
SimulationCraft 510-12

for World of Warcraft 5.2.0 PTR (build level 16650)

Table of Contents

Raid Summary


DPS Chart
Raid Event List
0 movement,players_only=1,first=10,cooldown=10,duration=4

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Shadow_T15H_FDCL_DI - - - 4.22 - 3.43 - - - 3.47 - 2.42 2.71 2.78 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_FDCL_PI - - - 4.16 - 3.13 - - - 2.96 - 2.30 2.58 2.49 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_FDCL_ToF - - - 4.11 - 3.15 - - - 3.11 - 2.47 2.50 2.62 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_MB_DI - - - 4.41 - 3.53 - - - 3.28 - 2.39 3.26 2.45 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_MB_PI - - - 4.43 - 3.38 - - - 2.71 - 2.40 3.38 2.35 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_MB_ToF - - - 4.27 - 3.28 - - - 2.90 - 2.47 3.10 2.29 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_MFI_DI - - - 4.09 - 3.21 - - - 3.42 - 2.46 2.92 2.96 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_MFI_PI - - - 4.00 - 2.88 - - - 2.58 - 2.41 2.85 2.37 - - - - - - wowhead wowhead (caps merged) lootrank
Priest_Shadow_T15H_MFI_ToF - - - 3.72 - 2.74 - - - 2.71 - 2.32 2.02 2.31 - - - - - - wowhead wowhead (caps merged) lootrank

Priest_Shadow_T15H_FDCL_DI : 135553 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
135552.7 135552.7 124.91 / 0.09% 16588 / 12.2% 22.9 5650.8 5075.7 Mana 6.77% 61.4 100.0% 100%
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
  • blacksmithing: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T15H_FDCL_DI Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.22 0.00 3.43 3.47 2.42 2.71 2.78
Normalized 1.00 0.00 0.81 0.82 0.57 0.64 0.66
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.18 0.00 0.18 0.18 0.18 0.18 0.18
Gear Ranking
  • Int > Hit ~= SP > Mastery ~= Haste > Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T15H_FDCL_DI": Intellect=4.22, SpellDamage=3.43, HitRating=3.47, CritRating=2.42, HasteRating=2.71, MasteryRating=2.78 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T15H_FDCL_DI": Intellect=4.22, SpellDamage=3.43, HitRating=0.00, CritRating=2.42, HasteRating=2.71, MasteryRating=2.78 )

