ticks_remain=1
Spelldata
  • id:129197
  • name:Mind Flay (Insanity)
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_insanity_mastery 6081 4.3% 35.6 12.38sec 77097 0 59850 125895 77168 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_insanity_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.57 35.54 0.00 0.00 0.0000 0.0000 2742295.40 2742295.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.22 73.78% 59849.76 26761 105589 59925.11 44850 75987 1569122 1569122 0.00
crit 9.32 26.22% 125895.41 53521 253413 125948.12 0 208161 1173173 1173173 0.00
DPS Timeline Chart

Action details: mind_flay_insanity_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_flay_mastery 5652 4.0% 61.3 6.69sec 41533 0 32311 67549 41545 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.28 61.26 0.00 0.00 0.0000 0.0000 2545117.87 2545117.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.21 73.79% 32310.54 26761 52794 32331.70 28418 37283 1460677 1460677 0.00
crit 16.05 26.21% 67548.52 53521 126706 67581.98 54128 91424 1084441 1084441 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4985 3.5% 13.0 5.98sec 172325 164767 135011 277917 172325 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.05 13.05 0.00 0.00 1.0459 0.0000 2248413.89 2248413.89 0.00 164767.25 164767.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.64 73.89% 135010.61 98214 195564 135161.43 110492 178435 1301606 1301606 0.00
crit 3.41 26.11% 277917.39 196429 469355 271803.03 0 469355 946808 946808 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=22171} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 14709 (19217) 10.3% (13.5%) 63.8 6.86sec 135682 129880 0 0 0 0.0% 0.0% 0.0% 0.0% 276.9 18776 38754 23945 25.9% 0.0% 93.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.84 63.84 276.87 276.87 1.0447 1.5174 6629453.33 6629453.33 0.00 17793.05 129880.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 205.2 74.13% 18776.23 15692 30949 18782.09 16711 21357 3853571 3853571 0.00
crit 71.6 25.87% 38754.47 31384 74279 38748.91 33757 44778 2775882 2775882 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4509 3.2% 84.1 5.20sec 24152 0 18902 39175 24168 26.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.14 84.08 0.00 0.00 0.0000 0.0000 2032114.54 2032114.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.24 74.02% 18901.54 15692 30949 18907.64 16978 21957 1176441 1176441 0.00
crit 21.84 25.98% 39175.05 31384 74279 39180.90 33192 47921 855674 855674 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 1.0576 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6267 4.4% 93.5 4.68sec 30225 0 23882 49544 30600 26.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.46 92.31 0.00 0.00 0.0000 0.0000 2824780.38 2824780.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.15 73.82% 23882.11 19578 39030 23883.50 21416 27029 1627474 1627474 0.00
crit 24.17 26.18% 49544.12 39157 93671 49537.80 41293 59835 1197307 1197307 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1409 1.0% 24.8 12.91sec 25191 0 17923 42405 25191 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.84 24.84 0.00 0.00 0.0000 0.0000 625876.20 625876.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.47 70.31% 17923.21 12216 23865 17953.32 14204 22007 313101 313101 0.00
crit 7.38 29.69% 42404.84 24432 51377 42457.67 0 51377 312775 312775 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:15690.24
  • base_dd_max:15690.24
vampiric_touch 11239 (14633) 7.9% (10.3%) 27.3 15.87sec 241762 228673 0 0 0 0.0% 0.0% 0.0% 0.0% 183.8 21493 44720 27546 26.1% 0.0% 79.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.27 27.27 183.81 183.81 1.0572 1.9540 5063134.47 5063134.47 0.00 16991.26 228672.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.9 73.94% 21493.15 17688 35579 21500.36 19345 24574 2921145 2921145 0.00
crit 47.9 26.06% 44719.63 35377 85390 44722.07 37923 52884 2141989 2141989 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 3394 2.4% 55.8 7.53sec 27412 0 21456 44476 27428 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.79 55.76 0.00 0.00 0.0000 0.0000 1529271.44 1529271.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.29 74.06% 21456.06 17688 35579 21460.43 18905 24739 885992 885992 0.00
crit 14.46 25.94% 44475.81 35377 85390 44478.27 35377 58414 643279 643279 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 83442 / 6631
melee 83154 4.6% 35.5 11.16sec 83193 92614 62639 148851 83191 27.9% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.47 35.47 0.00 0.00 0.8983 0.0000 2950790.48 2950790.48 0.00 92614.50 92614.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.07 48.13% 62639.44 42818 84472 62745.12 47741 78612 1069421 1069421 0.00
crit 9.91 27.95% 148850.90 98481 202733 148860.75 98481 202733 1475434 1475434 0.00
glance 8.48 23.92% 47842.13 32114 63354 47879.50 0 63354 405935 405935 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.98 5.98 0.00 0.00 1.0501 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 289 0.0% 7.0 0.74sec 1450 0 987 2369 1450 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 10151.80 10151.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.65 66.49% 987.05 828 988 986.86 0 988 4594 4594 0.00
crit 2.35 33.51% 2369.14 1987 2371 2233.05 0 2371 5558 5558 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:988.00
  • base_dd_max:988.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 33.33%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.8 1.7 81.4sec 60.3sec 28.77% 28.77%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:28.77%

    Trigger Attempt Success

    • trigger_pct:99.79%
chayes_essence_of_brilliance 11.0 2.9 41.8sec 32.5sec 27.65% 27.65%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.65%

    Trigger Attempt Success

    • trigger_pct:99.82%
jade_serpent_potion 2.0 0.0 419.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.7 11.7 31.5sec 17.1sec 52.87% 52.87%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:52.87%

    Trigger Attempt Success

    • trigger_pct:99.34%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 9.0 0.0 9.0sec 9.0sec 11.40% 30.95%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:11.40%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 3.0 0.0 180.0sec 180.0sec 6.56% 8.54%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 2.0 0.0 300.0sec 300.0sec 4.50% 4.50%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:4.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
twist_of_fate 1.0 111.9 0.0sec 0.7sec 16.94% 16.94%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.21% 14.21%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.8sec 74.8sec 83.41% 80.64%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.0 0.0 180.0sec 180.0sec 62.08% 72.99%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:62.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.37% 16.37%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.68% 5.68%