Charts,s,333333&chd=t:557903|342672|168331|140103|137908|114491|94814|70972&chds=0,1115806&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++557903++devouring_plague,9482C9,0,0,15|t++342672++vampiric_touch,9482C9,1,0,15|t++168331++halo,9482C9,2,0,15|t++140103++shadow_word_death,9482C9,3,0,15|t++137908++mind_blast,9482C9,4,0,15|t++114491++mind_spike,4A79D3,5,0,15|t++94814++shadow_word_pain,9482C9,6,0,15|t++70972++mind_flay,9482C9,7,0,15&chtt=Priest_Shadow_T15H_FDCL_DI Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:13,13,11,10,9,9,6,5,5,4,4,4,4,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=shadow_word_pain|mind_blast|mind_flay|devouring_plague_tick|vampiric_touch|mind_spike|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague_mastery|vampiric_touch_mastery|halo_damage|stormlash|shadowfiend: stormlash&chtt=Priest_Shadow_T15H_FDCL_DI Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.22,3.47,3.43,2.78,2.71,2.42|4.04,3.29,3.25,2.61,2.54,2.24|4.39,3.65,3.61,2.96,2.89,2.59&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.22++Int,FFFFFF,0,0,15,0.1,e|t++++3.47++Hit,FFFFFF,0,1,15,0.1,e|t++++3.43++SP,FFFFFF,0,2,15,0.1,e|t++++2.78++Mastery,FFFFFF,0,3,15,0.1,e|t++++2.71++Haste,FFFFFF,0,4,15,0.1,e|t++++2.42++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.070&chtt=Scale Factors|Priest_Shadow_T15H_FDCL_DI%20Damage%20Per%20Second&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:43200111222343446554210000zzyyxwwvvwvuttsrrrqrrrrqppppoonmmlkkkkjkkkkkkkkkjllmmmlllllmmmmmllllkmllkkkkkkjlkkkkkkkkjlkllmlllllmmmmmlllllmllllkkkjjkkkkkjjjjjkkkkllllkklllllklmnnpqrstuuvvvwwwwxwxwvuutssrppnnmonnnnmmmmlmmmmmlkkkjlkkkkkkjjjkkkkkkkkkklkkkkkkkkjkkkkkjjjiijjjjjiiiiijiiiiiiiiijjjjjiiiiijjjkkkkjjjkkkllllllkmmlllkkkkklkkkkjjjjjjjjjjiiiiiiiiiihhjklnoprsuvxxyz001223321210zywvtsstssssrrrrqrrrrrqqqqqrqqqqqqqqpqqqqpppppopppppoooooooooooonnnonnnnnnmmmmmmmmllllklkkkkkjjjjjjjiiiiiihihhhhhhggggggggggfffffffffeeeeeeddddddccccccbbbcdeghjlnpsuwxz0123468777655421zywyxyyxxyyyyzzz00011&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6681,0.4&chxt=x,y&chxl=0:|0|sec=583|1:|0|avg=135553|max=202880&chxp=1,1,67,100&chtt=Priest_Shadow_T15H_FDCL_DI DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,0,4,9,15,22,26,34,41,62,76,129,180,230,254,326,396,469,532,641,700,727,938,1054,1074,1348,1512,1577,1722,1697,1694,1497,1409,1159,972,719,618,385,307,174,120,53,40,19,17,7,2,1,1&chds=0,1722&chbh=5&chxt=x&chxl=0:|min=91202|avg=135553|max=169458&chxp=0,1,57,100&chtt=Priest_Shadow_T15H_FDCL_DI DPS Distribution&chts=dddddd,18,s,333333&chd=t:28.0,24.6,11.9,9.7,4.8,4.6,3.8,2.2,0.7,0.7,6.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 126.8s|shadow_word_pain 111.4s|mind_blast 54.1s|mind_spike 44.1s|vampiric_touch 21.6s|devouring_plague 20.7s|shadow_word_death 17.2s|halo 10.2s|shadowfiend 3.4s|dispersion 3.3s|waiting 30.7s&chtt=Priest_Shadow_T15H_FDCL_DI Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_FDCL_DI 135553
devouring_plague 8043 (25442) 6.0% (18.8%) 19.2 23.30sec 600922 557903 148959 312150 189972 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.19 19.19 0.00 0.00 1.0771 0.0000 3645514.16 3645514.16 0.00 557902.86 557902.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.37 74.87% 148958.58 127714 218648 149023.14 129967 184825 2139984 2139984 0.00
crit 4.82 25.13% 312150.43 255428 524755 310769.69 0 524755 1505530 1505530 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|<20&cooldown.shadow_word_death.remains<1.5)
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 4734 3.5% 67.7 6.38sec 31711 0 24929 52089 31753 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.66 67.57 0.00 0.00 0.0000 0.0000 2145524.11 2145524.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.59 74.88% 24928.91 21286 36442 24943.34 22087 28718 1261224 1261224 0.00
crit 16.98 25.12% 52089.31 42573 87461 52089.28 43136 67383 884300 884300 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 12665 9.4% 19.2 23.30sec 299138 0 0 0 0 0.0% 0.0% 0.0% 0.0% 181.6 24838 51864 31611 25.1% 0.0% 26.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.19 19.19 181.59 181.59 0.0000 0.6498 5740255.98 5740255.98 0.00 48645.41 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.1 74.94% 24837.54 21286 46057 24852.20 22075 28804 3379818 3379818 0.00
crit 45.5 25.06% 51864.16 42573 95831 51860.84 44534 62894 2360438 2360438 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3798) 0.0% (2.8%) 9.4 47.77sec 181615 168331 0 0 0 24.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.42 9.42 0.00 0.00 1.0790 0.0000 0.00 0.00 0.00 168331.07 168331.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.07 75.06% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.35 24.94% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.
halo_damage 3798 2.8% 9.4 47.77sec 181615 0 143674 295699 181612 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.42 9.42 0.00 0.00 0.0000 0.0000 1710243.65 1710243.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.07 75.04% 143673.55 126806 202009 143675.54 126806 183445 1015309 1015309 0.00
crit 2.35 24.96% 295698.64 253612 484822 274855.50 0 484822 694934 694934 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 9.4 47.77sec 0 0 0 0 0 27.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.42 107.01 0.00 0.00 0.0000 0.0000 0.00 25300867.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.12 72.07% 0.00 0 0 0.00 0 0 0 14050453 100.00
crit 29.89 27.93% 0.00 0 0 0.00 0 0 0 11250415 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_FDCL_DI
  • harmful:true
  • if_expr:
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 16517 12.2% 49.4 9.04sec 151122 137908 118698 247938 151122 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.40 49.40 0.00 0.00 1.0958 0.0000 7465216.60 7465216.60 0.00 137907.64 137907.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.01 74.91% 118698.44 101791 175409 118735.29 105555 135117 4392491 4392491 0.00
crit 12.39 25.09% 247937.79 203582 420982 247937.66 205145 311428 3072725 3072725 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=21931 to 22083} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14512 (19919) 10.7% (14.7%) 90.7 4.79sec 99203 70972 0 0 0 0.0% 0.0% 0.0% 0.0% 162.9 31570 66205 40246 25.1% 0.0% 23.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.73 90.73 162.94 162.94 1.3978 0.6452 6557603.63 6557603.63 0.00 70971.97 70971.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.1 74.95% 31570.23 27086 46368 31582.19 28212 35801 3855384 3855384 0.00
crit 40.8 25.05% 66204.70 54172 111283 66189.64 56962 78952 2702219 2702219 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5408 4.0% 60.7 7.03sec 40253 0 31585 66279 40273 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.70 60.67 0.00 0.00 0.0000 0.0000 2443558.72 2443558.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.48 74.96% 31585.06 27086 46368 31597.52 27626 37060 1436478 1436478 0.00
crit 15.19 25.04% 66279.49 54172 111283 66263.48 54172 89912 1007081 1007081 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 11190 8.2% 41.1 10.21sec 123082 114491 96624 202298 123081 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.06 41.06 0.00 0.00 1.0750 0.0000 5053737.48 5053737.48 0.00 114490.78 114490.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.78 74.96% 96624.08 82570 142915 96660.39 85089 113458 2974078 2974078 0.00
crit 10.28 25.04% 202297.63 165140 342996 202257.71 0 289419 2079659 2079659 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=14446 to 14518} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 5308 3.9% 15.9 5.25sec 151444 140103 118498 247515 151441 25.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.95 15.95 0.00 0.00 1.0810 0.0000 2415233.18 2415233.18 0.00 140102.86 140102.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.88 74.47% 118498.40 99326 171672 118840.25 99326 158195 1407268 1407268 0.00
crit 4.07 25.53% 247515.09 198652 412013 245060.67 0 412013 1007965 1007965 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=21089} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17038 (23381) 12.6% (17.2%) 103.6 4.23sec 102000 94814 0 0 0 0.0% 0.0% 0.0% 0.0% 327.1 18479 38695 23537 25.0% 0.0% 95.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.59 103.59 327.12 327.12 1.0758 1.3280 7699276.46 7699276.46 0.00 19356.39 94813.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 245.3 74.98% 18479.10 15883 27183 18486.19 16593 21009 4532497 4532497 0.00
crit 81.8 25.02% 38695.31 31767 65238 38686.84 33691 44162 3166779 3166779 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6343 4.7% 121.8 3.62sec 23532 0 18486 38716 23547 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.81 121.73 0.00 0.00 0.0000 0.0000 2866506.01 2866506.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.28 74.98% 18486.44 15883 27183 18494.04 16548 21168 1687451 1687451 0.00
crit 30.45 25.02% 38716.38 31767 65238 38710.82 33301 47302 1179055 1179055 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.1 180.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.10 3.10 0.00 0.00 1.0843 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6689 4.9% 103.4 4.26sec 29241 0 23248 48682 29635 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.43 102.06 0.00 0.00 0.0000 0.0000 3024430.37 3024430.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.43 74.89% 23247.67 19798 34259 23251.67 20428 26406 1776819 1776819 0.00
crit 25.63 25.11% 48682.31 39596 82222 48662.69 40921 60820 1247612 1247612 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1238 0.9% 28.3 11.70sec 19459 0 14732 33446 19459 25.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.28 28.28 0.00 0.00 0.0000 0.0000 550316.00 550316.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.14 74.74% 14731.82 12341 21596 14746.95 12635 20264 311376 311376 0.00
crit 7.14 25.26% 33446.27 24681 51831 33354.71 0 51831 238940 238940 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:17281.80
  • base_dd_max:17281.80
vampiric_touch 11917 (16355) 8.8% (12.1%) 19.2 23.21sec 385585 342672 0 0 0 0.0% 0.0% 0.0% 0.0% 201.6 20947 43906 26686 25.0% 0.0% 86.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.15 19.15 201.65 201.65 1.1253 1.9527 5381101.25 5381101.25 0.00 17782.72 342672.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.2 75.00% 20946.69 17872 31215 20954.68 18696 24133 3168044 3168044 0.00
crit 50.4 25.00% 43905.92 35744 74917 43903.56 37823 51556 2213058 2213058 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4439 3.3% 75.0 5.71sec 26716 0 20973 43968 26733 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.02 74.97 0.00 0.00 0.0000 0.0000 2004171.06 2004171.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.19 74.95% 20972.58 17872 31215 20980.38 18364 24625 1178403 1178403 0.00
crit 18.78 25.05% 43967.54 35744 74917 43972.42 36704 56308 825768 825768 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 70510 / 5714
melee 70331 4.2% 36.3 11.25sec 70379 75320 56111 126323 70378 25.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.34 36.34 0.00 0.00 0.9344 0.0000 2557356.45 2557356.45 0.00 75320.49 75320.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.50 50.91% 56110.75 43339 85318 56154.84 48850 73640 1037961 1037961 0.00
crit 9.10 25.05% 126323.05 86678 204764 126032.67 0 198441 1149718 1149718 0.00
glance 8.74 24.04% 42310.73 32504 63989 42289.48 0 59196 369677 369677 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 6.13 0.00 0.00 1.0753 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 180 0.0% 7.0 0.77sec 921 0 679 1641 921 25.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 6447.87 6447.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.24 74.85% 679.29 647 996 680.04 0 996 3559 3559 0.00
crit 1.76 25.15% 1640.68 1552 2391 1421.65 0 2391 2889 2889 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:615.72
  • base_dd_max:615.72


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 10.67%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 4.6 1.4 83.6sec 61.5sec 22.86% 22.86%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:8279.00