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.68%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by {$s2=10}%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by {$s2=10}%. {$?s73413=true}[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T15H_MFI_ToF_No_LMG
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. All damage you take reduced by {$s3=15}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}%, reducing all damage done to you by {$15473s3=15}%, and increasing all party and raid members spell haste by {$49868s1=5}%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T15H_MFI_ToF_No_LMG
devouring_plague Shadow Orb 16.6 49.9 3.0 3.0 192315.7
halo Mana 10.0 405871.6 40500.0 40500.1 4.7
mind_blast Mana 39.1 351857.5 9000.0 9000.0 17.2
mind_flay Mana 97.1 291403.2 3000.0 3000.0 37.5
mind_flay_insanity Mana 51.2 153630.7 3000.0 3000.0 76.7
shadow_word_death Mana 13.0 101775.3 7800.0 7800.3 22.1
shadow_word_pain Mana 63.8 842643.6 13200.0 13199.9 10.3
vampiric_touch Mana 27.3 245412.0 9000.0 8999.9 26.9
Resource Gains Type Count Total Average Overflow
dispersion Mana 5.23 94188.24 (4.41%) 18000.00 0.00 0.00%
shadowfiend Mana 35.47 283510.18 (13.26%) 7993.06 35715.50 11.19%
Shadow Orbs from Mind Blast Shadow Orb 39.10 39.10 (81.37%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.95 8.95 (18.63%) 1.00 0.00 0.00%
Devouring Plague Health Health 193.07 0.00 (-nan%) 0.00 3287110.47 100.00%
Vampiric Touch Mana Mana 239.57 1231996.67 (57.64%) 5142.63 38125.81 3.00%
mp5_regen Mana 1806.42 527867.48 (24.69%) 292.22 14058.98 2.59%
Resource RPS-Gain RPS-Loss
Mana 4731.95 5296.52
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 567523.00 567523.00 567523.00
Mana 46008.99 0.00 249900.00
Shadow Orb 1.10 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 281.6 1.6sec
Shadowy Apparition Procced 93.5 4.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Priest_Shadow_T15H_MFI_ToF_No_LMG Damage Per Second
Count 24992
Mean 142531.42
Minimum 115001.62
Maximum 171359.51
Spread ( max - min ) 56357.90
Range [ ( max - min ) / 2 * 100% ] 19.77%
Standard Deviation 6722.8112
5th Percentile 130202.75
95th Percentile 152800.70
( 95th Percentile - 5th Percentile ) 22597.95
Mean Distribution
Standard Deviation 42.5256
95.00% Confidence Intervall ( 142448.07 - 142614.77 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 85
0.1% Error 8546
0.1 Scale Factor Error with Delta=300 385820
0.05 Scale Factor Error with Delta=300 1543282
0.01 Scale Factor Error with Delta=300 38582068
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 142531.42
Distribution Chart

Damage

Sample Data
Count 24992
Mean 61243316.94
Distribution Chart

DTPS

Sample Data Priest_Shadow_T15H_MFI_ToF_No_LMG Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart

HPS

Sample Data Priest_Shadow_T15H_MFI_ToF_No_LMG Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Priest_Shadow_T15H_MFI_ToF_No_LMG Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 349.77
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.02 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 5.07 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
D 43.83 mind_blast,if=active_enemies<=6&cooldown_react
E 8.95 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
F 7.02 mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
G 17.69 mind_flay_insanity,interrupt=1,chain=1
H 3.38 shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
I 7.26 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
J 15.23 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
K 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
L 11.20 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
M 13.31 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
N 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
O 11.58 devouring_plague,if=shadow_orb=3&ticks_remain<=1
P 10.02 halo,if=talent.halo.enabled
Q 0.00 cascade_damage,if=talent.cascade.enabled
R 0.00 divine_star,if=talent.divine_star.enabled
S 71.40 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
T 25.92 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
U 0.00 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
V 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
W 47.16 mind_flay,chain=1,interrupt=1
X 0.72 shadow_word_death,moving=1
Y 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Z 45.38 shadow_word_pain,moving=1
a 0.64 dispersion

Sample Sequence

ACIPDGJWDWLWDMWZZZZZDOGJDJPWLDWMZZZDJOGFDWMWLDWPWZZZZZDJOGFDWMWLWDWIZZDJOGFDPWMWLWDWZZZZDJOGWDWMWLWDWPWAZZDJOGFDWMWLWTDWZZZZZDJOGFDPWMWLWTDWIZZDJOGFDWMWLTDWPWZZZZDJOGWDWMWLTDWZZZDJPWDOGFDIJWZZZZTTTTTDWMWDOGFDIJWIAZDJWPWTDWMWDCEGFIEHZDJOGEFDSSSSSSSSSSSSSSSSECGDEHIJPZZDCG8GFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSECGSSSSSSSS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 30080 27345 27268
Intellect 23288 20478 19297
Spirit 3046 3046 2830
Health 567523 529233 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 40720 31123 10655
Spell Hit 15.11% 15.11% 2308
Spell Crit 26.31% 20.20% 6529
Spell Haste 48.63% 41.55% 17660
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.11% 15.11% 2308
Melee Crit 19.25% 14.24% 6529
Melee Haste 41.55% 41.55% 17660
Swing Speed 55.71% 41.55% 17660
Expertise 0.00% 0.00% 0
Armor 26140 16338 16338
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.37% 21.37% 2321