    Stack Uptimes

    • breath_of_the_hydra_1:22.86%

    Trigger Attempt Success

    • trigger_pct:99.41%
chayes_essence_of_brilliance 5.3 1.9 74.5sec 52.4sec 27.18% 27.18%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:8279.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:27.18%

    Trigger Attempt Success

    • trigger_pct:99.77%
divine_insight_shadow 21.3 1.2 19.7sec 18.6sec 6.50% 41.42%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:6.50%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 1.0 0.0 418.5sec 0.0sec 10.02% 10.02%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.02%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 12.9 11.0 34.6sec 18.2sec 47.07% 47.07%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:47.07%

    Trigger Attempt Success

    • trigger_pct:99.25%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 9.3 0.0 9.3sec 9.3sec 11.74% 41.65%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:11.74%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 5.9 0.0 76.6sec 76.6sec 12.91% 14.63%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 8.99% 8.99%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 36.3 5.2 11.6sec 10.1sec 16.49% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:15.39%
  • surge_of_darkness_2:1.10%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 7.9 2.3 52.9sec 40.0sec 19.60% 21.37%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:19.60%

Trigger Attempt Success

  • trigger_pct:99.64%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-shadowcrawl 6.1 0.0 74.9sec 74.9sec 83.43% 77.65%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.1 0.0 180.0sec 180.0sec 52.09% 61.40%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:52.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.04% 16.04%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_DI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 19.2 57.6 3.0 3.0 200306.2
halo Mana 9.4 381385.3 40500.0 40500.3 4.5
mind_blast Mana 49.4 245485.4 4969.4 4969.5 30.4
mind_flay Mana 90.7 272209.6 3000.0 3000.1 33.1
shadow_word_death Mana 15.9 124399.1 7800.0 7800.3 19.4
shadow_word_pain Mana 103.6 1367331.5 13200.0 13199.9 7.7
vampiric_touch Mana 19.2 172383.8 9000.0 9000.2 42.8
Resource Gains Type Count Total Average Overflow
dispersion Mana 4.60 82722.96 (3.59%) 18000.00 0.00 0.00%
shadowfiend Mana 36.34 275707.78 (11.98%) 7587.58 51322.70 15.69%
Shadow Orbs from Mind Blast Shadow Orb 49.40 49.38 (84.09%) 1.00 0.02 0.04%
Shadow Orbs from Shadow Word: Death Shadow Orb 9.34 9.34 (15.91%) 1.00 0.00 0.00%
Devouring Plague Health Health 249.16 0.00 (-nan%) 0.00 4135156.88 100.00%
Vampiric Touch Mana Mana 276.62 1408890.78 (61.19%) 5093.23 25918.98 1.81%
mp5_regen Mana 1813.90 535006.92 (23.24%) 294.95 9161.75 1.68%
Resource RPS-Gain RPS-Loss
Mana 5075.72 5650.83
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 553215.00 553215.00 553215.00
Mana 39493.31 0.00 283200.00
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.8%
shadowfiend-Mana Cap 1.8%
lightwell-Mana Cap 1.8%


Count Interval
Shadowy Recall Extra Tick 324.9 1.4sec
Shadowy Apparition Procced 103.4 4.3sec
Divine Insight Mind Blast CD Reset 38.8 18.6sec
FDCL Mind Spike proc 41.5 10.1sec
Tier15 2pc caster 66.3 6.5sec
Tier15 4pc caster 27.7 15.0sec
Tier15 2pc caster Shadow Word: Pain Extra Tick 66.0 6.5sec
Tier15 2pc caster Vampiric Touch Extra Tick 61.0 6.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 453.60
Minimum 325.16
Maximum 583.39
Spread ( max - min ) 258.23
Range [ ( max - min ) / 2 * 100% ] 28.47%
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_DI Damage Per Second
Count 24992
Mean 135552.74
Minimum 91201.70
Maximum 169457.75
Spread ( max - min ) 78256.06
Range [ ( max - min ) / 2 * 100% ] 28.87%
Standard Deviation 10075.1581
5th Percentile 117133.38
95th Percentile 150309.18
( 95th Percentile - 5th Percentile ) 33175.81
Mean Distribution
Standard Deviation 63.7311
95.00% Confidence Intervall ( 135427.83 - 135677.65 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 212
0.1% Error 21221
0.1 Scale Factor Error with Delta=300 866537
0.05 Scale Factor Error with Delta=300 3466150
0.01 Scale Factor Error with Delta=300 86653759
Distribution Chart


Sample Data
Count 24992
Mean 135552.74
Distribution Chart


Sample Data
Count 24992
Mean 58702688.66
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_DI Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_DI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 24992
Mean 0.00
Distribution Chart


Sample Data
Count 24992
Mean 0.00
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_DI Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 464.02
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.10 shadowfiend,if=!talent.mindbender.enabled
B 0.00 power_infusion,if=talent.power_infusion.enabled
C 4.10 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|<20&cooldown.shadow_word_death.remains<1.5)
D 0.00 mind_flay_insanity,if=ptr&talent.solace_and_insanity.enabled,chain=1
E 15.95 shadow_word_death,if=active_enemies<=5
F 50.94 mind_blast,if=active_enemies<=6&cooldown_react
G 1.35 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
H 9.17 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=!ptr&talent.power_word_solace.enabled&active_enemies<=5
J 3.14 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.22 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
L 11.65 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 15.09 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 9.42 halo,if=talent.halo.enabled
P 0.00 cascade_damage,if=talent.cascade.enabled
Q 0.00 divine_star,if=talent.divine_star.enabled
R 91.56 wait,sec=cooldown.shadow_word_death.remains,<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
S 54.11 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
T 37.92 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
U 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
V 52.35 mind_flay,chain=1,interrupt=1
W 0.00 shadow_word_death,moving=1
X 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Y 102.01 shadow_word_pain,moving=1
Z 0.92 dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 29058 26416 26339
Intellect 22579 20139 18974
Spirit 2135 2135 1919
Health 553215 516227 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 39176 30207 10078
Spell Hit 15.05% 15.05% 3197
Spell Crit 25.74% 19.78% 6355
Spell Haste 42.13% 35.36% 15027
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.05% 15.05% 3197
Melee Crit 18.96% 13.95% 6355
Melee Haste 35.36% 35.36% 15027
Swing Speed 48.89% 35.36% 15027
Expertise 0.00% 0.00% 0
Armor 25889 16181 16181
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 37.26% 28.26% 4621


Source Slot Average Item Level: 536.88
Local Head hood_of_the_exorcist,id=96675,gems=sinister_primal_80int_160haste_180crit,reforge=spi_mastery
Local Neck necklace_of_the_terracotta_invoker,id=96708,gems=160int_60hit,reforge=haste_spi
Local Shoulders shoulderguards_of_the_exorcist,id=96678,gems=80int_160haste_320haste_120haste,enchant=200int_100crit,reforge=crit_hit
Shirt empty
Local Chest starburner_robes,id=95039,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=mastery_hit
Local Waist vitabinder_wrap,id=94996,gems=160spi_160haste_160spi_160haste_120int,reforge=hit_haste
Local Legs leggings_of_the_exorcist,id=96676,gems=320haste_160spi_160haste_120int,enchant=285int_165crit,reforge=crit_mastery
Local Feet starwalker_sandals,id=95004,gems=320haste_160spi_160haste_120int,enchant=140mastery,reforge=crit_haste
Local Wrists bracers_of_fragile_bone,id=96506,gems=320haste,enchant=180int,reforge=crit_mastery
Local Hands gloves_of_the_exorcist,id=96674,gems=80int_160haste_320haste_60int,enchant=170haste,reforge=crit_haste
Local Finger1 radens_summoning_band,id=95019,gems=160spi_160haste_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96529,gems=160spi_160haste_60haste,enchant=160int,reforge=mastery_hit
Local Trinket1 breath_of_the_hydra,id=96455
Local Trinket2 chayes_essence_of_brilliance,id=96516,reforge=crit_haste
Local Back red_sky_cloudcloak,id=95014,gems=320haste_60haste,enchant=180int,reforge=hit_mastery
Local Main Hand athame_of_the_sanguine_ritual,id=96518,gems=80int_160haste_160int_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96562,gems=80int_160haste_60int,enchant=165int,reforge=crit_hit
Unknown empty
Tabard empty


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo




# Executed before combat begins. Accepts non-harmful actions only.


# Executed every time the actor is available.



# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=26339
# gear_intellect=18974
# gear_spirit=1919
# gear_spell_power=10078
# gear_hit_rating=3197
# gear_crit_rating=6355
# gear_haste_rating=15027
# gear_mastery_rating=4621
# gear_armor=16181
# meta_gem=sinister_primal
# tier15_2pc_caster=1
# tier15_4pc_caster=1
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3002min_5576max,enchant=jade_spirit

Priest_Shadow_T15H_FDCL_PI : 128129 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
128128.8 128128.8 141.62 / 0.11% 18594 / 14.5% 22.2 5499.8 4917.8 Mana 12.58% 73.1 100.0% 100%
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
  • blacksmithing: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T15H_FDCL_PI Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.16 0.00 3.13 2.96 2.30 2.58 2.49
Normalized 1.00 0.00 0.75 0.71 0.55 0.62 0.60
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.20 0.00 0.20 0.20 0.20 0.20 0.20
Gear Ranking
  • Int > SP ~= Hit > Haste ~= Mastery ~= Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T15H_FDCL_PI": Intellect=4.16, SpellDamage=3.13, HitRating=2.96, CritRating=2.30, HasteRating=2.58, MasteryRating=2.49 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T15H_FDCL_PI": Intellect=4.16, SpellDamage=3.13, HitRating=0.00, CritRating=2.30, HasteRating=2.58, MasteryRating=2.49 )