Gear

Source Slot Average Item Level: 541.00
Local Head hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
Blizzard Neck soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
Local Shoulders lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
Shirt empty
Local Chest robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
Local Legs legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
Local Wrists bracers_of_fragile_bone,id=96878,enchant=180int
Local Hands crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
Local Trinket1 breath_of_the_hydra,id=96827
Local Trinket2 chayes_essence_of_brilliance,id=96888,reforge=crit_haste
Local Back deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
Local Main Hand athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T15H_MFI_ToF_No_LMG"
level=90
race=night_elf
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!002202
glyphs=dark_binding/mind_spike/inner_sanctum
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=0&active_enemies<=5
actions+=/mind_flay_insanity,if=target.dot.devouring_plague_tick.ticks_remain=1,chain=1
actions+=/mind_flay_insanity,interrupt=1,chain=1
actions+=/shadow_word_death,if=buff.shadow_word_death_reset_cooldown.stack=1&(buff.shadow_word_death_reset_cooldown.remains>3.5|!talent.solace_and_insanity.enabled)&active_enemies<=5
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/halo,if=talent.halo.enabled
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
actions+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=hood_of_the_crimson_wake,id=96887,gems=160haste_160spi_180int
neck=soul_prism_of_lei_shen,id=96932,gems=160haste_160spi_160haste_160spi_120spi,reforge=spi_crit
shoulders=lost_shoulders_of_fluidity,id=96981,gems=160haste_160spi_60int,enchant=200int_100crit
back=deadly_glare_cape,id=96857,gems=80int_160haste_60int,enchant=180int
chest=robes_of_nova,id=95040,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=hit_crit
wrists=bracers_of_fragile_bone,id=96878,enchant=180int
hands=crystalclaw_gloves,id=96806,gems=320haste_60int,enchant=170haste
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_crit
legs=legguards_of_surreal_visions,id=95031,gems=80int_160haste_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160haste_60haste,enchant=175haste
finger1=radens_summoning_band,id=95019,gems=160haste_160spi_60int,enchant=160int
finger2=roshaks_remembrance,id=96901,gems=160haste_160spi_60haste,enchant=160int,reforge=crit_haste
trinket1=breath_of_the_hydra,id=96827
trinket2=chayes_essence_of_brilliance,id=96888,reforge=crit_haste
main_hand=athame_of_the_sanguine_ritual,id=96890,gems=80int_160haste_60int,enchant=jade_spirit
off_hand=leishens_orb_of_command,id=96934,gems=80int_160haste_60int,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27268
# gear_intellect=19297
# gear_spirit=2830
# gear_spell_power=10655
# gear_hit_rating=2308
# gear_crit_rating=6529
# gear_haste_rating=17660
# gear_mastery_rating=2321
# gear_armor=16338
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3175min_5897max,enchant=jade_spirit

Simulation & Raid Information

Iterations: 25000
Threads: 8
Confidence: 95.00%
Fight Length: 343 - 567 ( 451.7 )

Performance:
Total Events Processed: 618708178
Max Event Queue: 203
Sim Seconds: 11293243
CPU Seconds: 1091.4200
Physical Seconds: 147.3160
Speed Up: 10347