Charts,s,333333&chd=t:562852|370049|175529|142379|142371|117153|96560|75466&chds=0,1125704&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++562852++devouring_plague,9482C9,0,0,15|t++370049++vampiric_touch,9482C9,1,0,15|t++175529++halo,9482C9,2,0,15|t++142379++mind_blast,9482C9,3,0,15|t++142371++shadow_word_death,9482C9,4,0,15|t++117153++mind_spike,4A79D3,5,0,15|t++96560++shadow_word_pain,9482C9,6,0,15|t++75466++mind_flay,9482C9,7,0,15&chtt=Priest_Shadow_T15H_FDCL_PI Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:14,12,11,9,9,9,6,5,5,5,4,4,3,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=shadow_word_pain|mind_flay|mind_blast|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|shadowfiend: melee|mind_flay_mastery|shadow_word_death|vampiric_touch_mastery|devouring_plague_mastery|halo_damage|stormlash|shadowfiend: stormlash&chtt=Priest_Shadow_T15H_FDCL_PI Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.16,3.13,2.96,2.58,2.49,2.30|3.96,2.93,2.75,2.38,2.29,2.10|4.36,3.34,3.16,2.78,2.69,2.51&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.16++Int,FFFFFF,0,0,15,0.1,e|t++++3.13++SP,FFFFFF,0,1,15,0.1,e|t++++2.96++Hit,FFFFFF,0,2,15,0.1,e|t++++2.58++Haste,FFFFFF,0,3,15,0.1,e|t++++2.49++Mastery,FFFFFF,0,4,15,0.1,e|t++++2.30++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.001&chtt=Scale Factors|Priest_Shadow_T15H_FDCL_PI%20Damage%20Per%20Second&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:87531334554544346433000zz0yywvuttssusqpolkjihlkkkllllllmkkkkjjjjikhhgfedccbefghiijkkjlkkkkkkkkjljhgfedccbeefgghiiiikjklllmmmmomlllkjiihkkkkkklllklkkkjjiiihigffedcbaacccdeefhijlmnoqrssssutsssrqpnmonnmmllkkjlkkkkjjjjikihgfedcbadddeeeffffhghhhhhiiikiiihhgfffhhhhiiiihhihhhggfffefedccaaZYYaaabbbbbcbdcddddddddeddddcbbaacccccccccccccccbbbbabbaaZZYYXXYYYYYYYabcfgilnprtuvyyz123454343210ywvututssrqqppopoooonnnnmonmmmmmmllmlllkkkjjjkjjiiihhhhihhhgggggfggfffffeeeeeedddddccdccccbbbbbbbbbbaaaaabbbbbbbcbbcccccccccbbbbbbbbbaaaaaaaaZZZZZZZZYYYZbbdegiknprttvxyz01343232110yxwutwuutttsrrrsrrrrrrs&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5986,0.4&chxt=x,y&chxl=0:|0|sec=583|1:|0|avg=128129|max=214058&chxp=1,1,60,100&chtt=Priest_Shadow_T15H_FDCL_PI DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,4,8,13,19,27,43,49,86,142,152,211,252,329,390,451,580,655,742,797,955,936,1013,1106,1109,1159,1261,1224,1287,1244,1321,1244,1108,1060,980,745,677,492,374,264,181,127,80,47,16,16,4,4,3,1&chds=0,1321&chbh=5&chxt=x&chxl=0:|min=86980|avg=128129|max=164590&chxp=0,1,53,100&chtt=Priest_Shadow_T15H_FDCL_PI DPS Distribution&chts=dddddd,18,s,333333&chd=t:26.3,24.5,9.8,9.1,4.2,3.9,3.6,1.9,1.1,0.7,12.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 119.2s|shadow_word_pain 111.3s|mind_blast 44.3s|mind_spike 41.2s|vampiric_touch 19.1s|devouring_plague 17.7s|shadow_word_death 16.5s|halo 8.7s|dispersion 4.9s|shadowfiend 3.4s|waiting 57.1s&chtt=Priest_Shadow_T15H_FDCL_PI Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_FDCL_PI 128129
devouring_plague 6942 (21963) 5.4% (17.2%) 16.4 27.09sec 604840 562852 149548 315467 191148 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.45 16.45 0.00 0.00 1.0746 0.0000 3144317.61 3144317.61 0.00 562852.11 562852.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.33 74.93% 149548.29 127714 229580 149616.55 128465 179693 1843288 1843288 0.00
crit 4.12 25.07% 315467.08 255428 550992 312378.27 0 550992 1301030 1301030 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|<20&cooldown.shadow_word_death.remains<1.5)
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 4098 3.2% 58.4 7.32sec 31812 0 25098 51953 31857 25.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.37 58.28 0.00 0.00 0.0000 0.0000 1856739.24 1856739.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.61 74.83% 25098.36 21286 38264 25113.47 21886 29376 1094635 1094635 0.00
crit 14.67 25.17% 51952.77 42573 91834 51957.33 42573 69778 762104 762104 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10923 8.6% 16.4 27.09sec 300822 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.4 24938 51620 31630 25.1% 0.0% 22.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.45 16.45 156.45 156.45 0.0000 0.6439 4948479.93 4948479.93 0.00 49123.74 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.2 74.92% 24938.18 21286 38264 24955.74 21966 29424 2922952 2922952 0.00
crit 39.2 25.08% 51619.77 42573 91834 51620.10 44533 62520 2025528 2025528 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.5 159.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 6.9 0 0 0 0.0% 0.0% 1.0%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.50 1.50 6.88 6.88 3.2321 0.6408 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.9 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3388) 0.0% (2.6%) 8.2 55.14sec 186249 175529 0 0 0 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 1.0611 0.0000 0.00 0.00 0.00 175529.45 175529.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.14 75.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.04 24.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.
halo_damage 3388 2.6% 8.2 55.14sec 186249 0 146659 304844 186250 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 1524122.22 1524122.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.14 74.97% 146659.28 126806 212110 146706.49 0 197887 899787 899787 0.00
crit 2.05 25.03% 304843.57 253612 509063 273837.00 0 509063 624335 624335 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 8.2 55.14sec 0 0 0 0 0 28.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.18 99.45 0.00 0.00 0.0000 0.0000 0.00 23696060.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.65 72.05% 0.00 0 0 0.00 0 0 0 13073210 100.00
crit 27.80 27.95% 0.00 0 0 0.00 0 0 0 10622851 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_FDCL_PI
  • harmful:true
  • if_expr:
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13948 10.9% 41.3 10.88sec 152801 142379 119912 251275 152801 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.27 41.27 0.00 0.00 1.0732 0.0000 6306127.53 6306127.53 0.00 142379.43 142379.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.94 74.96% 119912.08 101791 184180 119953.01 105973 139311 3709786 3709786 0.00
crit 10.33 25.04% 251274.60 203582 442032 251346.77 203582 374125 2596342 2596342 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=21931 to 22083} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 14510 (19929) 11.3% (15.5%) 88.5 4.87sec 101658 75466 0 0 0 0.0% 0.0% 0.0% 0.0% 159.8 32090 67578 40999 25.1% 0.0% 21.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.50 88.50 159.77 159.77 1.3471 0.6134 6550448.87 6550448.87 0.00 75466.48 75466.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.7 74.89% 32089.84 27086 48686 32104.57 28608 36972 3839828 3839828 0.00
crit 40.1 25.11% 67578.28 54172 116847 67568.96 58448 81677 2710621 2710621 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5419 4.2% 59.6 7.08sec 41052 0 32124 67698 41075 25.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.59 59.56 0.00 0.00 0.0000 0.0000 2446362.49 2446362.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.57 74.84% 32124.33 27086 48686 32138.11 28393 37519 1431844 1431844 0.00
crit 14.99 25.16% 67697.75 54172 116847 67686.86 54714 95655 1014519 1014519 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 10701 8.3% 38.6 10.75sec 125070 117153 97918 206075 125069 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.57 38.57 0.00 0.00 1.0676 0.0000 4824368.35 4824368.35 0.00 117153.19 117153.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.89 74.90% 97917.70 82570 150061 97969.18 84026 119735 2828853 2828853 0.00
crit 9.68 25.10% 206074.78 165140 360146 206036.13 0 316911 1995516 1995516 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=14446 to 14518} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 120.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.34 4.34 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 5158 4.1% 15.4 5.45sec 152735 142371 119669 250305 152731 25.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.36 15.36 0.00 0.00 1.0728 0.0000 2345555.55 2345555.55 0.00 142370.59 142370.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.47 74.69% 119669.27 99326 180255 120077.19 100035 164092 1372574 1372574 0.00
crit 3.89 25.31% 250305.18 198652 432613 246840.08 0 432613 972982 972982 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=21089} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17341 (23797) 13.5% (18.6%) 104.2 4.18sec 103088 96560 0 0 0 0.0% 0.0% 0.0% 0.0% 327.8 18719 39331 23883 25.0% 0.0% 92.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.21 104.21 327.78 327.78 1.0676 1.2726 7828239.86 7828239.86 0.00 20330.51 96559.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 245.7 74.95% 18719.28 15883 28542 18727.39 16720 21515 4598845 4598845 0.00
crit 82.1 25.05% 39331.43 31767 68500 39330.70 34336 45625 3229395 3229395 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6456 5.0% 122.1 3.59sec 23872 0 18726 39338 23886 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.08 122.01 0.00 0.00 0.0000 0.0000 2914321.22 2914321.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.46 74.96% 18725.57 15883 28542 18734.30 16658 21520 1712692 1712692 0.00
crit 30.55 25.04% 39337.63 31767 68500 39338.62 33667 48320 1201629 1201629 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.1 180.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.10 3.10 0.00 0.00 1.0843 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6589 5.1% 100.5 4.36sec 29629 0 23528 49372 30024 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.47 99.15 0.00 0.00 0.0000 0.0000 2976805.66 2976805.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.23 74.86% 23528.42 19798 35972 23534.39 20761 27245 1746409 1746409 0.00
crit 24.92 25.14% 49371.51 39596 86333 49358.31 40505 61448 1230396 1230396 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1284 1.0% 28.1 11.75sec 20289 0 15249 35125 20289 25.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.14 28.14 0.00 0.00 0.0000 0.0000 570863.19 570863.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.00 74.64% 15248.80 12341 22676 15267.71 13064 21140 320246 320246 0.00
crit 7.14 25.36% 35125.02 24681 54423 35056.24 0 54423 250617 250617 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:13340.52
  • base_dd_max:13340.52
vampiric_touch 11388 (15636) 8.9% (12.2%) 17.1 25.95sec 412599 370049 0 0 0 0.0% 0.0% 0.0% 0.0% 189.3 21241 44711 27129 25.1% 0.0% 78.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.09 17.09 189.27 189.27 1.1150 1.8742 5134753.81 5134753.81 0.00 18859.87 370049.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.8 74.91% 21241.26 17872 32776 21252.45 18639 25242 3011736 3011736 0.00
crit 47.5 25.09% 44711.29 35744 78662 44726.61 38132 56282 2123018 2123018 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<cast_time&miss_react
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4247 3.3% 70.6 6.03sec 27135 0 21254 44768 27154 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.56 70.51 0.00 0.00 0.0000 0.0000 1914687.26 1914687.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.82 74.91% 21253.73 17872 32776 21266.44 18660 25444 1122588 1122588 0.00
crit 17.69 25.09% 44768.18 35744 78662 44797.80 36141 58402 792099 792099 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 70750 / 5737
melee 70569 4.4% 36.4 11.25sec 70611 75566 56254 126645 70610 25.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.36 36.36 0.00 0.00 0.9344 0.0000 2567422.18 2567422.18 0.00 75565.76 75565.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.52 50.93% 56254.07 43339 85318 56296.67 49133 74898 1041690 1041690 0.00
crit 9.13 25.11% 126644.74 86678 204764 126339.28 0 186096 1156257 1156257 0.00
glance 8.71 23.96% 42406.41 32504 63989 42397.23 34224 61509 369475 369475 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.1 74.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.14 6.14 0.00 0.00 1.0685 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 180 0.0% 7.0 0.77sec 926 0 682 1649 926 25.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 6479.71 6479.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.23 74.79% 681.66 647 996 682.65 0 996 3568 3568 0.00
crit 1.77 25.21% 1649.49 1552 2391 1429.32 0 2391 2911 2911 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:645.96
  • base_dd_max:645.96


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 10.94%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 4.7 1.4 82.7sec 60.8sec 23.28% 23.28%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:8279.00

    Stack Uptimes

    • breath_of_the_hydra_1:23.28%

    Trigger Attempt Success

    • trigger_pct:99.57%
chayes_essence_of_brilliance 5.3 1.9 74.8sec 52.8sec 26.97% 26.97%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_chayes_essence_of_brilliance
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:8279.00

    Stack Uptimes

    • chayes_essence_of_brilliance_1:26.97%

    Trigger Attempt Success

    • trigger_pct:99.77%
jade_serpent_potion 1.0 0.0 418.4sec 0.0sec 10.03% 10.03%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.03%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 13.1 11.5 34.3sec 17.8sec 48.10% 48.10%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:48.10%

    Trigger Attempt Success

    • trigger_pct:99.26%
power_infusion 4.3 0.0 120.5sec 120.5sec 18.67% 19.83%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}%, all damage increased by {$s3=5}%, and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}%, all damage by {$s3=5}%, and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 44.8 0.0 10.0sec 10.0sec 39.36% 39.36%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:39.36%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 9.2 0.0 9.4sec 9.4sec 11.68% 39.72%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:11.68%

Trigger Attempt Success

  • trigger_pct:100.00%
skull_banner 5.9 0.0 76.6sec 76.6sec 12.91% 15.38%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 8.99% 8.99%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 34.2 4.8 12.2sec 10.7sec 14.59% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:13.65%
  • surge_of_darkness_2:0.94%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
tempus_repit 8.0 2.4 52.3sec 39.2sec 20.01% 21.46%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:20.01%

Trigger Attempt Success

  • trigger_pct:99.64%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
shadowfiend-shadowcrawl 6.1 0.0 74.8sec 74.8sec 83.43% 77.66%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-skull_banner 3.1 0.0 180.0sec 180.0sec 51.60% 60.95%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_shadowfiend
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:51.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
shadowfiend-stormlash 1.0 0.0 0.0sec 0.0sec 16.03% 16.03%

Buff details

  • buff initial source:Priest_Shadow_T15H_FDCL_PI_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:16.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 16.5 49.4 3.0 3.0 201611.7
halo Mana 8.2 305497.7 37332.1 37332.0 5.0
mind_blast Mana 41.3 356908.4 8648.0 8648.1 17.7
mind_flay Mana 88.5 252822.1 2856.7 2856.7 35.6
shadow_word_death Mana 15.4 115347.3 7510.7 7511.0 20.3
shadow_word_pain Mana 104.2 1317902.2 12647.3 12646.9 8.2
vampiric_touch Mana 17.1 146221.6 8558.3 8558.2 48.2
Resource Gains Type Count Total Average Overflow
dispersion Mana 6.88 123901.20 (5.55%) 18000.00 0.00 0.00%
shadowfiend Mana 36.36 256116.16 (11.48%) 7043.90 71123.84 21.73%
Shadow Orbs from Mind Blast Shadow Orb 41.27 41.27 (81.75%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 9.21 9.21 (18.25%) 1.00 0.00 0.00%
Devouring Plague Health Health 214.73 0.00 (-nan%) 0.00 3563788.24 100.00%
Vampiric Touch Mana Mana 259.78 1316658.05 (59.02%) 5068.41 30477.19 2.26%
mp5_regen Mana 1813.90 534023.52 (23.94%) 294.41 10145.15 1.86%
Resource RPS-Gain RPS-Loss
Mana 4917.81 5499.82
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 553215.00 553215.00 553215.00
Mana 35855.84 0.00 255000.00
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.0%
shadowfiend-Mana Cap 2.0%
lightwell-Mana Cap 2.0%


Count Interval
Shadowy Recall Extra Tick 310.4 1.4sec
Shadowy Apparition Procced 100.5 4.4sec
FDCL Mind Spike proc 39.0 10.7sec
Tier15 2pc caster 64.4 6.6sec
Tier15 4pc caster 25.9 15.9sec
Tier15 2pc caster Shadow Word: Pain Extra Tick 63.6 6.6sec
Tier15 2pc caster Vampiric Touch Extra Tick 56.0 7.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24992
Mean 453.60
Minimum 325.16
Maximum 583.39
Spread ( max - min ) 258.23
Range [ ( max - min ) / 2 * 100% ] 28.47%
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_PI Damage Per Second
Count 24992
Mean 128128.80
Minimum 86980.45
Maximum 164590.11
Spread ( max - min ) 77609.66
Range [ ( max - min ) / 2 * 100% ] 30.29%
Standard Deviation 11422.7749
5th Percentile 108319.34
95th Percentile 145508.00
( 95th Percentile - 5th Percentile ) 37188.67
Mean Distribution
Standard Deviation 72.2555
95.00% Confidence Intervall ( 127987.18 - 128270.42 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 305
0.1% Error 30531
0.1 Scale Factor Error with Delta=300 1113850
0.05 Scale Factor Error with Delta=300 4455402
0.01 Scale Factor Error with Delta=300 111385050
Distribution Chart


Sample Data
Count 24992
Mean 128128.80
Distribution Chart


Sample Data
Count 24992
Mean 55286192.78
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_PI Damage Taken Per Second
Count 24992
Mean 0.00
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_PI Healing Per Second
Count 24992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 24992
Mean 0.00
Distribution Chart


Sample Data
Count 24992
Mean 0.00
Distribution Chart


Sample Data Priest_Shadow_T15H_FDCL_PI Healing taken Per Second
Count 24992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 24992
Mean 552.42
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 mindbender,if=talent.mindbender.enabled
A 3.10 shadowfiend,if=!talent.mindbender.enabled
B 4.34 power_infusion,if=talent.power_infusion.enabled
C 3.41 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|<20&cooldown.shadow_word_death.remains<1.5)
D 0.00 mind_flay_insanity,if=ptr&talent.solace_and_insanity.enabled,chain=1
E 15.36 shadow_word_death,if=active_enemies<=5
F 41.68 mind_blast,if=active_enemies<=6&cooldown_react
G 1.77 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&!ticking
H 9.41 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=!ptr&talent.power_word_solace.enabled&active_enemies<=5
J 2.75 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.18 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&ticks_remain<=1
L 9.16 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=remains<cast_time+tick_time&miss_react
M 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
N 13.04 devouring_plague,if=shadow_orb=3&ticks_remain<=1
O 8.18 halo,if=talent.halo.enabled
P 0.00 cascade_damage,if=talent.cascade.enabled
Q 0.00 divine_star,if=talent.divine_star.enabled
R 120.02 wait,sec=cooldown.shadow_word_death.remains,<20&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
S 131.75 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&active_enemies<=1
T 35.82 mind_spike,if=buff.surge_of_darkness.react&active_enemies<=6
U 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
V 47.68 mind_flay,chain=1,interrupt=1
W 0.00 shadow_word_death,moving=1
X 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
Y 102.25 shadow_word_pain,moving=1
Z 1.50 dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 130 124 80
Agility 149 142 80
Stamina 29058 26416 26339
Intellect 22579 20139 18974
Spirit 2135 2135 1919
Health 553215 516227 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 39176 30207 10078
Spell Hit 15.05% 15.05% 3197
Spell Crit 25.74% 19.78% 6355
Spell Haste 42.13% 35.36% 15027
ManaReg per Second 1200 1200 0
Attack Power 132 114 0
Melee Hit 15.05% 15.05% 3197
Melee Crit 18.96% 13.95% 6355
Melee Haste 35.36% 35.36% 15027
Swing Speed 48.89% 35.36% 15027
Expertise 0.00% 0.00% 0
Armor 25889 16181 16181
Tank-Miss 2.00% 2.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 37.26% 28.26% 4621