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Standard Deviation 57.9987
5th Percentile 366.41
95th Percentile 544.57
( 95th Percentile - 5th Percentile ) 178.17
Mean Distribution
Standard Deviation 0.3669
95.00% Confidence Intervall ( 451.01 - 452.45 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 633
0.1% Error 63324
0.1 Scale Factor Error with Delta=300 28
0.05 Scale Factor Error with Delta=300 114
0.01 Scale Factor Error with Delta=300 2871
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG devouring_plague 2944 3642912 8064 2.57 147758 304649 19.3 19.3 25.9% 0.0% 0.0% 0.0% 24.07sec 3642912 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG devouring_plague_mastery 124467 1680171 3719 6.88 25260 52599 51.9 51.8 26.3% 0.0% 0.0% 0.0% 8.65sec 1680171 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG devouring_plague_tick ticks -2944 5369353 11932 22.77 24665 50913 19.3 170.8 25.8% 0.0% 0.0% 0.0% 24.07sec 5369353 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG halo 120644 0 0 1.50 0 0 11.3 11.3 26.4% 0.0% 0.0% 0.0% 41.42sec 0 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG halo_damage 120696 2113098 4678 1.50 146312 302118 11.3 11.3 26.4% 0.0% 0.0% 0.0% 41.42sec 2113098 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG halo_heal 120696 0 0 16.20 0 0 11.3 121.9 29.7% 0.0% 0.0% 0.0% 41.42sec 31996646 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG mind_blast 8092 7363684 16301 6.41 119277 247184 48.3 48.3 26.0% 0.0% 0.0% 0.0% 9.30sec 7363684 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG mind_flay ticks -15407 10842769 24095 35.04 31993 67390 129.2 262.8 26.2% 0.0% 0.0% 0.0% 3.43sec 10842769 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG mind_flay_mastery 124468 3292018 7288 10.60 31994 67316 79.9 79.8 26.2% 0.0% 0.0% 0.0% 5.49sec 3292018 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG mind_spike 73510 4883169 10810 5.23 96996 201164 39.3 39.3 26.0% 0.0% 0.0% 0.0% 11.07sec 4883169 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG shadow_word_death 32379 2367552 5241 2.07 118401 244248 15.6 15.6 26.3% 0.0% 0.0% 0.0% 4.96sec 2367552 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG shadow_word_pain ticks -589 6493800 14431 36.74 18480 38136 55.3 275.5 25.9% 0.0% 0.0% 0.0% 8.10sec 6493800 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG shadow_word_pain_mastery 124464 1984111 4392 11.10 18558 38437 83.7 83.6 26.0% 0.0% 0.0% 0.0% 5.30sec 1984111 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG shadowy_apparition 87532 2753074 6095 12.16 23476 48703 93.1 91.5 26.2% 0.0% 0.0% 0.0% 4.78sec 2753074 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG stormlash 120687 595824 1319 3.17 17773 42132 23.8 23.8 29.6% 0.0% 0.0% 0.0% 13.49sec 595824 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG vampiric_touch ticks -34914 5602055 12449 27.31 21309 44413 30.1 204.8 26.2% 0.0% 0.0% 0.0% 15.02sec 5602055 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG vampiric_touch_mastery 124465 1685024 3730 8.26 21142 43966 62.2 62.2 26.1% 0.0% 0.0% 0.0% 7.07sec 1685024 451.73sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend melee 0 2942339 82879 59.91 62532 148549 35.4 35.4 27.9% 0.0% 24.0% 0.0% 11.16sec 2942339 35.50sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.80sec 0 35.50sec
Priest_Shadow_T15H_FDCL_DI_No_LMG Priest_Shadow_T15H_FDCL_DI_No_LMG_shadowfiend stormlash 120687 10154 286 11.83 987 2369 7.0 7.0 33.6% 0.0% 0.0% 0.0% 0.74sec 10154 35.50sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG devouring_plague 2944 2916291 6456 2.03 149447 308465 15.3 15.3 25.8% 0.0% 0.0% 0.0% 30.87sec 2916291 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG devouring_plague_mastery 124467 1438360 3184 5.70 25946 54553 43.0 42.9 26.4% 0.0% 0.0% 0.0% 10.49sec 1438360 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG devouring_plague_tick ticks -2944 4517227 10038 18.90 24953 51733 15.3 141.7 25.8% 0.0% 0.0% 0.0% 30.87sec 4517227 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG halo 120644 0 0 1.50 0 0 11.3 11.3 26.6% 0.0% 0.0% 0.0% 41.32sec 0 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG halo_damage 120696 2183036 4833 1.50 149956 311386 11.3 11.3 26.5% 0.0% 0.0% 0.0% 41.32sec 2183036 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG halo_heal 120696 0 0 16.37 0 0 11.3 123.2 30.0% 0.0% 0.0% 0.0% 41.32sec 32696503 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG mind_blast 8092 5546218 12278 4.78 120455 249224 36.0 36.0 26.1% 0.0% 0.0% 0.0% 12.56sec 5546218 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG mind_flay ticks -15407 12218132 27151 38.37 32791 69436 134.4 287.8 26.4% 0.0% 0.0% 0.0% 3.30sec 12218132 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG mind_flay_mastery 124468 3704103 8200 11.60 32757 69316 87.4 87.4 26.4% 0.0% 0.0% 0.0% 5.03sec 3704103 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG mind_spike 73510 5311124 11757 5.59 98464 204710 42.1 42.1 26.1% 0.0% 0.0% 0.0% 10.31sec 5311124 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.74sec 0 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG shadow_word_death 32379 2435153 5391 2.10 120036 248085 15.8 15.8 26.3% 0.0% 0.0% 0.0% 4.90sec 2435153 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG shadow_word_pain ticks -589 6986010 15524 38.66 18834 39032 60.3 289.9 26.0% 0.0% 0.0% 0.0% 7.42sec 6986010 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG shadow_word_pain_mastery 124464 2129331 4714 11.69 18872 39196 88.1 88.0 26.1% 0.0% 0.0% 0.0% 5.06sec 2129331 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.84sec 0 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG shadowy_apparition 87532 2975584 6587 12.87 23898 49797 98.5 96.9 26.3% 0.0% 0.0% 0.0% 4.52sec 2975584 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG stormlash 120687 719958 1594 3.62 18685 44671 27.2 27.2 29.8% 0.0% 0.0% 0.0% 11.74sec 719958 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG vampiric_touch ticks -34914 6139056 13642 29.10 21829 45775 30.0 218.2 26.3% 0.0% 0.0% 0.0% 15.07sec 6139056 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG vampiric_touch_mastery 124465 1830873 4053 8.79 21522 44956 66.2 66.2 26.2% 0.0% 0.0% 0.0% 6.65sec 1830873 451.73sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend melee 0 2964216 83514 59.91 62974 149563 35.4 35.4 28.0% 0.0% 24.0% 0.0% 11.16sec 2964216 35.49sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.81sec 0 35.49sec
Priest_Shadow_T15H_FDCL_PI_No_LMG Priest_Shadow_T15H_FDCL_PI_No_LMG_shadowfiend stormlash 120687 10122 285 11.83 987 2370 7.0 7.0 33.2% 0.0% 0.0% 0.0% 0.74sec 10122 35.49sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG devouring_plague 2944 3034561 6718 2.05 154212 318164 15.4 15.4 25.8% 0.0% 0.0% 0.0% 30.55sec 3034561 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG devouring_plague_mastery 124467 1413435 3129 5.51 26465 55293 41.6 41.5 26.3% 0.0% 0.0% 0.0% 10.82sec 1413435 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG devouring_plague_tick ticks -2944 4469379 9932 18.23 25628 53027 15.4 136.7 25.8% 0.0% 0.0% 0.0% 30.55sec 4469379 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG dispersion 47585 0 0 0.01 0 0 0.1 0.1 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG halo 120644 0 0 1.49 0 0 11.2 11.2 26.5% 0.0% 0.0% 0.0% 41.41sec 0 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG halo_damage 120696 2146921 4753 1.49 149637 309638 11.2 11.2 26.4% 0.0% 0.0% 0.0% 41.41sec 2146921 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG halo_heal 120696 0 0 16.18 0 0 11.2 121.8 29.8% 0.0% 0.0% 0.0% 41.41sec 32710139 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG mind_blast 8092 5660018 12530 4.83 121745 251882 36.4 36.4 26.0% 0.0% 0.0% 0.0% 12.37sec 5660018 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG mind_flay ticks -15407 11596930 25771 36.94 32457 68343 132.0 277.1 26.2% 0.0% 0.0% 0.0% 3.34sec 11596930 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG mind_flay_mastery 124468 3519299 7791 11.17 32460 68306 84.2 84.1 26.2% 0.0% 0.0% 0.0% 5.17sec 3519299 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG mind_spike 73510 4966044 10993 5.20 99190 205577 39.2 39.2 26.0% 0.0% 0.0% 0.0% 10.97sec 4966044 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG shadow_word_death 32379 2709495 5998 2.07 135592 279688 15.6 15.6 26.4% 0.0% 0.0% 0.0% 4.97sec 2709495 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG shadow_word_pain ticks -589 6739249 14976 37.33 18875 38945 60.0 280.0 25.9% 0.0% 0.0% 0.0% 7.44sec 6739249 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG shadow_word_pain_mastery 124464 2064854 4571 11.30 18999 39336 85.1 85.1 26.0% 0.0% 0.0% 0.0% 5.21sec 2064854 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.82sec 0 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG shadowy_apparition 87532 2860925 6333 12.36 23986 49771 94.6 93.1 26.2% 0.0% 0.0% 0.0% 4.70sec 2860925 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG stormlash 120687 610835 1352 3.23 17859 42258 24.3 24.3 29.7% 0.0% 0.0% 0.0% 13.18sec 610835 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG vampiric_touch ticks -34914 5664156 12587 27.07 21739 45304 29.8 203.0 26.2% 0.0% 0.0% 0.0% 15.06sec 5664156 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG vampiric_touch_mastery 124465 1706012 3777 8.18 21631 44992 61.6 61.6 26.0% 0.0% 0.0% 0.0% 7.10sec 1706012 451.73sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend melee 0 2941550 82851 59.91 62563 148631 35.5 35.5 27.8% 0.0% 24.0% 0.0% 11.17sec 2941550 35.50sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.82sec 0 35.50sec
Priest_Shadow_T15H_FDCL_ToF_No_LMG Priest_Shadow_T15H_FDCL_ToF_No_LMG_shadowfiend stormlash 120687 10115 285 11.83 987 2369 7.0 7.0 33.2% 0.0% 0.0% 0.0% 0.74sec 10115 35.50sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG devouring_plague 2944 3637877 8053 2.56 147769 304217 19.3 19.3 26.0% 0.0% 0.0% 0.0% 24.14sec 3637877 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG devouring_plague_mastery 124467 1677410 3713 6.87 25269 52624 51.8 51.7 26.2% 0.0% 0.0% 0.0% 8.68sec 1677410 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG devouring_plague_tick ticks -2944 5359745 11911 22.73 24657 50907 19.3 170.5 25.8% 0.0% 0.0% 0.0% 24.14sec 5359745 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG halo 120644 0 0 1.50 0 0 11.3 11.3 26.4% 0.0% 0.0% 0.0% 41.42sec 0 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG halo_damage 120696 2115120 4682 1.50 146297 302827 11.3 11.3 26.3% 0.0% 0.0% 0.0% 41.42sec 2115120 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG halo_heal 120696 0 0 16.22 0 0 11.3 122.1 29.8% 0.0% 0.0% 0.0% 41.42sec 32072529 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG mind_blast 8092 7360361 16294 6.41 119254 247082 48.3 48.3 26.0% 0.0% 0.0% 0.0% 9.31sec 7360361 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG mind_flay ticks -15407 12796617 28437 41.39 31998 67221 148.0 310.4 26.2% 0.0% 0.0% 0.0% 3.00sec 12796617 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG mind_flay_mastery 124468 3881073 8592 12.51 31991 67201 94.2 94.2 26.2% 0.0% 0.0% 0.0% 4.66sec 3881073 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.83sec 0 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG shadow_word_death 32379 2342028 5185 2.06 118349 244144 15.5 15.5 26.2% 0.0% 0.0% 0.0% 5.00sec 2342028 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG shadow_word_pain ticks -589 6583232 14629 37.21 18490 38161 58.9 279.1 25.9% 0.0% 0.0% 0.0% 7.62sec 6583232 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG shadow_word_pain_mastery 124464 2010739 4451 11.25 18559 38430 84.8 84.7 26.0% 0.0% 0.0% 0.0% 5.24sec 2010739 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG shadowy_apparition 87532 2792772 6182 12.33 23472 48730 94.4 92.8 26.2% 0.0% 0.0% 0.0% 4.72sec 2792772 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG stormlash 120687 601333 1331 3.15 17970 42717 23.7 23.7 29.8% 0.0% 0.0% 0.0% 13.50sec 601333 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG vampiric_touch ticks -34914 5602794 12451 27.30 21309 44408 30.1 204.8 26.2% 0.0% 0.0% 0.0% 15.03sec 5602794 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG vampiric_touch_mastery 124465 1683301 3726 8.25 21151 43938 62.2 62.1 26.1% 0.0% 0.0% 0.0% 7.07sec 1683301 451.73sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG_mindbender melee 0 7039586 60317 60.96 47193 103078 118.6 118.6 26.7% 0.0% 24.0% 0.0% 3.70sec 7039586 116.71sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.31sec 0 116.71sec