Source Slot Average Item Level: 536.88
Local Head hood_of_the_exorcist,id=96675,gems=sinister_primal_80int_160haste_180crit,reforge=spi_mastery
Local Neck necklace_of_the_terracotta_invoker,id=96708,gems=160int_60hit,reforge=haste_spi
Local Shoulders shoulderguards_of_the_exorcist,id=96678,gems=80int_160haste_320haste_120haste,enchant=200int_100crit,reforge=crit_hit
Shirt empty
Local Chest starburner_robes,id=95039,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all,reforge=mastery_hit
Local Waist vitabinder_wrap,id=94996,gems=160spi_160haste_160spi_160haste_120int,reforge=hit_haste
Local Legs leggings_of_the_exorcist,id=96676,gems=320haste_160spi_160haste_120int,enchant=285int_165crit,reforge=crit_mastery
Local Feet starwalker_sandals,id=95004,gems=320haste_160spi_160haste_120int,enchant=140mastery,reforge=crit_haste
Local Wrists bracers_of_fragile_bone,id=96506,gems=320haste,enchant=180int,reforge=crit_mastery
Local Hands gloves_of_the_exorcist,id=96674,gems=80int_160haste_320haste_60int,enchant=170haste,reforge=crit_haste
Local Finger1 radens_summoning_band,id=95019,gems=160spi_160haste_60int,enchant=160int
Local Finger2 roshaks_remembrance,id=96529,gems=160spi_160haste_60haste,enchant=160int,reforge=mastery_hit
Local Trinket1 breath_of_the_hydra,id=96455
Local Trinket2 chayes_essence_of_brilliance,id=96516,reforge=crit_haste
Local Back red_sky_cloudcloak,id=95014,gems=320haste_60haste,enchant=180int,reforge=hit_mastery
Local Main Hand athame_of_the_sanguine_ritual,id=96518,gems=80int_160haste_160int_60int,enchant=jade_spirit
Local Off Hand leishens_orb_of_command,id=96562,gems=80int_160haste_60int,enchant=165int,reforge=crit_hit
Unknown empty
Tabard empty


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Solace and Insanity
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo




# Executed before combat begins. Accepts non-harmful actions only.


# Executed every time the actor is available.



# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=26339
# gear_intellect=18974
# gear_spirit=1919
# gear_spell_power=10078
# gear_hit_rating=3197
# gear_crit_rating=6355
# gear_haste_rating=15027
# gear_mastery_rating=4621
# gear_armor=16181
# meta_gem=sinister_primal
# tier15_2pc_caster=1
# tier15_4pc_caster=1
# main_hand=athame_of_the_sanguine_ritual,heroic=1,weapon=dagger_1.80speed_3002min_5576max,enchant=jade_spirit

Priest_Shadow_T15H_FDCL_ToF : 121786 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
121785.5 121785.5 157.73 / 0.13% 20660 / 17.0% 21.6 5354.4 4740.8 Mana 16.76% 80.8 100.0% 100%
  • Glyph of Dark Binding
  • Glyph of Mind Spike
  • Glyph of Inner Sanctum
  • blacksmithing: 600
  • enchanting: 600
Scale Factors for Priest_Shadow_T15H_FDCL_ToF Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.11 0.00 3.15 3.11 2.47 2.50 2.62
Normalized 1.00 0.00 0.77 0.76 0.60 0.61 0.64
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.23 0.00 0.23 0.23 0.22 0.22 0.22
Gear Ranking
  • Int > SP ~= Hit > Mastery ~= Haste ~= Crit
Pawn string
  • ( Pawn: v1: "Priest_Shadow_T15H_FDCL_ToF": Intellect=4.11, SpellDamage=3.15, HitRating=3.11, CritRating=2.47, HasteRating=2.50, MasteryRating=2.62 )
Zero hit/exp
  • ( Pawn: v1: "Priest_Shadow_T15H_FDCL_ToF": Intellect=4.11, SpellDamage=3.15, HitRating=0.00, CritRating=2.47, HasteRating=2.50, MasteryRating=2.62 )