Priest_Shadow_T15H_MB_DI_No_LMG Priest_Shadow_T15H_MB_DI_No_LMG_mindbender stormlash 120687 23631 202 10.33 833 1983 20.1 20.1 29.9% 0.0% 0.0% 0.0% 12.38sec 23631 116.71sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG devouring_plague 2944 2983015 6604 2.08 149655 307157 15.7 15.7 25.8% 0.0% 0.0% 0.0% 30.09sec 2983015 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG devouring_plague_mastery 124467 1504079 3330 5.95 26020 54469 44.9 44.8 26.6% 0.0% 0.0% 0.0% 10.03sec 1504079 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG devouring_plague_tick ticks -2944 4705053 10456 19.71 24985 51531 15.7 147.8 25.8% 0.0% 0.0% 0.0% 30.09sec 4705053 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG halo 120644 0 0 1.50 0 0 11.3 11.3 26.5% 0.0% 0.0% 0.0% 41.35sec 0 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG halo_damage 120696 2184454 4836 1.50 150213 312234 11.3 11.3 26.5% 0.0% 0.0% 0.0% 41.35sec 2184454 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG halo_heal 120696 0 0 16.28 0 0 11.3 122.6 29.9% 0.0% 0.0% 0.0% 41.35sec 32584844 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG mind_blast 8092 5702669 12624 4.94 120263 248405 37.2 37.2 25.9% 0.0% 0.0% 0.0% 12.15sec 5702669 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG mind_flay ticks -15407 14441446 32092 45.38 32796 69336 153.7 340.3 26.4% 0.0% 0.0% 0.0% 2.89sec 14441446 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG mind_flay_mastery 124468 4374200 9683 13.72 32757 69173 103.3 103.3 26.3% 0.0% 0.0% 0.0% 4.24sec 4374200 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.90sec 0 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.85sec 0 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG shadow_word_death 32379 2416198 5349 2.09 120003 248117 15.7 15.7 26.4% 0.0% 0.0% 0.0% 4.93sec 2416198 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG shadow_word_pain ticks -589 7072676 15717 39.16 18830 39009 64.1 293.7 26.0% 0.0% 0.0% 0.0% 6.99sec 7072676 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG shadow_word_pain_mastery 124464 2152721 4766 11.84 18862 39168 89.2 89.1 26.1% 0.0% 0.0% 0.0% 4.99sec 2152721 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG shadowy_apparition 87532 3006653 6656 13.02 23890 49749 99.7 98.0 26.3% 0.0% 0.0% 0.0% 4.48sec 3006653 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG stormlash 120687 731853 1620 3.58 19042 45743 27.0 27.0 30.4% 0.0% 0.0% 0.0% 11.84sec 731853 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG vampiric_touch ticks -34914 6108313 13574 28.96 21824 45763 30.0 217.2 26.3% 0.0% 0.0% 0.0% 15.08sec 6108313 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG vampiric_touch_mastery 124465 1821923 4033 8.76 21514 44913 66.0 65.9 26.2% 0.0% 0.0% 0.0% 6.67sec 1821923 451.73sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG_mindbender melee 0 7108718 60983 60.96 47741 103836 118.4 118.4 26.8% 0.0% 24.0% 0.0% 3.70sec 7108718 116.57sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.32sec 0 116.57sec
Priest_Shadow_T15H_MB_PI_No_LMG Priest_Shadow_T15H_MB_PI_No_LMG_mindbender stormlash 120687 21611 185 9.07 859 2060 17.6 17.6 30.5% 0.0% 0.0% 0.0% 9.69sec 21611 116.57sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG devouring_plague 2944 3046272 6744 2.07 153985 315929 15.6 15.6 25.9% 0.0% 0.0% 0.0% 30.30sec 3046272 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG devouring_plague_mastery 124467 1428203 3162 5.59 26430 54941 42.1 42.1 26.4% 0.0% 0.0% 0.0% 10.62sec 1428203 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG devouring_plague_tick ticks -2944 4513840 10031 18.51 25556 52625 15.6 138.8 25.7% 0.0% 0.0% 0.0% 30.30sec 4513840 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG halo 120644 0 0 1.50 0 0 11.3 11.3 26.3% 0.0% 0.0% 0.0% 41.40sec 0 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG halo_damage 120696 2171627 4807 1.50 149860 310248 11.3 11.3 26.4% 0.0% 0.0% 0.0% 41.40sec 2171627 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG halo_heal 120696 0 0 16.18 0 0 11.3 121.8 29.8% 0.0% 0.0% 0.0% 41.40sec 32705827 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG mind_blast 8092 5725708 12675 4.89 121806 252058 36.8 36.8 25.8% 0.0% 0.0% 0.0% 12.24sec 5725708 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG mind_flay ticks -15407 13620334 30267 43.36 32505 68292 149.9 325.2 26.2% 0.0% 0.0% 0.0% 2.96sec 13620334 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG mind_flay_mastery 124468 4132939 9149 13.11 32513 68280 98.8 98.7 26.2% 0.0% 0.0% 0.0% 4.46sec 4132939 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG mindbender 123040 0 0 1.05 0 0 7.9 7.9 0.0% 0.0% 0.0% 0.0% 60.90sec 0 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG shadow_word_death 32379 2718311 6018 2.08 135543 279601 15.7 15.7 26.2% 0.0% 0.0% 0.0% 4.94sec 2718311 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG shadow_word_pain ticks -589 6856195 15236 37.89 18911 39037 63.6 284.2 25.9% 0.0% 0.0% 0.0% 7.05sec 6856195 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG shadow_word_pain_mastery 124464 2093523 4634 11.45 19006 39343 86.3 86.2 26.0% 0.0% 0.0% 0.0% 5.15sec 2093523 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG shadowy_apparition 87532 2901139 6422 12.54 24002 49773 96.0 94.4 26.1% 0.0% 0.0% 0.0% 4.63sec 2901139 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG stormlash 120687 603242 1335 3.13 18151 43133 23.6 23.6 29.9% 0.0% 0.0% 0.0% 13.62sec 603242 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG vampiric_touch ticks -34914 5688894 12642 27.16 21757 45321 30.1 203.7 26.2% 0.0% 0.0% 0.0% 15.04sec 5688894 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG vampiric_touch_mastery 124465 1714245 3795 8.21 21660 44997 61.8 61.8 26.1% 0.0% 0.0% 0.0% 7.11sec 1714245 451.73sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender melee 0 7018777 60216 60.96 47198 102726 118.4 118.4 26.6% 0.0% 24.0% 0.0% 3.70sec 7018777 116.56sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.32sec 0 116.56sec
Priest_Shadow_T15H_MB_ToF_No_LMG Priest_Shadow_T15H_MB_ToF_No_LMG_mindbender stormlash 120687 21359 183 8.94 862 2065 17.4 17.4 30.5% 0.0% 0.0% 0.0% 9.61sec 21359 116.56sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG devouring_plague 2944 3683172 8153 2.60 147811 304368 19.6 19.6 25.8% 0.0% 0.0% 0.0% 23.81sec 3683172 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG devouring_plague_mastery 124467 1694432 3751 6.94 25257 52595 52.3 52.2 26.3% 0.0% 0.0% 0.0% 8.59sec 1694432 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG devouring_plague_tick ticks -2944 5418418 12041 22.97 24665 50921 19.6 172.3 25.8% 0.0% 0.0% 0.0% 23.81sec 5418418 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG dispersion 47585 0 0 0.01 0 0 0.1 0.1 0.0% 0.0% 0.0% 0.0% 166.25sec 0 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG halo 120644 0 0 1.40 0 0 10.5 10.5 26.4% 0.0% 0.0% 0.0% 43.77sec 0 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG halo_damage 120696 1964507 4349 1.40 146202 301037 10.5 10.5 26.3% 0.0% 0.0% 0.0% 43.77sec 1964507 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG halo_heal 120696 0 0 15.04 0 0 10.5 113.2 29.8% 0.0% 0.0% 0.0% 43.77sec 29658316 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG mind_blast 8092 7279799 16115 6.35 119209 246971 47.8 47.8 25.9% 0.0% 0.0% 0.0% 9.38sec 7279799 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG mind_flay ticks -15407 8250492 18334 26.79 31923 66865 95.4 200.9 26.2% 0.0% 0.0% 0.0% 4.46sec 8250492 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG mind_flay_mastery 124468 2502192 5539 8.10 31896 66785 61.0 61.0 26.1% 0.0% 0.0% 0.0% 6.79sec 2502192 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG mind_flay_insanity ticks -129197 9008053 20018 16.15 57761 121012 54.7 121.1 26.2% 0.0% 0.0% 0.0% 8.18sec 9008053 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG mind_flay_insanity_mastery 124468 2736688 6058 4.89 57773 121101 36.8 36.8 26.3% 0.0% 0.0% 0.0% 12.02sec 2736688 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG shadow_word_death 32379 2041373 4519 1.80 118214 243623 13.5 13.5 26.2% 0.0% 0.0% 0.0% 5.79sec 2041373 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG shadow_word_pain ticks -589 6381797 14182 36.16 18450 38084 58.7 271.2 25.9% 0.0% 0.0% 0.0% 7.57sec 6381797 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG shadow_word_pain_mastery 124464 1952442 4322 10.93 18546 38411 82.4 82.3 26.0% 0.0% 0.0% 0.0% 5.38sec 1952442 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.78sec 0 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG shadowy_apparition 87532 2715435 6011 12.00 23460 48699 91.6 90.3 26.1% 0.0% 0.0% 0.0% 4.83sec 2715435 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG stormlash 120687 612434 1356 3.25 17773 42141 24.5 24.5 29.7% 0.0% 0.0% 0.0% 13.14sec 612434 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG vampiric_touch ticks -34914 5091223 11314 25.04 21161 44002 28.0 187.8 26.1% 0.0% 0.0% 0.0% 15.81sec 5091223 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG vampiric_touch_mastery 124465 1534194 3396 7.57 21062 43595 57.0 57.0 26.0% 0.0% 0.0% 0.0% 7.53sec 1534194 451.73sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend melee 0 2942951 82865 59.91 62551 148536 35.5 35.5 27.9% 0.0% 24.0% 0.0% 11.17sec 2942951 35.52sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.79sec 0 35.52sec
Priest_Shadow_T15H_MFI_DI_No_LMG Priest_Shadow_T15H_MFI_DI_No_LMG_shadowfiend stormlash 120687 10130 285 11.83 987 2369 7.0 7.0 33.3% 0.0% 0.0% 0.0% 0.74sec 10130 35.52sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG devouring_plague 2944 3049701 6751 2.12 149656 310543 15.9 15.9 25.9% 0.0% 0.0% 0.0% 29.57sec 3049701 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG devouring_plague_mastery 124467 1517238 3359 5.99 25980 54964 45.2 45.1 26.4% 0.0% 0.0% 0.0% 9.99sec 1517238 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG devouring_plague_tick ticks -2944 4761303 10581 19.84 24991 52147 15.9 148.8 25.8% 0.0% 0.0% 0.0% 29.57sec 4761303 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG halo 120644 0 0 1.43 0 0 10.7 10.7 26.5% 0.0% 0.0% 0.0% 43.25sec 0 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG halo_damage 120696 2045454 4528 1.43 149033 306225 10.7 10.7 26.4% 0.0% 0.0% 0.0% 43.25sec 2045454 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG halo_heal 120696 0 0 15.30 0 0 10.7 115.2 29.9% 0.0% 0.0% 0.0% 43.25sec 30284045 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG mind_blast 8092 5719556 12661 4.90 120964 252130 36.9 36.9 26.0% 0.0% 0.0% 0.0% 12.24sec 5719556 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG mind_flay ticks -15407 10244654 22766 32.32 32772 68764 108.8 242.4 26.4% 0.0% 0.0% 0.0% 3.97sec 10244654 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG mind_flay_mastery 124468 3096815 6855 9.78 32668 68437 73.6 73.6 26.3% 0.0% 0.0% 0.0% 5.74sec 3096815 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG mind_flay_insanity ticks -129197 8539618 18977 14.38 60943 130077 47.4 107.8 26.4% 0.0% 0.0% 0.0% 9.46sec 8539618 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG mind_flay_insanity_mastery 124468 2593232 5741 4.34 61015 130193 32.7 32.7 26.5% 0.0% 0.0% 0.0% 13.51sec 2593232 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.75sec 0 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG shadow_word_death 32379 2130136 4716 1.84 119919 247790 13.9 13.9 26.2% 0.0% 0.0% 0.0% 5.62sec 2130136 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG shadow_word_pain ticks -589 7031561 15626 38.99 18800 38952 65.6 292.4 26.0% 0.0% 0.0% 0.0% 6.80sec 7031561 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG shadow_word_pain_mastery 124464 2141796 4741 11.78 18852 39160 88.8 88.7 26.1% 0.0% 0.0% 0.0% 5.01sec 2141796 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.89sec 0 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG shadowy_apparition 87532 2997246 6635 12.98 23879 49729 99.2 97.7 26.3% 0.0% 0.0% 0.0% 4.48sec 2997246 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG stormlash 120687 768195 1701 3.85 18663 44710 29.0 29.0 30.0% 0.0% 0.0% 0.0% 11.02sec 768195 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG vampiric_touch ticks -34914 5793547 12875 27.71 21675 45330 28.9 207.8 26.2% 0.0% 0.0% 0.0% 15.42sec 5793547 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG vampiric_touch_mastery 124465 1732202 3835 8.37 21417 44577 63.1 63.0 26.2% 0.0% 0.0% 0.0% 6.87sec 1732202 451.73sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend melee 0 2964434 83531 59.90 63020 149784 35.4 35.4 27.9% 0.0% 24.1% 0.0% 11.16sec 2964434 35.49sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.84sec 0 35.49sec