Charts,s,333333&chd=t:577154|349843|172010|159743|141831|116673|96936|71263&chds=0,1154309&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9&chm=t++577154++devouring_plague,9482C9,0,0,15|t++349843++vampiric_touch,9482C9,1,0,15|t++172010++halo,9482C9,2,0,15|t++159743++shadow_word_death,9482C9,3,0,15|t++141831++mind_blast,9482C9,4,0,15|t++116673++mind_spike,4A79D3,5,0,15|t++96936++shadow_word_pain,9482C9,6,0,15|t++71263++mind_flay,9482C9,7,0,15&chtt=Priest_Shadow_T15H_FDCL_ToF Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:14,12,11,10,9,8,6,5,5,5,5,4,4,3,3,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,336600&chl=shadow_word_pain|mind_blast|mind_flay|devouring_plague_tick|vampiric_touch|mind_spike|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery|vampiric_touch_mastery|halo_damage|stormlash|shadowfiend: stormlash&chtt=Priest_Shadow_T15H_FDCL_ToF Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.11,3.15,3.11,2.62,2.50,2.47|3.89,2.93,2.89,2.39,2.28,2.24|4.34,3.38,3.34,2.84,2.73,2.69&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.11++Int,FFFFFF,0,0,15,0.1,e|t++++3.15++SP,FFFFFF,0,1,15,0.1,e|t++++3.11++Hit,FFFFFF,0,2,15,0.1,e|t++++2.62++Mastery,FFFFFF,0,3,15,0.1,e|t++++2.50++Haste,FFFFFF,0,4,15,0.1,e|t++++2.47++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.946&chtt=Scale Factors|Priest_Shadow_T15H_FDCL_ToF%20Damage%20Per%20Second&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:yxwutuuuuuuuvttuxwxwuutttutsssrrrrqsqonljihggjijjjjkkkjliiiihhhhhjgffedcbbaddfghhiiiikijjjiiiiikhgfedcbbadddeffghhgihhiiihhhhigffedcbaacccdddeeeeffeeeeeeedfdccbaZYYXZZaabbcefgijklnoppqqsrqqqppomlmmllkjjiihjiiiihhhhgigffedcbaaccccddddddeedddddddcdcbbaZYYXXYYYZZZZZZZaaaaaaaaaZaaZZYXXWWWXXXXYXYYYYZZZZaZZZZZbaaaaaZZZZaaaaaaaaaaaaaaaZZZZZZZYYYXXXXWXXXXXXXYaadefhkmopqrtuuwxxyzyxyyxwvtsqpoqpooonnmmlnmlllllkkklkkkkjjjiijiiiiihhhhhhhggggggfggfffffffefffffeeeedeeddddddcccccccbbbbbbbaaaaaaaZaZZZZZZZZYZYYYYYYYYXYXXXXXXXWWWWWWWWWVVVVVVVVUVWXYacdfilorttwyz124677687665320zxzxwwwvvuttuttttttt&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5446,0.4&chxt=x,y&chxl=0:|0|sec=583|1:|0|avg=121786|max=223632&chxp=1,1,54,100&chtt=Priest_Shadow_T15H_FDCL_ToF DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,1,3,4,7,20,51,73,116,180,257,310,434,530,619,727,856,971,1023,1097,1203,1261,1217,1272,1290,1262,1191,1183,1187,1171,1138,988,830,703,558,434,314,220,113,88,46,24,8,6,2,0,1,2&chds=0,1290&chbh=5&chxt=x&chxl=0:|min=73763|avg=121786|max=165835&chxp=0,1,52,100&chtt=Priest_Shadow_T15H_FDCL_ToF DPS Distribution&chts=dddddd,18,s,333333&chd=t:25.4,22.6,9.5,8.3,4.0,3.9,3.6,1.8,1.2,0.7,16.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 115.4s|shadow_word_pain 102.6s|mind_blast 42.9s|mind_spike 37.5s|vampiric_touch 18.2s|devouring_plague 17.5s|shadow_word_death 16.2s|halo 8.0s|dispersion 5.4s|shadowfiend 3.4s|waiting 76.0s&chtt=Priest_Shadow_T15H_FDCL_ToF Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T15H_FDCL_ToF 121786
devouring_plague 7105 (22274) 5.9% (18.4%) 16.2 27.52sec 622117 577154 155191 327619 198392 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.23 16.23 0.00 0.00 1.0780 0.0000 3219849.20 3219849.20 0.00 577154.38 577154.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.16 74.94% 155191.43 127714 251445 155197.46 129066 190065 1887632 1887632 0.00
crit 4.07 25.06% 327619.39 255428 603468 324517.23 0 584829 1332217 1332217 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|<20&cooldown.shadow_word_death.remains<1.5)
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.786000
  • base_dd_min:1643.25
  • base_dd_max:1643.25
devouring_plague_mastery 4137 3.4% 56.8 7.52sec 33003 0 26010 53971 33049 25.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.83 56.75 0.00 0.00 0.0000 0.0000 1875595.15 1875595.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.46 74.82% 26009.78 21286 41908 26017.83 22437 31079 1104495 1104495 0.00
crit 14.29 25.18% 53970.65 42573 100580 53959.29 43073 76462 771100 771100 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.131000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 11032 9.1% 16.2 27.52sec 308158 0 0 0 0 0.0% 0.0% 0.0% 0.0% 152.7 25824 53530 32747 25.0% 0.0% 22.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.23 16.23 152.73 152.73 0.0000 0.6535 5001294.40 5001294.40 0.00 50109.15 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.6 75.01% 25824.29 21286 41908 25831.45 22536 30304 2958514 2958514 0.00
crit 38.2 24.99% 53529.92 42573 100580 53517.09 44206 66452 2042780 2042780 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=9565} Shadow damage and an additional {$s5=1594} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.{$?s139139=false}[ While Devouring Plague is active, damage from your Mind Flay is increased by 33% per orb consumed][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.131000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.7 151.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 7.4 0 0 0 0.0% 0.0% 1.1%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.70 1.70 7.39 7.39 3.1820 0.6641 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.4 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3053) 0.0% (2.5%) 7.4 59.86sec 185455 172010 0 0 0 24.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.38 7.38 0.00 0.00 1.0782 0.0000 0.00 0.00 0.00 172010.21 172010.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.55 75.24% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.83 24.76% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.
halo_damage 3053 2.5% 7.4 59.86sec 185455 0 145701 305195 185451 24.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.38 7.38 0.00 0.00 0.0000 0.0000 1369029.28 1369029.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.54 75.07% 145700.59 126806 232311 145641.00 0 225888 807460 807460 0.00
crit 1.84 24.93% 305194.95 253612 557545 266271.09 0 557545 561569 561569 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 7.4 59.86sec 0 0 0 0 0 27.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 7.38 92.10 0.00 0.00 0.0000 0.0000 0.00 22381915.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.37 72.06% 0.00 0 0 0.00 0 0 0 12287024 100.00
crit 25.73 27.94% 0.00 0 0 0.00 0 0 0 10094892 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T15H_FDCL_ToF
  • harmful:true
  • if_expr:
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=34814 to 44923} Shadow damage to enemies, and up to {$120696s1=58024 to 74871} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13504 11.1% 39.7 10.97sec 153348 141831 120386 252573 153349 24.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.72 39.72 0.00 0.00 1.0812 0.0000 6090669.35 6090669.35 0.00 141831.48 141831.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.81 75.06% 120385.60 101791 201721 120359.95 105680 138160 3589143 3589143 0.00
crit 9.90 24.94% 252573.22 203582 484130 252438.07 203582 360370 2501527 2501527 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=21931 to 22083} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.909000
  • base_dd_min:2692.00
  • base_dd_max:2844.25
mind_flay 13274 (18229) 10.9% (15.0%) 83.3 5.08sec 98787 71263 0 0 0 0.0% 0.0% 0.0% 0.0% 147.1 31923 67044 40711 25.0% 0.0% 20.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.25 83.25 147.10 147.10 1.3862 0.6441 5988622.04 5988622.04 0.00 71262.96 71262.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.3 74.98% 31922.77 27086 53323 31924.08 28450 36736 3520767 3520767 0.00
crit 36.8 25.02% 67044.04 54172 127976 67008.24 57342 82056 2467855 2467855 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4955 4.1% 54.8 7.57sec 40761 0 31966 67149 40783 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.85 54.82 0.00 0.00 0.0000 0.0000 2235550.66 2235550.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.08 74.94% 31965.58 27086 53323 31965.31 28154 38312 1313085 1313085 0.00
crit 13.74 25.06% 67149.44 54172 127976 67102.94 54172 88990 922465 922465 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 9730 8.0% 34.9 11.47sec 125328 116673 98307 206636 125329 24.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.91 34.91 0.00 0.00 1.0742 0.0000 4375570.94 4375570.94 0.00 116672.56 116672.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.20 75.06% 98307.21 82570 164352 98272.92 83667 124155 2576090 2576090 0.00
crit 8.71 24.94% 206636.34 165140 394445 206482.63 0 352079 1799481 1799481 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=14446 to 14518} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 5695 4.7% 15.0 5.59sec 172750 159743 135283 282751 172755 25.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.99 14.99 0.00 0.00 1.0814 0.0000 2589274.26 2589274.26 0.00 159743.00 159743.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.18 74.59% 135283.47 99326 197422 135671.33 112046 182090 1512471 1512471 0.00
crit 3.81 25.41% 282750.55 198652 473815 279188.93 0 473815 1076804 1076804 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=21089} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 16078 (22070) 13.2% (18.1%) 95.5 4.47sec 104175 96936 0 0 0 0.0% 0.0% 0.0% 0.0% 302.7 18764 39418 23937 25.0% 0.0% 88.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.46 95.46 302.66 302.66 1.0747 1.3283 7244717.51 7244717.51 0.00 19706.54 96935.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 226.9 74.95% 18763.72 15883 31260 18764.76 16407 21733 4256683 4256683 0.00
crit 75.8 25.05% 39418.01 31767 75024 39400.93 34064 45960 2988035 2988035 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&!ticking
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5991 4.9% 112.7 3.82sec 23952 0 18782 39471 23965 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.71 112.65 0.00 0.00 0.0000 0.0000 2699539.97 2699539.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.42 74.95% 18781.83 15883 31260 18783.32 16581 21703 1585624 1585624 0.00
crit 28.22 25.05% 39470.53 31767 75024 39453.94 33438 48652 1113916 1113916 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.1 180.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.10 3.10 0.00 0.00 1.0841 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 6247 5.1% 94.5 4.54sec 29800 0 23629 49616 30157 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.52 93.40 0.00 0.00 0.0000 0.0000 2816629.84 2816629.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.94 74.88% 23629.13 19798 39398 23621.88 20484 27469 1652618 1652618