Priest_Shadow_T15H_MFI_PI_No_LMG Priest_Shadow_T15H_MFI_PI_No_LMG_shadowfiend stormlash 120687 10138 286 11.83 987 2370 7.0 7.0 33.3% 0.0% 0.0% 0.0% 0.74sec 10138 35.49sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG devouring_plague 2944 3258424 7213 2.21 153626 317550 16.6 16.6 25.7% 0.0% 0.0% 0.0% 28.20sec 3258424 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG devouring_plague_mastery 124467 1524247 3374 5.97 26349 55165 45.0 44.9 26.3% 0.0% 0.0% 0.0% 9.95sec 1524247 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG devouring_plague_tick ticks -2944 4822157 10716 19.75 25515 52921 16.6 148.1 25.7% 0.0% 0.0% 0.0% 28.20sec 4822157 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG dispersion 47585 0 0 0.08 0 0 0.6 0.6 0.0% 0.0% 0.0% 0.0% 165.59sec 0 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG halo 120644 0 0 1.33 0 0 10.0 10.0 26.3% 0.0% 0.0% 0.0% 44.79sec 0 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG halo_damage 120696 1910136 4228 1.33 148880 306285 10.0 10.0 26.5% 0.0% 0.0% 0.0% 44.79sec 1910136 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG halo_heal 120696 0 0 14.40 0 0 10.0 108.4 29.9% 0.0% 0.0% 0.0% 44.79sec 28943657 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG mind_blast 8092 6059185 13413 5.19 121218 251237 39.1 39.1 26.0% 0.0% 0.0% 0.0% 11.35sec 6059185 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG mind_flay ticks -15407 8390789 18646 26.92 32319 67633 97.1 201.9 26.2% 0.0% 0.0% 0.0% 4.32sec 8390789 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG mind_flay_mastery 124468 2545118 5634 8.14 32311 67549 61.3 61.3 26.2% 0.0% 0.0% 0.0% 6.69sec 2545118 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG mind_flay_insanity ticks -129197 9037921 20084 15.64 59776 125708 51.2 117.3 26.2% 0.0% 0.0% 0.0% 8.74sec 9037921 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG mind_flay_insanity_mastery 124468 2742295 6071 4.72 59850 125895 35.6 35.5 26.2% 0.0% 0.0% 0.0% 12.38sec 2742295 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG shadow_word_death 32379 2248414 4977 1.73 135011 277917 13.0 13.0 26.1% 0.0% 0.0% 0.0% 5.98sec 2248414 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG shadow_word_pain ticks -589 6629453 14732 36.92 18776 38754 63.8 276.9 25.9% 0.0% 0.0% 0.0% 6.86sec 6629453 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG shadow_word_pain_mastery 124464 2032115 4499 11.17 18902 39175 84.1 84.1 26.0% 0.0% 0.0% 0.0% 5.20sec 2032115 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG shadowfiend 34433 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.79sec 0 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG shadowform 15473 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG shadowy_apparition 87532 2824780 6253 12.26 23882 49544 93.5 92.3 26.2% 0.0% 0.0% 0.0% 4.68sec 2824780 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG stormlash 120687 625876 1386 3.30 17923 42405 24.8 24.8 29.7% 0.0% 0.0% 0.0% 12.91sec 625876 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG vampiric_touch ticks -34914 5063134 11251 24.51 21493 44720 27.3 183.8 26.1% 0.0% 0.0% 0.0% 15.87sec 5063134 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG vampiric_touch_mastery 124465 1529271 3385 7.41 21456 44476 55.8 55.8 25.9% 0.0% 0.0% 0.0% 7.53sec 1529271 451.73sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend melee 0 2950790 83060 59.90 62639 148851 35.5 35.5 27.9% 0.0% 23.9% 0.0% 11.16sec 2950790 35.53sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.83sec 0 35.53sec
Priest_Shadow_T15H_MFI_ToF_No_LMG Priest_Shadow_T15H_MFI_ToF_No_LMG_shadowfiend stormlash 120687 10152 286 11.82 987 2369 7.0 7.0 33.5% 0.0% 0.0% 0.0% 0.74sec 10152 35.53sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=566|1:|0|&chxp=1,1,-nan,100&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.36% 8.36%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.70% 8.70%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.12% 11.12%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.99% 10.99%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.38% 11.38%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.80% 11.80%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.81% 9.81%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.29% 5.29%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:0.00%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:{$@spelldesc1490=Curses the target, increasing magic damage taken by $s1% for {$d=300 seconds}. $@spellname118773 {$@spelldesc118773=A Warlock can only have one Curse active per target.} {$?s103112=false}[ |cFFFFFFFFSoulburn:|r |cFF8282FFYour Curse of the Elements will affect all enemies in a $104225A yard radius around your target.|R][]}
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:0.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:0.00%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for {$81326d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:0.00%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. The target can always be seen and tracked by the Hunter. Arcane Shot, Chimera Shot, Kill Command, and Explosive Shot automatically apply Hunter's Mark. Lasts for {$d=300 seconds}.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:0.00%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals {$m2=150}% weapon damage, absorbs the next ${{$m1=100}/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:0.00%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:0.00%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for {$115798d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1290108.18
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 451.73
Minimum 343.40
Maximum 566.98
Spread ( max - min ) 223.58
Range [ ( max - min ) / 2 * 100% ] 24.75%
Distribution Chart

DPS

Sample Data Fluffy_Pillow Damage Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 24992
Mean 0.00
Distribution Chart

DTPS

Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24992
Mean 1292873.62
Distribution Chart

HPS

Sample Data Fluffy_Pillow Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 24992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 24992
Mean 0.00
Distribution Chart

HTPS

Sample Data Fluffy_Pillow Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 465282729 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.